Способ для применения в терапии



Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии
Способ для применения в терапии

 


Владельцы патента RU 2579659:

АЦ ИММУНЕ С.А. (CH)

Настоящее изобретение относится к биохимии, в частности к применению антигенной композиции, включающей антигенный пептид, происходящий из амилоидного белка или амилоидоподобного белка для лечения заболевания, состояния или расстройства, которое вызвано или связано с указанным белком, в популяции пациентов, страдающих от недостаточности Т-клеток при индукции иммунного ответа. Указанный антигенный пептид модифицирован липофильной или гидрофобной частью молекулы, которая облегчает инсерцию в липидный двойной слой липосомного носителя/адъюванта, и презентирован в виде часто повторяющейся матрицы на поверхности липосомы. Указанную антигенную композицию применяют в способе лечения заболевания, состояния или расстройства, которое связано или вызвано амилоидным белком или амилоидоподобным белком, в количестве, достаточном для индукции независимого от Т-клеток иммунного ответа. Настоящее изобретение позволяет использовать указанную антигенную композицию по новому медицинскому применению, а именно для лечения заболеваний, при которых желательны ответы в виде выработки антител, независимых от Т-хелперов, например у животных или людей с иммунной недостаточностью или аутоиммунными заболеваниями, такими как болезнь Альцгеймера. 2 н. и 49 з.п. ф-лы, 22 ил., 6 табл., 6 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к способам индукции иммунного ответа, не зависящего от Т-клеток, у индивидуума, в частности животного или человека, при лечении заболевания или расстройства у пациента, в частности заболеваний и расстройств, которые вызваны или ассоциированы с амилоидом или амилоидоподобными белками, или с тау-белком или с тау-подобными белками, в частности болезни Альцгеймера.

В частности, настоящее изобретение относится к способам терапевтического и диагностического применения для лечения заболеваний и расстройств, которые вызваны или связаны с амилоидом амилоидоподобными белками, включая амилоидоз - группу заболеваний и нарушений, ассоциированных с амилоидным белком, например, болезнь Альцгеймера. Настоящее изобретение дополнительно относится к способам и композициям терапевтического и диагностического применения для лечения заболеваний и расстройств, которые вызваны или связаны с нейрофибриллярными узлами. В частности, настоящее изобретение относится к способам и композициям терапевтического и диагностического применения для лечения таупатий, включая болезнь Альцгеймера (БА).

Предпосылки создания изобретения

Антигены традиционно классифицируют на Т-зависимые и Т-независимые антигены (Alugupulli 2008). Белки и пептиды относятся Т-зависимым антигенам, поскольку они индуцируют антиген-специфические Т-клетки, которые способствуют В-клеткам путем обеспечения когнитивных и некогнитивных взаимодействий. Многие вакцины представляют Т-зависимые антигены. Т-зависимые антигены обычно требуют многих активных иммунизации для выработки ответного антитела.

Антигены, которые индуцируют ответы в виде выработки антитела без Т-хелперных клеток, относятся к Т-независимым антигенам (Bachmann и Zinkernagel, 1997). Эти антигены индуцируют ответ в виде выработки антитела при отсутствии Т-хелперных клеток in vivo, например, у бестимусных голых мышей (nu/nu). Т-независимые антигены являются типичными антигенами, которые не могут стимулировать ответ Т-клеток, поскольку они не могут обрабатываться и презентироваться молекулами главного комплекса гистосовместимости II (ГКГ-П). Липополисахариды (ЛПС) и бактериальные полисахариды обычно являются типичными антигенами, независящими от Т-клеток. Кроме того, некоторые белки определенных вирусов и бактерий могут стимулировать ответ в виде антитела в отсутствии Т-клеток, наиболее вероятно из-за их повторяющейся структуры, которая может эффективно перекрестие связывать рецептор В-клеток (BCR). Размножение В-клеток и выраженные титры антител индуцируются намного быстрее при независящих от Т-клеток антигенах, чем при зависящих от Т-клеток антигенов.

Обычно В-клетки не полностью активируются для пролиферации и выработки иммуноглобулина (Ig) простым перекрестным связыванием Ig на поверхности В-клеток. Для достижения оптимальной выработки антитела требуется второй сигнал, а именно сигнал, посылаемый Т-хелперными клетками. Антигены связываются с Ig на поверхности В-клеток, который интернализуется и затем передается в контексте молекул класса II главного комплекса гистосовместимости антиген-специфическим Т-хелперным клеткам. Кроме того, В-клетки экспрессируют CD40 а также В7 (CD86), взаимодействуя с лигандом CD40 (CD40L) и CD28, соответственно, на Т-клетках, тем самым, индуцируя секрецию цитокина Т-клетками, что дополнительно модулирует ответ В-клеток. Эти цитокины индуцируют пролиферацию В-клеток и дифференциацию в клетки, вырабатывающие антитело (клетки плазмы). Такое переключение изотипа на IgG, IgA или IgE называют класс-переключающей рекомбинацией (Class Switch Recombination - CSR). Если такое переключение происходит, определенная В-клетка не может больше производить другие изотипы - IgM или IgD.

Хотя огромное количество антигенов нуждаются в помощи Т-клеток для активирования В-клеток и поэтому называются антигенами, зависящими от помощи Т-клеток (T-cell help dependent antigens - антигены TD), меньшинство антигенов может индуцировать антитела, независящие от помощи Т-клеток, так называемые антигены TI (T-cell help independent antigens - антигены TI) (Mond JJ, Vos Q, Lees A, Snapper CM, Curr Opin Immunol 7, 1995, cc.349-354). Исходя из их иммуногенности у мышей с врожденным отсутствием тимуса (мыши линии nu/nu) и у мышей с Х-связанным иммунным дефектом В-клеток (мыши линии xid, утратившие функцию тирозинкиназы Бартона), антигены TI дополнительно обычно подразделяют на антигены TI типа 1 (TI-1) и антигены TI типа 2 (TI-2). Антигены TI-1 стимулируют превосходные ответы в виде антител у мышей nu/nu и мышей xid. Антигены TI-2 также стимулируют превосходные ответы в виде антител у мышей nu/nu, но не у мышей xid. Антигены TI-1 содержат поликлональные активаторы В-клеток, которые обычно являются липосолисахаридами (ЛПС). Напротив, антигены TI-2 являются типично антигенами, состоящими из повторяющихся биохимических структур, например, полимерные белковые антигены или капсульные полисахариды бактерий. Большинство пептидных или белковых вакцин основано на том, что и В-клетки, и Т-клетки активируются, и ответ в виде выработки антител является зависимым от Т-клеток. При этом могут возникнуть сложности у пациентов с дефицитом Т-клеток из-за возраста, иммуносупрессии или заболеваний.

При старении иммунная система проявляет изменения, которые выражаются в числе Т-клеток и их качестве, которые являются прямым последствием инволюции тимуса. Тимус - центральный лимфоидный орган, который расположен в верхней передней части грудной клетки непосредственно над сердцем, ответственный за развитие, отбор и выработку зрелых не подвергнутых какому-либо воздействию Т-клеток на периферию в процессе, называемом тимопоэзом. По мере старения тимус дегенерирует. В результате выработка не подвергнутых какому-либо воздействию Т-клеток резко снижается с возрастом. Сниженная продуктивность тимуса вместе с длительным воздействием антигенов приводит к уменьшению пула не подвергнутых какому-либо воздействию Т-клеток у пожилых субъектов и, следовательно, к ограничениям способности организма хозяина отвечать на новые антигены. Это особенно тревожно, если пожилые индивидуумы сталкиваются с вновь возникшими заболеваниями, например, тяжелым острым респираторным синдром (ТОРС), при котором умирает более 50% зараженных людей в возрасте старше 50 лет. Кроме того, не подвергнутые какому-либо воздействию Т-клетки, которые обнаруживают в пожилом возрасте, находятся в течение десятилетий на периферии и подвергаются воздействию ряда факторов, например, окислительному стрессу и ограниченным концентрациям факторов выживания, что может оказывать отрицательное воздействие на функцию клеток. Не подвергнутые какому-либо воздействию CD4+ Т-клетки, полученные от старых животных, при сравнении с клетками, полученными от молодых мышей, вырабатывают значительно меньше IL-2, плохо развиваются и вызывают меньше эффекторов, обладают менее активированным фенотипом и сниженной способностью к выработке цитокинов. Однако вновь выработанные CD4+ Т-клетки у старых животных весьма эффективно отвечают на антигены in vivo и in vitro, способны развиваться, вырабатывают IL-2 и проявляют когнитивную хелперную функцию. Таким образом, возрастные дефекты в ответ на стимуляцию антигеном могут быть вызваны, по меньшей мере частично, хронологическим возрастом CD4+ Т-клеток.

CD4+ Т-клетки памяти являются центральными в регуляции гуморального и клеточного ответа, и поэтому их долгая жизнеспособность и ответ на вакцинацию принципиально важны для поддержания защитного иммунитета. Т-клетки памяти, выработанные из возрастных не подвергнутых какому-либо воздействию Т-клеток, хорошо выживают и сохраняются in vivo, но они обладают выраженным дефектом, касающимся пролиферации и секреции цитокина во время вновь востребованных ответов, несмотря на то, что клетки памяти, выработанные у молодых индивидуумов, сохраняют функцию в течение продолжительного периода до старения их организма-хозяина. Эти данные, полученные при исследовании животных, недавно были подтверждены у людей. Здоровые пожилые индивидуумы могут поднять ответ CD4+ Т-клеток до сопоставимого с ответом у более молодых индивидуумов при вакцинации против гриппа, но они проявляют уменьшенный долгосрочный иммунный ответ CD4+ Т-клеток на вакцину от гриппа.

Недостаточность Т-клеток, однако, действительно является не только следствием старения, но также может быть обнаружена у пациентов с иммунной недостаточностью или у пациентов с некоторыми заболеваниями, например, с ВИЧ, раком или другими опасными заболеваниями.

Краткое описание изобретения

В одном из вариантов осуществления настоящего изобретения получают антигенную композицию, включающую пальмитилированный пептид, презентированный на липосомах, комбинированных с монофосфорильным липидом А (МФЛА), причем вакцина является независимой от Т-клеток. Пептид находится в конформации бета-слоя. Такая вакцина индуцирует быстрые и сильные ответы в виде выработки антител. Это не зависит от другого белка-носителя и может индуцировать ответы в виде выработки антител в отсутствие Т-клеток, что продемонстрировано путем индукции антитела у голых мышей. В итоге она индуцирует сильный и эффективный ответ в виде выработки антитела у старых мышей, несмотря на нехватку Т-клеток в таком старом возрасте (Miller R.A. и др., 1996; Adolfsson О. и др., 2001; Linton P.J. и др. 1996).

Краткое описание свойств вакцины

• Специфическая конформация (бета-слой)

• Сильный ответ (1000000 нг/мл на 7 сутки после иммунизации)

• Быстрая ответная реакция (7 суток после иммунизации)

• Не требуется поддержки Т-клеток

• Не требуется носитель белка.

• Эффективна у мышей пожилого возраста, несмотря на недостаточность Т-клеток в таком пожилом возрасте.

Аβ антигенные композиции известны в предшествующем уровне техники, например, AN 1792 от компании Elan Inc (Калифорния, США), и обычно являются типичными Т-зависимыми антигенами (Аβ1-42), введенными вместе с сильным Th1 стимулирующим адъювантом (QS21). Первоначальное исследование AN 1792 у пациентов с болезнью Альцгеймера показывает обнадеживающую эффективность, отличающуюся более медленной степенью когнитивного снижения у пациентов, которые получили вакцинацию, по сравнению с пациентами, получившими вакцинацию плацебо (Gilman и др., 2005). Однако у 6% подвергнутых лечению пациентов развивается менингоэнцефалит, предположительно в качестве реакции на опосредованный Т-клетками ответ против Аβ1-42 полной длины (Orgogozo и др. 2003). Хотя у большинства пациентов такой ответ в виде воспаления был обратим, он привел к прекращению клинического исследования.

Поэтому необходимы способы, в которых применение антигена, например, анти-Аβ антигена или анти-тау антигена, индуцирует ответ в виде антитела за счет прямого активирования В-клеток при отсутствии специфичных по антигену, т.е. Аβ- или тау-специфичных, Т-клеток для лечения, облегчения симптомов, задержки начала развития заболеваний или расстройств или для их предупреждения, например, заболеваний и расстройств, которые вызваны или ассоциированы с амилоидом или амилоидоподобными белками, включая амилоидоз - группу заболеваний и нарушений, ассоциированных с амилоидным белком, например, болезнь Альцгеймера, или заболевания и расстройства, вызываемые или ассоциированные с тау-белком, включая таупатии, у пациентов с недостаточностью Т-клеток, особенно у пациентов, у которых истощены CD4 Т-клетки. Особенно пальмитилированный пептид Аβ или тау-пептид, презентированные на липосомах в комбинации с МФЛА, индуцируют Аβ специфические антитела без необходимости в помощи Т-клеток и без потребности в белке-носителе, обеспечивающем помощь Т-клеток.

Настоящее изобретение предусматривает способ применения в терапии и диагностике при лечении, облегчении симптомов или предупреждении заболеваний и расстройств, включающий введение пациенту антигенной композиции, не зависящей от Т-клеток, включающей модифицированный антиген, причем указанный антиген презентирован в виде часто повторяющейся матрицы на поверхности липосом. В частности, указанные заболевания и расстройства, которые вызываются амилоидом или амилоид-подобными белками или связаны с ними, включают амилоидоз - группу заболеваний и нарушений, ассоциированных с амилоидным белком, например, болезнь Альцгеймера, заболевания и расстройства, которые вызваны или ассоциированы с тау-белком, включая таупатии, у пациента, особенно у пациента с иммунной устойчивостью, особенно у пациента с недостаточностью Т-клеток, особенно с недостаточностью Т-клеток, которая вызывается истощением у указанных пациентов CD4 Т-клеток и/или пониженной экспрессией CD14 и/или CD40L на Т-клетках CD4, например, у пациента с ослабленным иммунитетом или у пациента с аутоиммунным заболеванием.

Кроме того, неожиданно было установлено в рамках охвата настоящего изобретения, что заболевания у пациентов, нуждающихся в иммунном ответе, независящем от Т-клеток, особенно у пациентов с иммунной устойчивостью, особенно у пациентов с Т-клеточным иммунодефицитом, можно избежать у индивидуума, особенно у животного или человека, причем индивидуум может быть или вакцинирован до начала развития заболевания, например, ассоциированного с амилоидом или тау-белком, или в случае заболевания или состояния, ассоциированного с амилоидом или тау-белком, индивидуума можно лечить способом, описанным в настоящем изобретении.

Техническая проблема, лежащая в основе настоящего изобретения, заключается в получении способа терапевтического и диагностического применения антигенной композиции для лечения, облегчения симптомов или предупреждения заболеваний или расстройств у пациента, особенно у пациента, нуждающегося в независящем от Т-клеток иммунном ответе, например, у пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, причем независящий от Т-клеток иммунный ответ индуцируется у подвергшихся лечению индивидуумов. В частности, заболеваниями и расстройствами, подвергаемыми лечению в рамках охвата настоящего изобретения, являются, например, заболевания и расстройства, вызываемые или ассоциированные с амилоидом или амилоидоподобными белками, включая амилоидоз - группу заболеваний и нарушений, ассоциированных с амилоидным белком, например, болезнь Альцгеймера, или заболевания и расстройства, вызываемые или ассоциированные с тау-белком, включая таупатии.

Технические проблемы решаются с помощью вариантов осуществления настоящего изобретения, представленных в формуле изобретения.

Таким образом, настоящее изобретение относится в первом варианте своего осуществления к антигенной композиции, включающей модифицированный антиген для индукции иммунного ответа, независящего от Т-клеток, при лечении заболевания, состояния или расстройства у пациента, особенно животного или человека, особенно пациента, нуждающегося в таком независящем от Т-клеток ответе, например, пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, причем указанный антиген расположен на поверхности липосомы.

В одном из вариантов осуществления настоящего изобретения антигенная композиция, согласно описанию настоящего изобретения, эффективна в качестве стимулятора иммунитета.

В одном из вариантов осуществления настоящего изобретения указанный антиген является пептидным антигеном, который презентирован в виде часто повторяющейся матрицы на поверхности липосом. В другом варианте осуществления настоящего изобретения указанный антиген не содержит эпитопа Т-клеток.

В одном из вариантов осуществления настоящего изобретения антигенная композиция, согласно описанию настоящего изобретения, применяется для лечения пациента с иммунной устойчивостью или пациента с активированными Т-клетками, особенно пациента с ослабленным иммунитетом, особенно пациента с аутоиммунным заболеванием, особенно пациента с недостаточностью Т-клеток, особенно с недостаточностью Т-клеток, вызванной истощением у указанных пациентов CD4 Т-клеток и/или сниженной экспрессией CD14 и/или CD40L на CD4 Т-клетках.

В одном из вариантов осуществления настоящее изобретение относится к описанной антигенной композиции настоящего изобретения, причем указанная недостаточность Т-клеток вызвана пожилым возрастом, ослабленным иммунитетом или заболеванием, особенно заболеванием, выбранным из группы, включающей ВИЧ, рак или другие опасные заболевания, включающие, например, воспалительные заболевания, которые лечат иммуносупрессирующими и химиотерапевтическими соединениями, соответственно, приводящими к состоянию подавления иммунитета у пациентов, например, к ревматоидному артриту, псориазу, системной красной волчанки, гранулематоза Вегенера и др. В одном из вариантов осуществления настоящего изобретения описанная в нем антигенная композиция включает конформационный антиген, причем весь или часть указанного антигена являются по конформации бета-слоем. В одном из вариантов осуществления настоящего изобретения указанный антигенный пептид модифицирован таким образом, что он способен поддерживать и стабилизировать определенную конформацию антигена, особенно конформацию, которая отличается сбалансированным соотношением частей случайной спирали, α-спирали и β-слоя. Такая определенная конформация приводит к индукции сильного и высокоспецифичного иммунного ответа, особенно независящего от Т-клеток иммунного ответа, при интродукции животному или человеку.

В частности антигенная композиция по настоящему изобретению согласно приведенному описанию может включать конформационный антиген, в котором более 30%, особенно более 40%, особенно более 50%, особенно более 60%, особенно более 70%, особенно более 80%, особенно более 90%, особенно более 95% и до 100% представлено конформацией бета-слоя.

В одном из вариантов осуществления настоящего изобретения описанная антигенная композиция по настоящему изобретению включает пептидный антиген, который модифицирован липофильной или гидрофобной частью молекулы, особенно, жирной кислотой, триглицеридом, диглицеридом, стероидом, сфинголипидом, гликолипидом или фосфолипидами, которые способствуют инсерции в двойной липидный слой липосомы.

В одном из вариантов осуществления настоящего изобретения липофильной или гидрофобной частью молекулы является жирная кислота, особенно жирная кислота с углеродным каркасом молекулы по меньшей мере из 10 атомов углерода, особенно пальмитиновая кислота.

В другом варианте осуществления настоящего изобретения описанная антигенная композиция по настоящему изобретению включает пептидный антиген, включающий две части молекулы, представленные пальмитиновой кислотой, особенно четыре части молекулы, представленные пальмитиновой кислотой.

В еще одном из вариантов осуществления настоящего изобретения размер липофильной или гидрофильной части молекулы в комбинации с общим результирующим зарядом антигенного пептида и носителя/адъюванта, к которым пептид присоединяется, в которые пептид встраивается или в которых пептид восстанавливается таким образом, что антигенный пептид располагается, стабилизируется и презентируется в биологически высоко активной конформации, которая позволяет иммунной системе организма-мишени свободно взаимодействовать с антигенными детерминантами, содержащимися в антигенной конструкции, в ее доступной, стабилизированной и высоко биологически активной конформации, которая приводит к сильному иммунному ответу.

В одном из вариантов осуществления настоящего изобретения описанная антигенная композиция по настоящему изобретению включает липосомный препарат и адъювант, особенно липид А, особенно детоксифицированный липид А, например, монофосфорильный или дифосфорильный липид А, или алюминий гидроксид.

В одном из вариантов осуществления настоящего изобретения описанная антигенная композиция по настоящему изобретению включает антигенную конструкцию, особенно антигенную конструкцию Аβ, включающую один или повторяющийся фрагмент пептида Аβ, производный от N-конца пептида Аβ.

В одном из вариантов осуществления настоящего изобретения N-конец пептида Аβ включает

а) Аβ 1-30,

б) Аβ 1-20 или

в) Аβ 1-16.

В другом варианте осуществления настоящего изобретения фрагмент пептида Аβ включает

а) от 4 до 20 аминокислот,

б) от 5 до 16 аминокислот,

в) от 6 до 12 аминокислот, или

г) от 4 до 8 аминокислот.

В еще одном из вариантов осуществления настоящего изобретения фрагментом пептида Аβ является

a) Аβ1-15,

6) Аβ1-16,

в) Аβ1-5.

В одном из вариантов осуществления настоящего изобретения описанная антигенная композиция по настоящему изобретению включает антигенную конструкцию, содержащую антигенный пептид, который является фосфо-пептидом, мимикрирующим крупный патологический фосфо-эпитоп тау-белка, особенно тау-белка человека.

В одном из вариантов осуществления настоящего изобретения указанный тау-белок обладает аминокислотной последовательностью, идентичной в отношении:

а) последовательности SEQ ID NO: 2 по меньшей мере на 95% и указанный тау-белок обладает в существенной степени тем же иммуногенным действием, что и указанный антигенный пептид последовательности SEQ ID NO: 2, причем аминокислотный остаток, соответствующий аминокислотному остатку 18 (Р-Tyr18) последовательности SEQ ID NO: 2, является фосфорилированным (Т1),

б) последовательности SEQ ID NO: 3 по меньшей мере на 95% и указанный тау-белок обладает в существенной степени тем же иммуногенным действием, что и указанный антигенный пептид последовательности SEQ ID NO: 3, причем по меньшей мере один, особенно по меньшей мере 2 аминокислотных остатка, соответствующих аминокислотным остаткам 212 (Р-Thr212) и 214 (P-Ser214) последовательности SEQ ID NO: 3, являются фосфорилированными,

в) последовательности SEQ ID NO: 4 по меньшей мере на 95% и указанный тау-белок обладает в существенной степени тем же иммуногенным действием, что и указанный антигенный пептид последовательности SEQ ID NO: 4, причем по меньшей мере один, особенно по меньшей мере 2 аминокислотных остатка, соответствующих аминокислотным остаткам 202 (P-Ser202) и 205 (Р-Thr205) последовательности SEQ ID NO: 4, являются фосфорилированными,

г) последовательности SEQ ID NO: 5 по меньшей мере на 95% и указанный тау-белок обладает в существенной степени тем же иммуногенным действием, что и указанный антигенный пептид последовательности SEQ ID NO: 5, причем по меньшей мере один, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 396 (Р-Ser396) и 404 (P-Ser404) последовательности SEQ ID NO: 5, являются фосфорилированными,

д) последовательности SEQ ID NO: 6 по меньшей мере на 95% и указанный тау-белок обладает в существенной степени тем же иммуногенным действием, что и указанный антигенный пептид последовательности SEQ ID NO: 6, причем по меньшей мере один, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 404 (P-Ser404) и 409 (P-Ser409) последовательности SEQ ID NO: 6, являются фосфорилированными,

е) последовательности SEQ ID NO: 7 по меньшей мере на 95%, и указанный тау-белок обладает в существенной степени тем же иммуногенным действием, что и указанный антигенный пептид последовательности SEQ ID NO: 7, причем по меньшей мере один, особенно по меньшей мере 2, особенно по меньшей мере 3, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 202 (P-Ser202), 205 (P-Thr205). 212 (P-Thr212) и 214 (P-Ser214) последовательности SEQ ID NO: 7, являются фосфорилированными.

В другом варианте осуществления настоящего изобретения описанная антигенная композиция по настоящему изобретению включает тау-белок с аминокислотной последовательностью:

а) SEQ ID NO: 2,

б) SEQ ID NO: 3,

в) SEQ ID NO: 4,

г) SEQ ID NO: 5,

д) SEQ ID NO: 6 или

е) SEQ ID NO: 7.

В еще одном из вариантов осуществления настоящее изобретение относится к антигенной композиции какого-либо из ранее описанных вариантов осуществления настоящего изобретения, включающей модифицированный антиген для применения в лечении заболевания, состояния или расстройства у пациента, особенно животного или человека, особенно у пациента, нуждающегося в независимом от Т-клеток ответе, например, у пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, особенно у пациента с ослабленным иммунитетом, особенно у пациента с аутоиммунным заболеванием, особенно у пациента с недостаточностью Т-клеток, особенно с недостаточностью Т-клеток, вызванной истощением у указанных пациентов CD4 Т-клеток и/или пониженной экспрессией CD14 и/или CD40L на CD4 Т-клетках, чтобы преодолеть или уменьшить иммунную устойчивость у указанного пациента, причем указанный антиген презентирован в виде часто повторяющейся матрицы на поверхности липосом и у указанного пациента имеется заболевание или расстройство, вызванное или ассоциированное с амилоидом или амилоидоподобными белками.

В еще одном из вариантов осуществления настоящее изобретение относится к антигенной композиции по одному из ранее описанных вариантов осуществления настоящего изобретения, включающей модифицированный антиген для применения в лечении заболевания, состояния или расстройства у пациента, особенно животного или человека, особенно у пациента, нуждающегося в независимом от Т-клеток ответе, например, у пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, особенно у пациента с ослабленным иммунитетом, особенно у пациента с аутоиммунным заболеванием, особенно у пациента с недостаточностью Т-клеток, особенно с недостаточностью Т-клеток, вызванной истощением у указанных пациентов CD4 Т-клеток и/или пониженной экспрессией CD 14 и/или CD40L на CD4 Т-клетках, чтобы преодолеть или уменьшить иммунную устойчивость у указанного пациента, причем указанный антиген презентирован в виде часто повторяющейся матрицы на поверхности липосомы и у указанного пациента имеется заболевание или расстройство, вызванное или ассоциированное с тау-белком или тау-подобными белками.

В одном из вариантов осуществления настоящего изобретения амилоид-ассоциированное заболевание или расстройство отличается потерей когнитивного объема памяти у индивидуума, особенно у животного или человека.

В другом варианте осуществления настоящего изобретения указанное заболевание является неврологическим заболеванием или расстройством, особенно заболеванием или расстройством из группы амилоидозов, особенно заболеванием или расстройством, выбранным из группы, состоящей из болезни Альцгеймера (БА), умеренного когнитивного нарушения (УКН), деменции с тельцами Леви, синдрома Дауна, наследственной церебральной геморрагией с амилоидозом исландского типа, комплекса паркинсонизма-деменции с острова Гуам, прогрессирующего супрануклеарного паралича, рассеянного склероза, болезни Крейцфельдта-Якоба, болезни Паркинсона, слабоумия, связанного с ВИЧ, амиотрофического бокового склероза (АБС), сахарного диабета взрослых, эндокринных опухолей, инсульта, травматических повреждений мозга, дегенерации желтого пятна и глаукомы.

В одном из вариантов осуществления настоящего изобретения указанным заболеванием является болезнь Альцгеймера.

В еще одном из вариантов осуществления настоящего изобретения заболевание или расстройство, ассоциированные с тау-белком, являются нейродегенеративным заболеванием, особенно нейродегенеративным заболеванием или расстройством, которое вызвано или ассоциировано с формированием нейрофибриллярных повреждений.

В одном из вариантов осуществления настоящего изобретения нейродегенеративное заболевание или расстройство является таупатией, особенно выбранной из группы, включающей болезнь Альцгеймера (БА), болезнь Крейцфельдта-Якоба, деменцию боксеров, синдром Дауна, синдром Герстманна-Штройслера-Шейнкера, миозит с включенными тельцами и церебральную амилоидную ангиопатию прионного белка, травматические повреждения мозга, амиотрофический боковой склероз/комплекс паркинсонизма-деменции с острова Гуам, заболевание двигательных нейронов с нейрофибриллярными сплетениями, не являющееся заболеванием с острова Гуам, аргирофильную зернистую деменцию, кортико-базальную дегенерацию, диффузные нейрофибриллярные узлы с кальцификацией, лобно-височное слабоумие с паркинсонизмом, связанное с хромосомой 17, болезнь Галлервордена-Шпатца, множественную системную атрофию, болезнь Ниманна-Пика, тип С, болезнь Пика, прогрессивный субкортикальный глиоз, прогрессирующий супрануклеарный паралич, подострый склерозирующий панэнцефалит, исключительно клубочковую деменцию, постэнцефалитический паркинсонизм, миотоническую дистрофию.

В одном из вариантов осуществления настоящего изобретения указанным нейродегенеративным расстройством является болезнь Альцгеймера.

В одном из объектов по настоящему изобретению антигенная композиция по какому-либо из ранее описанных вариантов осуществления настоящего изобретения не проявляет каких-либо побочных воспалительных эффектов.

В одном из вариантов осуществления настоящее изобретение относится к способу применения антигенной композиции, включающей модифицированный антиген по одному из ранее описанных вариантов осуществления настоящего изобретения для получения лекарственного средства для индукции иммунного ответа, независящего от Т-клеток, при лечении заболевания, состояния или расстройства у пациента, особенно у животного или человека, особенно у пациента, нуждающегося в таком независящем от иммунной системы ответе Т-клеток, причем указанный антиген презентирован в виде часто повторяющейся матрицы на поверхности липосом.

В одном из вариантов осуществления настоящего изобретения указанная антигенная композиция эффективна в качестве стимулятора иммунитета.

В одном из вариантов осуществления настоящее изобретение относится к способу применения антигенной композиции, включающей модифицированный антиген по одному из ранее описанных вариантов осуществления настоящего изобретения для получения лекарственного средства для применения в лечении пациента с устойчивым иммунитетом или пациента с активированными Т-клетками, особенно животного или человека, особенно пациента с ослабленным иммунитетом, особенно пациента с аутоиммунным заболеванием, особенно пациента с недостаточностью Т-клеток, особенно с недостаточностью Т-клеток, которая вызвана истощением у указанных пациентов CD4 Т-клеток и/или пониженной экспрессией CD14 и/или CD40L на CD4 Т-клетках, чтобы преодолеть или уменьшить иммунную устойчивость у указанного пациента или избежать повышенной стимуляции ответа Т-клеток у указанного пациента, причем указанный антиген презентирован в виде часто повторяющейся матрицы на поверхности липосом.

В настоящее изобретение также включен способ индукции независящего от Т-клеток иммунного ответа при лечении заболевания, состояния или расстройства у пациента, особенно животного или человека, особенно у пациента, нуждающегося в таком независящем от Т-клеток ответе, причем указанный антиген презентирован в часто повторяющейся матрице на поверхности липосом.

В одном из вариантов осуществления настоящего изобретения указанная антигенная композиция эффективна в качестве иммунного стимулятора.

В настоящее изобретение также включен способ преодоления или снижения иммунной устойчивости у пациента с иммунной устойчивостью или способ, позволяющий избежать повышенную стимуляцию ответа Т-клеток у пациента с активированными Т-клетками, при лечении заболевания или расстройства у указанного пациента, особенно животного или человека, особенно пациента с ослабленным иммунитетом, особенно пациента с аутоиммунным заболеванием, особенно пациента с недостаточностью Т-клеток, особенно с недостаточностью Т-клеток, которая вызвана истощением у указанных пациентов CD4 Т-клеток и/или пониженной экспрессией CD14 и/или CD40L на CD4 Т-клетках, включающий введение указанному пациенту антигенной композиции, включающей модифицированный антиген по одному из ранее описанных вариантов осуществления настоящего изобретения, в которой указанный антиген презентирован в виде часто повторяющейся матрицы на поверхности липосом, и необязательно дополнительную стадию определения иммунного ответа у указанного индивидуума путем измерения концентрации антитела IgG и/или IgM.

В другом варианте осуществления настоящее изобретение также относится к способу лечения, облегчения симптомов или предупреждения заболевания или состояния, особенно заболевания или состояния, ассоциированного с амилоидным белком или тау-белком, у пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, особенно животного или человека, причем пациента с недостаточностью Т-клеток, особенно с недостаточностью Т-клеток, которая вызвана истощением у указанных пациентов Т-клеток, особенно CD4 Т-клеток, например, пациента с ослабленным иммунитетом или пациента с аутоиммунным заболеванием, включающий введение указанному пациенту антигенной композиции, включающей модифицированный антиген по одному из ранее описанных вариантов осуществления настоящего изобретения, причем указанный антиген презентирован в виде часто повторяющейся матрицы на поверхности липосом и независящий от Т-клеток иммунный ответ индуцируется у подвергнутого лечению пациента.

Таким образом настоящее изобретение дополнительно относится к способу индукции независящего от Т-клеток иммунного ответа у пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, особенно к способу лечения, облегчения симптомов или задержки начала развития или предупреждения заболевания или расстройства у такого пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, у которого заболевание или расстройство вызвано или ассоциировано с амилоидом или амилоидоподобными белками, включая амилоидоз - группу заболеваний и нарушений, ассоциированных с амилоидным белком, например, болезни Альцгеймера, или заболеваний и расстройств, которые вызваны или ассоциированы с тау-белком, включая таупатии, у индивидуума, особенно у животного или человека, особенно у животного или человека, у которого истощены Т-клетки, особенно CD4 Т-клетки, например, у пациента с ослабленным иммунитетом или у пациента с аутоиммунным заболеванием, включающему следующие стадии (а) введения антигенной конструкции, особенно антигенной конструкции, включающей независящий от Т-клеток антиген, указанному индивидууму, и (б) определения иммунного ответа у указанного индивидуума, особенно путем измерения концентрации антитела IgG.

В одном из вариантов осуществления настоящего изобретения указанный индивидуум является пожилым человеком - пациентом с истощенным запасом Т-клеток, особенно CD4 Т-клеток, особенно пациентом с ослабленным иммунитетом или пациентом с аутоиммунным заболеванием.

В другом варианте осуществления настоящего изобретения указанный индивидуум является человеком - пациентом с ослабленным иммунитетом, у которого истощены Т-клетки, особенно CD4 Т-клетки.

В еще одном из вариантов осуществления настоящего изобретения указанный индивидуум является человеком - пациентом, у которого истощены Т-клетки, особенно CD4 Т-клетки, и имеется иммунная недостаточность, особенно в связи с ВИЧ.

В еще одном из вариантов осуществления настоящего изобретения указанный индивидуум является человеком - пациентом с раковым или другим опасным заболеванием и у которого истощены Т-клетки, особенно CD4 Т-клетки.

В другом варианте осуществления настоящего изобретения указанный индивидуум является человеком - пациентом, у которого истощены Т-клетки, особенно CD4 Т-клетки, и имеется аутоиммунное заболевание.

Настоящее изобретение дополнительно относится в другом варианте осуществления к способу индукции иммунного ответа, независящего от Т-клеток, особенно Аβ-иммунного ответа или связанного с тау-белком иммунного ответа, у индивидуума, особенно животного или человека, особенно у индивидуума, нуждающегося в таком независящем от Т-клеток Аβ-иммунном ответе, особенно у индивидуума или пациента с иммунной устойчивостью, у которого истощены Т-клетки, особенно CD4 Т-клетки, например, у пациента с ослабленным иммунитетом или у пациента с аутоиммунным заболеванием, включающему следующие стадии: (а) введения антигенной конструкции, особенно связанной с Аβ или тау-белком антигенной конструкции, особенно связанной с Аβ или тау-белком антигенной конструкции, включающей Т-независимый антиген, указанному индивидууму, и (б) определения иммунного ответа у указанного индивидуума, особенно путем измерения концентрации антитела IgG.

В другом варианте осуществления настоящее изобретение относится к способу по ранее описанному варианту осуществления настоящего изобретения, в котором указанный связанной с Аβ или тау-белком антиген индуцирует ответ в виде выработки антитела при отсутствии Т-хелперных клеток in vivo.

В другом варианте осуществления настоящее изобретение предусмотрен способ по одному из ранее описанных вариантов его осуществления, в которых указанный связанный с Аβ или тау-белком иммунный ответ представляет ответ в виде выработки IgG.

В одном из описанных вариантов осуществления настоящего изобретения предусмотрен способ, в котором индивидуум или пациент с иммунной устойчивостью или пациент с активированными Т-клетками, особенно животное или человек, особенно животное или человек, у которого истощены Т-клетки, особенно CD4 Т-клетки, не проявляет какого-либо побочного воспалительного эффекта.

В другом описанном варианте осуществления настоящего изобретения предусмотрен способ, в котором индивидуум или пациент с иммунной устойчивостью, особенно животное или человек, является недостаточным по Т-клеткам, особенно недостаточным по CD4 Т-клеткам, например, пациент с ослабленным иммунитетом или пациент с аутоиммунным заболеванием.

В ранее описанном другом варианте осуществления настоящего изобретения предусмотрен способ, в котором Аβ антигенная конструкция включает один или повторяющийся пептидный фрагмент Аβ, или производный от N-конца пептида Аβ.

В других ранее описанных вариантах осуществления настоящего изобретения предусмотрен способ, в котором N-конец пептида Аβ включает Аβ 1-30, Аβ 1-20 или Аβ 1-16.

В одном из ранее описанных вариантах осуществления настоящего изобретения предусмотрен способ, в котором фрагмент пептида Аβ включает от 4 до 20 аминокислот, от 5 до 16 аминокислот, от 6 до 12 аминокислот или от 4 до 8 аминокислот.

В частности настоящее изобретение относится в другом варианте его осуществления к ранее описанному способу по настоящему изобретению, в котором указанным фрагментом пептида Аβ является Аβ1-15, Аβ1-16 или Аβ1-5.

В одном из вариантов осуществления настоящее изобретение относится к одному из ранее описанных вариантов его осуществления, в котором антигенная композиция включает антигенную конструкцию, включающую антигенный пептид, который является фосфо-пептидом, мимикрирующим крупный патологический фосфо-этитоп тау-белка, особенно тау-белка человека.

В одном из вариантов осуществления настоящего изобретения указанный тау-белок имеет аминокислотную последовательность, которая идентична

а) последовательности SEQ ID NO: 2 по меньшей мере на 95% и обладает в существенной степени той же иммуногенной активностью, что и указанный антигенный пептид SEQ ID NO: 2, причем аминокислотный остаток, соответствующий аминокислотному остатку 18 (P-Tyr18) последовательности SEQ ID NO: 2, фосфорилирован (T1),

б) последовательности SEQ ID NO: 3 по меньшей мере на 95% и обладает в существенной степени той же иммуногенной активностью, что и указанный антигенный пептид SEQ ID NO: 3, причем по меньшей мере один, особенно по меньшей мере 2 аминокислотных остатка, соответствующих аминокислотным остаткам 212 (Р-Thr212) и 214 (Р-Ser214) последовательности SEQ ID NO: 3, фосфорилированы,

в) последовательности SEQ ID NO: 4 по меньшей мере на 95% и обладает в существенной степени той же иммуногенной активностью, что и указанный антигенный пептид SEQ ID NO: 4, причем по меньшей мере один, особенно по меньшей мере 2 аминокислотных остатка, соответствующих аминокислотным остаткам 202 (P-Ser202) и 205 (Р-Thr205) последовательности SEQ ID NO: 4, фосфорилированы,

г) последовательности SEQ ID NO: 5 по меньшей мере на 95% и обладает в существенной степени той же иммуногенной активностью, что и указанный антигенный пептид SEQ ID NO: 5, причем по меньшей мере один, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 396 (P-Ser396) и 404 (P-Ser404) последовательности SEQ ID NO: 5, фосфорилированы,

д) последовательности SEQ ID NO: 6 по меньшей мере на 95% и обладает в существенной степени той же иммуногенной активностью, что и указанный антигенный пептид SEQ ID NO: 6, причем по меньшей мере один, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 404 (P-Ser404) и 409 (P-Ser409) последовательности SEQ ID NO: 6, фосфорилированы,

е) последовательности SEQ ID NO: 7 по меньшей мере на 95% и обладает в существенной степени той же иммуногенной активностью, что и указанный антигенный пептид SEQ ID NO: 7, причем по меньшей мере один, особенно по меньшей мере 2, особенно по меньшей мере 3, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 202 (P-Ser202), 205 (Р-Thr205), 212 (P-Thr212) и 214 (P-Ser214) последовательности SEQ ID NO: 7, фосфорилированы.

В другом варианте осуществления настоящего изобретения описанная в нем антигенная композиция по настоящему изобретению включает тау-белок, который имеет аминокислотную последовательность

a) SEQ ID NO: 2,

б) SEQ ID NO: 3,

в) SEQ ID NO: 4,

г) SEQ ID NO: 5,

д) SEQ ID NO: 6 или

e) SEQ ID NO: 7.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором антиген, особенно Аβ- или тау-пептидный антиген представлен восстановленным в носителе, например, в везикулах, корпускулярной частице или молекуле.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором антиген, особенно Аβ- или тау-пептидный антиген представлен восстановленным в липосоме.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором антиген, особенно Аβ- или тау-пептидный антиген, модифицирован липофильной или гидрофобной частью молекулы, которая облегчает инсерцию в липидный двойной слой липосомного носителя/адъюванта.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором размер липофильной или гидрофобной части молекулы в комбинации с общим результирующим зарядом антигенного пептида и носителя/адъюванта к которым пептид присоединяется, в которые пептид встраивается или в которых пептид восстанавливается таким образом, что антигенный пептид располагается, стабилизируется и презентируется в биологически высоко активной конформации, которая позволяет иммунной системе организма-мишени свободно взаимодействовать с антигенными детерминантами, содержащимися в антигенной конструкции, в ее доступной, стабилизированной и высоко биологически активной конформации, которая приводит к сильному иммунному ответу.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором липофильная или гидрофобная часть является жирной кислотой, триглицеридами или фосфолипидом, особенно жирной кислотой с каркасом из по меньшей мере 10 атомов углерода, особенно пальмитиновой кислотой.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором антиген, особенно Аβ- или тау-пептидный антиген, включает две части молекулы, представленные пальмитиновой кислотой, особенно четыре части молекулы, представленные пальмитиновой кислотой.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором липосомный препарат содержит адъювант, особенно липид А, особенно детоксифицированный липид А, например, монофосфорильный или дифосфорильный липид А или алюминий гидроксид.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором ассоциированное с амилоидом заболевание или состояние выбрано из группы, состоящей из заболеваний, к которым относятся, но которыми перечень не ограничивается, неврологические расстройства, например, болезнь Альцгеймера (БА), включая заболевания или состояния, отличающиеся утратой когнитивного объема памяти, например, умеренное когнитивное нарушение (УКН), деменцию с тельцами Леви, синдром Дауна, наследственную церебральную геморрагию с амилоидозом исландского типа, комплекс паркинсонизма-деменции с острова Гуам, а также другие заболевания, которые основаны или ассоциированы с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз, болезнь Крейцфельдта-Якоба, болезнь Паркинсона, слабоумие, связанное с ВИЧ, амиотрофический боковой склероз (АБС), сахарный диабет взрослых, старческий амилоидоз сердца, эндокринные опухоли, инсульт, травматическое повреждение мозга, все глазные заболевания и другие, включая дегенерацию желтого пятна и глаукому, особенно болезнь Альцгеймера.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором ассоциированное с амилоидом состояние отличается утратой когнитивного объема памяти у индивидуума, особенно у индивидуума или пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, особенно у животного или человека.

Настоящее изобретение относится в другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором лечение индивидуума или пациента с иммунной устойчивостью или пациента с активированными Т-клетками, особенно животного или человека, с ассоциированным с амилоидом состоянием, отличающимся утратой когнитивного объема памяти, приводит к повышению задержки когнитивного объема памяти, особенно к полному восстановлению когнитивного объема памяти.

Настоящее изобретение относится в еще одном другом варианте своего осуществления к способу по одному из предшествующих вариантов осуществления, в котором ассоциированное с тау-белком заболевание или расстройство является нейродегенеративным расстройством, особенно нейродегенеративным заболеванием или расстройством, которое вызвано или ассоциировано с формированием нейрофибриллярных патологических изменений, особенно таупатия, особенно таупатия, выбранная из группы, состоящей из болезни Альцгеймера, болезни Крейцфельдта-Якоба, деменции боксеров, синдром Дауна, синдром Герстманна-Штройслера-Шейнкера, миозита с включенными тельцами и церебральной амилоидной ангиопатии прионного белка, травматических повреждений мозга, амиотрофического бокового склероза/комплекса паркинсонизма-деменции с острова Гуам, заболевания двигательных нейронов с нейрофибриллярными сплетениями, не являющееся заболеванием с острова Гуам, аргирофильной зернистой деменции, кортико-базальной дегенерации, диффузных нейрофибриллярных узлов с кальцификацией, лобно-височного слабоумия с паркинсонизмом, связанного с хромосомой 17, болезни Галлервордена-Шпатца, множественной системной атрофии, болезни Ниманна - Пика, типа С, болезни Пика, прогрессирующего субкортикального глиоза, прогрессирующего супрануклеарного паралича, подострого склерозирующего панэнцефалита, исключительно клубочковой деменции, постэнцефалитического паркинсонизма, миотонической дистрофии, но особенно болезни Альцгеймера.

Настоящее изобретение относится в другом варианте своего осуществления к применению антигена, особенно Аβ пептидного антигена или тау пептидного антигена, согласно описанию в предшествующих вариантах осуществления настоящего изобретения, для индукции иммунного ответа, независящего от Т-клеток, особенно связанного с Аβ или с тау-белком, у индивидуума, особенно у животного или человека, особенно у животного или человека, у которого истощены Т-клетки, особенно CD4 Т-клетки.

Настоящее изобретение относится в другом варианте своего осуществления к способу лечения, облегчения симптомов или предупреждения заболевания или состояния, особенно связанного с Аβ или с тау-белком заболевания или состояния у индивидуума, особенно у индивидуума с иммунной устойчивостью или у пациента с активированными Т-клетками, включающего введение указанному индивидууму или пациенту, особенно животному или человеку, особенно животному или человеку с истощенными Т-клетками, особенно CD4 Т-клетками, с указанным заболеванием или состоянием, антигенной конструкции, особенно Аβ или тау антигенной конструкции, заявленной в каком-либо из предшествующих вариантов осуществления, или независящей от Т-клеток антигенной композиции, включающей указанную антигенную конструкцию, причем независящий от Т-клеток иммунный ответ, особенно Аβ или тау иммунный ответ, индуцируется у подвергнутых лечению индивидуумов.

В одном из вариантов осуществления настоящего изобретения указанный индивидуум является пожилым человеком - пациентом с истощенным запасом Т-клеток, особенно CD4 Т-клеток.

В другом варианте осуществления настоящего изобретения указанный индивидуум является человеком - пациентом с ослабленным иммунитетом, у которого истощены Т-клетки, особенно CD4 Т-клетки.

В еще одном из вариантов осуществления настоящего изобретения указанный индивидуум является человеком - пациентом, у которого истощены Т-клетки, особенно CD4 Т-клетки, и имеется иммунная недостаточность, особенно в связи с ВИЧ.

В еще одном из вариантов осуществления настоящего изобретения указанный индивидуум является человеком - пациентом с раковым или другим опасным заболеванием и у которого истощены Т-клетки, особенно CD4 Т-клетки.

В другом варианте осуществления настоящего изобретения указанный индивидуум является человеком - пациентом, у которого проявляется активация Т-клеток и у которого дополнительная стимуляция ответа Т-клеток может привести к возникновению медицинского риска.

В другом варианте настоящее изобретение также относится к способу по одному из предшествующих вариантов своего осуществления, причем не индуцируются побочные воспалительные эффекты.

Настоящее изобретение также относится в другом варианте своего осуществления к способу по настоящему изобретению, в котором введение указанного антигена, особенно Аβ или тау-антигенной конструкции, приводит в основном к выработке антител невоспалительных подтипов, особенно невоспалительного подтипа Th2, особенно изотипов IgG1 и IgG2b.

В другом варианте настоящее изобретение также относится к способу по одному из предшествующих вариантов своего осуществления, причем введение указанной Аβ антигенной конструкции приводит в основном к выработке антител подкласса независящих от Т-клеток IgG, особенно изотипа IgG3.

Настоящее изобретение также относится в другом варианте своего осуществления к способу по настоящему изобретению, в котором введение указанной Аβ антигенной конструкции не приводит к существенному повышению маркеров воспаления в мозге, особенно маркеров, выбранных из группы, состоящей из IL-1 β, IL-6, IFN-γ и TNFα.

В другом варианте настоящее изобретение также относится к способу по одному из предшествующих вариантов своего осуществления, причем введение указанной Аβ антигенной конструкции приводит к существенному снижению нерастворимых связанных с бляшками Аβ1-40 и Аβ1-42 в мозге.

Настоящее изобретение также относится в другом варианте своего осуществления к способу по настоящему изобретению (49), в котором введение указанной Аβ антигенной конструкции приводит к существенному снижению уровня растворимого Аβ1-42 в мозге.

В другом варианте осуществления настоящее изобретение относится к способу по одному из предшествующих вариантов своего осуществления, в котором ассоциированное с амилоидом заболевание выбрано из группы заболеваний, включающей, но ими не ограничивающейся, неврологические расстройства, например, болезнь Альцгеймера (БА), включая заболевания или состояния, отличающиеся утратой когнитивного объема памяти, например, умеренное когнитивное нарушение (УКН), деменцию с тельцами Леви, синдром Дауна, наследственную церебральную геморрагию с амилоидозом исландского типа, комплекс паркинсонизма-деменции с острова Гуам, а также другие заболевания, которые основаны или ассоциированы с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз; болезнь Крейцфельдта-Якоба, болезнь Паркинсона, слабоумие, связанное с ВИЧ, амиотрофический боковой склероз (АБС), сахарный диабет взрослых; старческий амилоидоз сердца; эндокринные опухоли, инсульт, травматическое повреждение мозга, все глазные заболевания и другие, включая дегенерацию желтого пятна и глаукому, особенно болезнь Альцгеймера.

Настоящее изобретение в другом варианте осуществления относится к способу лечения, облегчения симптомов или предупреждения заболевания или состояния, особенно ассоциированного с тау-белком заболевания или состояния, у индивидуума, особенно у индивидуума или пациента с иммунной устойчивостью или у пациента с активированными Т-клетками, в соответствии с одним из предшествующих вариантов осуществления настоящего изобретения, в котором ассоциированное с тау-белком заболевание или расстройство является нейродегенеративным расстройством, особенно нейродегенеративным заболеванием или расстройством, которое вызвано или ассоциировано с формированием нейрофибриллярных повреждений, особенно таупатией, выбранных из группы, включающей болезнь Альцгеймера (БА), болезнь Крейцфельдта-Якоба, деменцию боксеров, синдром Дауна, синдром Дауна, синдром Герстманна-Штройслера-Шейнкера, миозит с включенными тельцами и церебральную амилоидную ангиопатию прионного белка, травматические повреждения мозга, амиотрофический боковой склероз/комплекс паркинсонизма-деменции с острова Гуам, заболевание двигательных нейронов с нейрофибриллярными сплетениями, не являющееся заболеванием с острова Гуам, аргирофильную зернистую деменцию, кортико-базальную дегенерацию, диффузные нейрофибриллярные узлы с кальцификацией, лобно-височное слабоумие с паркинсонизмом, связанное с хромосомой 17, болезнь Галлервордена-Шпатца, множественную системную атрофию, болезнь Ниманна - Пика, тип С, болезнь Пика, прогрессивный субкортикальный глиоз, прогрессирующий супрануклеарный паралич, подострый склерозирующий панэнцефалит, исключительно клубочковую деменцию, постэнцефалитический паркинсонизм, миотоническую дистрофию, особенно болезнь Альцгеймера.

Другие способы, лекарственные средства - кандидаты, соединения и подробности изложены в РСТ/ЕР 2006/011861 (номер публикации WO 2007/068411) и в патентной заявке ЕР 09157303.0, опубликованной 03 апреля 2009 года, сущность которых включена в настоящее описание в виде ссылок на их сущность.

Описание изобретения

Настоящее изобретение также рассматривает в одном из вариантов своего осуществления, что заболеваний с иммуннонедостаточностью Т-клеток можно избежать у индивидуума, особенно животного или человека. Такой индивидуум может быть или вакцинирован до начала заболевания или в случае заболевания или состояния индивидуум может быть подвергнут лечению способом, описанным в настоящем изобретении. В одном из вариантов осуществления настоящего изобретения заболевание является амилоид-ассоциированным заболеванием. В другом варианте осуществления настоящего изобретения заболевание является ассоциированным с тау-белком заболеванием. Такими заболеваниями могут быть, inter alia, синдром Ди Георге (аплазия тимуса), синдром Вискотта-Олдрича, атаксии-телеангиэктазия или хронический кожно-слизитый кандидоз.

Надмолекулярные антигенные конструкции по настоящему изобретению или антигенная композиция, включающая такую антигенную конструкцию, могут быть применены для получения вакцинной композиции для индукции независящего от Т-клеток иммунного ответа у индивидуума, особенно у индивидуума или пациента с иммунной устойчивостью, или у пациента с активированными Т-клетками, особенно у животного или человека, особенно у животного или человека, у которого истощены Т-клетки, особенно CD4 Т-клетки. В одном из вариантов осуществления настоящего изобретения надмолекулярную антигенную конструкцию применяют в способе предупреждения, лечения или облегчения проявлений амилоидоза - группы заболеваний и расстройств, ассоциированных с формированием амилоидных бляшек, включающей вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), включая заболевания или состояния, отличающиеся утратой когнитивного объема памяти, например, умеренное когнитивное нарушение (УКН), деменцию с тельцами Леви, синдром Дауна, наследственную церебральную геморрагию с амилоидозом исландского типа, комплекс паркинсонизма-деменции с острова Гуам, а также другие заболевания, которые основаны или ассоциированы с белками амилоидного типа, например, прогрессирующий супрануклеарный паралич, рассеянный склероз; болезнь Крейцфельдта-Якоба, болезнь Паркинсона, слабоумие, связанное с ВИЧ, амиотрофический боковой склероз (АБС), сахарный диабет взрослых; старческий амилоидоз сердца; эндокринные опухоли, инсульт, травматическое повреждение мозга, все глазные заболевания и другие, включая дегенерацию желтого пятна и глаукому, но особенно заболевание или состояние, отличающееся утратой когнитивного объема партии, например, умеренное когнитивное нарушение (УКН), у индивидуума, особенно у индивидуума или пациента с иммунной устойчивостью, или у пациента с активированными Т-клетками, особенно у животного или человека, особенно у животного или человека, у которого истощены Т-клетки, особенно CD4 Т-клетки, включающий введение указанному индивидууму надмолекулярной антигенной конструкции по настоящему изобретению, но особенно вакцинной композиции, включающей такие надмолекулярные антигенные конструкции по настоящему изобретению животному, особенно млекопитающему или человеку, имеющего указанное расстройство и следовательно нуждающегося в таком лечении.

В еще одном из вариантов осуществления настоящего изобретения предусмотрен способ получения лекарственного средства для предупреждения, лечения или облегчения состояния индивидуума, особенно индивидуума или пациента с иммунной устойчивостью или пациента с активированными Т-клетками, особенно животного или человека, особенно животного или человека, у которого истощены Т-клетки, особенно CD4 Т-клетки, проявлений амилоидоза - группы заболеваний и расстройств, ассоциированных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), включая заболевания и состояния, отличающиеся утратой когнитивного объема памяти, например, умеренное когнитивное нарушение (УКН), деменцию с тельцами Леви, синдром Дауна, наследственную церебральную геморрагию с амилоидозом исландского типа, комплекс паркинсонизма-деменции с острова Гуам, а также другие заболевания, основанные или ассоциированные с амилоидоподобными белками, например, прогрессирующий супрануклеарный паралич, рассеянный склероз; болезнь Крейцфельдта-Якоба, болезнь Паркинсона, слабоумие, связанное с ВИЧ, амиотрофический боковой склероз (АБС), сахарный диабет взрослых; старческий амилоидоз сердца, эндокринные опухоли, инсульт, травматическое повреждение мозга, все глазные заболевания и другие, включая дегенерацию желтого пятна и глаукому, но особенно заболевание или состояние, отличающееся утратой объема когнитивной памяти, например, умеренное когнитивное нарушение (УКН), включающий переработку антитела по настоящему изобретению в фармацевтически приемлемую форму.

В одном из вариантов осуществления настоящего изобретения осуществляют применение антигенной презентации, которая приводит к повышенной экспозиции и стабилизации предпочтительной антигенной конформации, которая в конечном счете приводит к высокоспецифичному иммунному ответу и выражается в выработке антител с уникальными свойствами.

Настоящее изобретение также относится к иммуногенным композициям и к композициям терапевтических вакцин, включающих указанные иммуногенные композиции, включающие надмолекулярные конструкции, в которых применяют антигенные пептиды для лечения, облегчения симптомов, задержки начала развития заболевания или для предупреждения заболеваний и расстройств, особенно заболеваний и расстройств, которые вызываются или которые ассоциированы с амилоидом или амилоидоподобными белками, включая амилоизозы - группу заболеваний и нарушений, связанных с амилоидным белком, например, болезнь Альцгеймера (БА), или заболевания и расстройства, которые вызываются или которые ассоциированы с тау-белком, включая таупатии, у пациентов с иммунной устойчивостью с недостаточностью Т-клеток, особенно у пациентов, у которых истощены CD4 Т-клетки. К таким антигенным пептидам могут относиться, но ими перечень не ограничивается, амилоидный белок или амилоидоподобный белок, например, прионный белок, тау-белок, альфа-синуклеин, гентингтин и др. В одном из вариантов осуществления настоящего изобретения предусматривают иммуногенные композиции, включающие надмолекулярную антигенную конструкцию, особенно антигенную конструкцию, включающую пептидный антиген, производный от амилоидного белка или амилоидоподобного белка, например, прионного белка, тау-белка, альфа-синуклеина, гентингтина и других, особенно от β-амилоидного пептидного антигена или тау-пептидного антигена по настоящему изобретению и, согласно описанному в настоящем изобретении, перед типичным представителем N-концевой части β-амилоидного пептида, причем антигенный пептид модифицирован таким образом, что он способен поддерживать и стабилизировать определенную конформацию антигена, особенно конформацию, которая отличается сбалансированным соотношением случайной спирали, частей α-спирали и β-слоя. Такая конформация приводит к индукции сильного и в высокой степени специфичного иммунного ответа, особенно независящего от Т-клеток иммунного ответа, при индукции у животного или человека.

В частности, антигенная композиция по настоящему изобретению может включать конформационный антиген, у которого более 30%, особенно более 40%, особенно более 50%, особенно более 60%, особенно более 70%, особенно более 80%, особенно более 90%, особенно более 95% и до 100% конформации представлено бета-слоем.

Один из способов достижения формирования и стабилизации требуемой конформации антигенного пептида заключается в презентировании антигенного пептида, присоединенного, или внедренного, или восстановленного частично или полностью в носителе, например, в везикуле, корпускулярной частице или молекуле, или в каком-либо ином средстве, которое может соответствующим образом выступать в качестве носителя/адъюванта для антигенного пептида. В одном из вариантов осуществления настоящего изобретения антигенный пептид присоединен или включен, или восстановлен в носителе за счет слабых взаимодействий, например, ван-дер-ваальсовых сил, гидрофобного или электростатического взаимодействия или комбинации двух или нескольких указанных взаимодействий таким образом, что пептид находится в специфической конформации, которая поддерживается и стабилизируется путем ограничения указанного антигенного пептида в его трехмерной подвижности таким образом, что конформационные изменения предупреждаются или существенно ограничиваются.

В одном из вариантов осуществления настоящего изобретения антигенный пептид презентирован на поверхности молекулы-носителя в виде часто повторяющейся матрицы, особенно в повторяющейся матрице, включающей по меньшей мере 10 повторяющихся антигенных единиц/молекулу-носителя, особенно по меньшей мере 50 повторяющихся антигенных единиц/молекулу-носителя, особенно по меньшей мере 100 повторяющихся антигенных единиц/молекулу-носителя, особенно по меньшей мере 200 повторяющихся антигенных единиц/молекулу-носителя, особенно по меньшей мере 300 повторяющихся антигенных единиц/молекулу-носителя; особенно по меньшей мере 400 повторяющихся антигенных единиц/молекулу-носителя, особенно по меньшей мере 500 повторяющихся антигенных единиц/молекулу-носителя.

Если везикулу, частицу или корпускулярное тело применяют в качестве носителя/адъюванта, например, липосому, композиция антигенного пептида может быть выбрана таким образом, что ее общий результирующий заряд идентичен результирующему заряду на поверхности носителя/адъюванта, к которому присоединен пептид. Силы электростатического отталкивания эффективны между равно заряженными поверхностью носителя/адъюванта и антигенным пептидом, но особенно между поверхностью равно заряженного носителя и аминокислотных носителей, составляющих антигенный пептид и более конкретно между поверхностью равно заряженного носителя и равно заряженных аминокислотных остатков, включенных в антигенный пептид, может привести к потреблению антигенного пептида в определенной, высоко специфичной и стабилизированной конформации, которая обеспечивает высокую биологическую активность. В результате антигенный пептид свободен и представлен в конформации, которая представляет высокую биологическую активность, выражающуюся в том, что она позволяет иммунной системе целевого организма свободно взаимодействовать с антигенными детерминантами, содержащимися в антигенной конструкции в биологически активной конформации, что приводит к сильному и специфичному по конформации иммунному ответу, выражающемуся, например, в высоком титре антител в целевом организме. Путем тщательной координации общих результирующих зарядов антигенного пептида с одной стороны и носителя, к которому пептид оказывается присоединенным, инкорпорированным или восстановленным с другой стороны, антигенный пептид свободен на поверхности носителя или в тесной близости к ней в конформации, которая индуцируется и стабилизируется электростатическими отраженными силами, действующими эффективно между идентично заряженной поверхностью носителя и антигенного пептида, но особенно идентично заряженной поверхностью носителя и аминокислотными остатками, составляющими антигенный пептид, и более конкретно, идентично заряженной поверхностью носителя и идентично заряженными аминокислотными остатками, включенными в антигенный пептид. Это приводит к презентации антигенной конструкции таким образом, что она свободно доступна для механизма иммунной защиты целевого организма и таким образом способна к индукции сильного и высоко специфичного иммуногенного ответа при введении животному или человеку. Иммуногенный ответ может быть дополнительно повышен за счет использования липосом в качестве носителя, причем указанные липосомы могут функционировать в качестве адъюванта для повышения или стимулирования иммунного ответа у целевого животного или человека, подвергаемого лечению терапевтической вакциной по настоящему изобретению. Необязательно липосома может также содержать дополнительный адъювант, например, липид А, алюминий гидроксид, кальций фосфат, интерлейкин 1 и/или микрокапсулы полисахаридов и белков, но особенно детоксифицированный липид А, например, монофосфорильный или дифосфорильный липид А, или алюминий гидроксид.

В одном из вариантов осуществления настоящего изобретения антигенный пептид по настоящему изобретению, описанный в настоящем изобретении, особенно антигенный пептид, общий результирующий заряд которого является отрицательным, применяют восстановленным в липосомы, особенно липосомы, компоненты которых выбраны таким образом, что общий результирующий заряд головной группы липосомы является отрицательным. В частности липосома состоит из компонентов, выбранных из группы, состоящей из димиристоилфосфатидилхолина (ДМФХ), димиристоилфосфатидилэтаноламина (ДМФЭА), димиристоилфосфатидилглицерина (ДМФГ) и холестерина, а также необязательно дополнительно содержит монофосфорильный липид А или какой-либо другой адъювант, который может быть соответствующим образом применен в рамках охвата настоящего изобретения, например, алюминий гидроксид, кальций фосфат, интерлейкин 1 и/или микрокапсулы полисахаридов и белков.

В другом варианте осуществления настоящего изобретения модифицированный пептидный антиген по настоящему изобретению предусмотрен ковалентно связанным с молекулой якорного типа, которая способна инсертировать в носитель/адъювант, тем самым, фиксируя пептид на носителе/адъюванте и презентируя его на поверхности молекулы носителя/адъюванта или в непосредственной близости к нему таким образом, что электростатические силы могут стать эффективными, согласно описанному в настоящем изобретении ранее.

При использовании липосом в качестве носителей/адъювантов, конструкция антигенного пептида обычно содержит гидрофобный хвост, который инсертирован в мембрану липосомы в таких сформированных условиях. Кроме того, антигенные пептиды могут быть модифицированы для включения гидрофобного хвоста таким образом, что он может быть инсертирован в липосому.

Надмолекулярные антигенные конструкции по настоящему изобретению обычно включают пептиды, модифицированные для повышения антигенного свойства, причем такие пептиды могут быть модифицированы за счет пэгелирования (используя полиэтиленгликоль или модифицированный полиэтиленгликоль) или модифицированы с помощью других средств, например пальмитиновой кислоты, согласно описанному выше, полиаминокислот (например, полиглицина, полигистидина), полисахаридов (например, полигалактуроновой кислоты, полимолочной кислоты, полигликолида, хитина, хитозана), синтетических полимеров (полиамидов, полиуретанов, полиэфиров) или сополимеров (например, поли(метакриловой кислоты) и N-(2-гидрокси)пропилметакриламида) и др.

В одном из вариантов осуществления настоящего изобретения предусмотрены антигенные пептиды по настоящему изобретению, описанные в настоящем изобретении, которые модифицированы для содержания гидрофобного хвоста таким образом, чтобы указанные пептиды могли быть инсертированы в липосому. В частности, β-амилоидный пептид может быть модифицирован липофильной или гидрофобной частью молекулы, которая облегчает инсерцию в двойной липидный слой носителя/адъюванта. Липофильные или гидрофобные части молекул по настоящему изобретению могут быть жирными кислотами, триглицеридами и фосфолипидами, особенно жирными кислотами, триглицеридами и фосфолипидами, причем углеродный каркас молекулы жирной кислоты содержит по меньшей мере 10 атомов углерода, особенно липофильные части молекул, содержащие жирные кислоты с углеродным каркасом, состоящим по меньшей мере примерно от 14 атомов углерода и примерно до 24 атомов углерода, более конкретно гидрофобные части молекул, содержащие углеродный каркас, состоящий по меньшей мере из 14 атомов углерода. К примерам гидрофобных частей молекул относятся, но ими не ограничиваются, пальмитиновая кислота, стеариновая кислота, миристиновая кислота, лауриновая кислота, олеиновая кислота, линолевая кислота, линоленовая кислота и холестерин или дистеароилфосфатидилэтаноламин (ДСФЭ). В одном из вариантов осуществления настоящего изобретения гидрофобной частью молекулы является пальмитиновая кислота.

Пальмитилирование, хотя и обеспечивает якорь для пептида в двойном слое липосомы, из-за относительно уменьшенной длины части молекулы жирной кислоты С16:0 приводит к пептиду, который презентируется открытым на поверхности липосомы или в тесной близости к поверхности липосомы. Поэтому клеткам, процессирующим антиген, придется поглотить целую липосому с пептидом.

В другом варианте осуществления настоящего изобретения ПЭГ применяют при получении надмолекулярной конструкции, в которой конец без ПЭГ ковалентно присоединен к молекуле фосфатидилэтаноламина (где жирной кислотой может быть миристиновая, пальмитиновая, стеариновая, олеиновая кислота или какая-либо другая кислота или их комбинация). Такая надмолекулярная структура может быть восстановлена в липосомах, состоящих из фосфолипидов и холестерина (фосфатидилэтаноламина, фосфатидилглицерина, холестерина в разных молярных соотношениях). Могут применяться другие фосфолипиды. Липид А применяют в концентрации примерно 40 мкг/пмоль фосфолипидов.

В некоторых вариантах осуществления настоящего надмолекулярные антигенные конструкции по настоящему изобретению включают последовательность антигенного пептида, согласно приведенному выше описанию, ковалентно присоединенного к пэгелированному лизину - по меньшей мере по одному с каждого конца, но особенно по 1 или 2 с каждого конца. Длина цепи ПЭГ (полиэтиленгликоля) может варьировать от n=8 до n=150000 или более, особенно от n=10 до n=80000, более специфично от n=10 до n=10000. В одном из вариантов осуществления настоящего изобретения длина цепи ПЭГ не превышает n=45, особенно составляет от n=5 до n=40, более специфично от n=10 до n=30, и еще более специфично от n=10. К липосомам, которые могут применяться в композициях по настоящему изобретению, относятся липосомы, известные специалистам в данной области. Какие-либо стандартные липиды, пригодные для получения липосом, могут быть применены. Стандартные двухслойные и многослойные липосомы могут применяться для получения композиций по настоящему изобретению. Хотя какие-либо методы получения липосом, известные специалистам в данной области, могут быть применены, большинство предпочтительных липосом получают по методу Alving и др.. Infect. Immun. 60, 1992, cc.2438-2444, включенному в настоящее изобретение в виде ссылки. Липосома может необязательно содержать адъювант или иммуномодулятор, или и адъювант и иммуномодулятор. Предпочтительным иммуномодулятором является липид А, особенно детоксифицированный липид А, например, монофосфорильный или дифосфорильный липид А.

Липосома может обладать двойной функцией, что выражается в том, что она может применяться в качестве носителя, включающего надмолекулярную конструкцию согласно описанному в настоящем изобретении выше, одновременно действуя в качестве адъюванта для повышения или стимулирования иммунного ответа у целевого животного или человека, подвергаемого воздействию терапевтической вакцины по настоящему изобретению. Необязательно липосома может кроме того содержать дополнительный адъювант или иммуномодулятор или оба эти компонента, например, липид А, алюминий гидроксид, кальций фосфат, интерлейкин 1 и/или микрокапсулы полисахаридов и белков, но особенно липид А, более конкретно детоксифицированный липид А, например, монофосфорильный или дифосфорильный липид А или алюминий гидроксид.

Иммуногенная композиция и/или терапевтическая вакцина по настоящему изобретению, включающая надмолекулярную анигенную конструкцию по настоящему изобретению и которая согласно описанному в настоящем изобретении выше может быть получена в форме жидкого раствора, или инъекционной суспензии, или также в твердой форме, пригодной для растворения перед проведением инъекции, в составе, например, набора для осуществления применения настоящей композиции, согласно описанному ниже.

Иммуногенную композицию и/или терапевтическую вакцину по настоящему изобретению, включающую надмолекулярную антигенную конструкцию, вводят человеку или животному, особенно человеку или животному с заболеванием, ассоциированным с амилоидом или с тау-белком, для индукции иммунного ответа у указанного человека или животного для облегчения симптомов, связанных с заболеванием, или для восстановления состояния, наблюдаемого у здоровых индивидуумов, которые не затронуты заболеванием.

Иммуногенную композицию и/или терапевтическую вакцину по настоящему изобретению вводят человеку или животному каким-либо соответствующим стандартным путем введения. В общем, композиция может вводиться местно, перорально, ректально, назально или парентерально (например, внутривенно, подкожно или внутримышечно). Кроме того, композиция может быть инкорпорирована в матрицы устойчивого высвобождения, например, в биодеградируемые полимеры, полимеры, имплантированные вблизи от требуемого места доставки, например, по месту опухоли. Способ включает введение одной дозы, введение повторяющихся доз с заранее установленными интервалами, и устойчивое введение для заранее установленного периода времени.

В частности композицию антигенного пептида по настоящему изобретению вводят парентерально, особенно инъекцией внутрибрюшинно, внутривенно, подкожно и внутримышечно.

Дозирование композиции может зависеть от подвергаемого лечению состояния, определенной применяемой композиции и от других клинических факторов, например, массы, размера и состояния пациента, поверхности тела, определенного вводимого соединения или композиции, других лекарственных средств, вводимых одновременно, и от способа введения.

Иммуногенную композицию и/или терапевтическую вакцину по настоящему изобретению могут вводить в комбинации с другими веществами биологического действия и методами лечения заболеваний. Другие вещества биологического действия могут быть частью той же композиции, которая уже включает иммуногенную композицию и/или терапевтическую вакцину по настоящему изобретению, в форме смеси, в которой терапевтическая вакцина и другое вещество биологического действия перемешаны в том же фармацевтически приемлемом растворителе и/или носителе или вместе с ним, или могут быть представлены отдельно или вместе в форме набора частей.

Иммуногенную композицию и/или терапевтическую вакцину по настоящему изобретению могут вводить в качестве сопутствующего средства с другим веществом или веществами биологического действия, время от времени или последовательно, один за другим. Например, иммуногенная композиция и/или терапевтическая вакцина по настоящему изобретению может вводиться одновременно с первым дополнительным веществом биологического действия или последовательно после или до введения указанной композиции. Если выбрана схема введения, в которой вводят более одного дополнительного вещества биологического действия вместе по меньшей мере с одной иммуногенной композицией и/или терапевтической вакциной по настоящему изобретению, соединения или вещества могут частично вводиться одновременно, частично последовательно в разных комбинациях.

Другая задача, решаемая в настоящем изобретении, заключается в получении смесей иммуногенной композиции и/или терапевтической вакцины по настоящему изобретению и необязательно одного или нескольких дополнительных веществ биологического действия, а также в разработке способов применения такой композиции по настоящему изобретению или ее смесей для предупреждения, и/или терапевтического лечения, и/или облегчения проявлений амилоидоза - группы заболеваний и расстройств, ассоциированных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, или таупатии - ассоциированного с тау-белком заболевания или расстройства, вызванного или ассоциированного с формированием нейрофибриллярных повреждений, согласно описанному в настоящем изобретении выше, у пациентов с иммунной устойчивостью или у пациентов с активированными Т-клетками, особенно у пациентов с недостаточностью Т-клеток, особенно у пациентов с истощенными CD4 Т-клетками.

Смеси по настоящему изобретению могут включать дополнительно к иммуногенной композиции и/или терапевтической вакцине по настоящему изобретению, биологически действующее вещество, например, известные соединения, применяемые в лечении амилоидозов - группы заболеваний и расстройств, ассоциированных с амилоидом или амилоидоподобным белком, например, белком Аβ, участвующим в болезни Альцгеймера, включая антитело, возникающее против амилоидогенного пептидного антигена, особенно антитело, возникающее против амилоидогенного антигена, представленного в форме надмолекулярной антигенной конструкции, более конкретно антитела по настоящему изобретению, которое описано в нем.

В другом варианте осуществления настоящего изобретения другим веществом или соединением биологического действия также может быть терапевтический агент, который может применяться в лечении заболеваний и расстройств, вызванных или ассоциированных с амилоидом или амилоид-подобными белками, в том числе амилоидоза, вызванного амилоидом β, или тау-ассоциированных нейродегенеративных заболеваний или расстройств, включая таутопатии, или может применяться в лечении других нейродегенеративных расстройств. Другие вещества или соединения биологического действия могут выражать свое биологическое действие по тому же или близкому механизму подобно иммуногенной композиции и/или терапевтической вакцине по настоящему изобретению, или с помощью иного механизм действия, или с помощью разнообразных близких и/или иных механизмов действия.

Обычно другое соединение биологического действия может включать энхансеры нейтронной трансмиссии, психотерапевтические лекарственные средства, ингибиторы ацетилхолинэстеразы, блокаторы кальциевых каналов, биогенные амины, бензодиазепиновые транкливизаторы, энхансеры синтеза хранения или высвобождения ацетилхолина, агонисты постсинаптических рецепторов ацетилхолина, ингибиторы моноамиоксидазы-А или -В, антагонисты глютамат-рецепторов типа N-метил-D-аспартат, нестероидные противовоспалительные лекарственные средства, антиоксиданты и антагонисты серотинэргического рецептора. В частности смесь по настоящему изобретению может включать по меньшей мере одно другое соединение биологического действия, выбранное из группы, состоящей из соединений, действующих против оксидативного стресса, анти-апоптических соединений, хелаторов металлов, ингибиторов репарации ДНК, например, пирензипина и метаболитов, 3-амино-1-пропансульфоновой кислоты (ЗАПС), 1,3-пропандисульфоната (1,ЗПДС), активаторов секретазы, ингибиторов β- и γ-секретазы, тау-белков, нейротрансмиттера, разрушителей β-слоев, противовоспалительных молекул или ингибиторов холинэстеразы, например, такрина, ривастигмина, донепезила и/или галантамина и других лекарственных средств и пищевых добавок вместе с терапевтической вакциной по настоящему изобретению и, необязательно, с фармацевтически приемлемым носителем, и/или разбавителем, и/или эксципиентом.

В другом варианте осуществления настоящего изобретения смеси по настоящему изобретению могут включать ниацин или мемантин вместе с иммуногенной композицией и/или терапевтической вакциной по настоящему изобретению и необязательно с фармацевтически приемлемым носителем, и/или разбавителем, и/или эксципиентом.

В еще одном из вариантов осуществления настоящего изобретения предусмотрены смеси, которые включают «атипичные антипсихотики», например, клозапин, зипразидон, рисперидон, арипипразол или оланзапин, для лечения положительных и отрицательных психотических симптомов, включая галлюцинации, бред, нарушения мышления (выражающиеся в виде выраженного бессвязного поведения, крушения, поверхностности) и неестественное или дезорганизованное поведение, а также эмоциональную анестезию, негативные симптомы, апатию и социальную замкнутость, вместе с иммуногенной композицией и/или терапевтической вакциной по настоящему изобретению и необязательно с фармацевтически приемлемым носителем, и/или разбавителем, и/или эксципиентом, для лечения, облегчения симптомов или предупреждения заболеваний и расстройств, вызываемых или ассоциированных с амилоидом или амилоидоподобными белками, к которым относится амилоидоз - группа заболеваний и нарушений, ассоциированных с амилоидным белком, например, болезнь Альцгеймера, или заболеваний и расстройств, вызываемых или ассоциированных с тау-белком, например, тау-ассоциированные нейродегенеративные заболевания или расстройства, которые вызваны или ассоциированы с формированием нейрофибриллярных патологических изменений, включая таутопатии, у пациентов с иммунной устойчивостью или у пациентов с активированными Т-клетками, особенно у пациентов с недостаточностью Т-клеток, особенно у пациентов с истощением CD4 Т-клеток.

В одном из вариантов осуществления настоящего изобретения композиции и смеси по настоящему изобретению и ранее описанные в настоящем изобретении представляют иммуногенную композицию по настоящему изобретению и вещество биологического действия, соответственно, в терапевтически или профилактически эффективном количестве.

Другие соединения, которые могут соответствующим образом применяться в смесях в комбинации с иммуногенной композицией и/или терапевтической вакциной по настоящему изобретению, описаны, например, в WO 2004/058258 (особенно см. cc.16 и 17), включая терапевтические мишени лекарственных средств (cc.36-39), алкансульфоновую кислоту и алканолсерную кислоту (cc.39-51), ингибиторы холинэстеразы (cc.51-56), антагонисты рецептора NMDA (cc.56-58), эстрогены (cc.58-59), нестероидные противовоспалительные лекарственные средства (cc.60-61), антиоксиданты (cc.61-62), агонисты рецепторов, активирующих пролиферацию пероксисом (PPAR) (cc.63-67), агенты снижения холестерина (cc.68-75); ингибиторы амилоида (cc.75-77), ингибиторы формирования амилоида (cc.77-78), хелаторы металла (cc.78-79), антипсихотики и антидепрессанты (cc.80-82), пищевые добавки (cc.83-89) и соединения, повышающие выживаемость веществ биологического действия в мозге (см. cc.89-93) и пролекарства (cc.93 и 94), указанная работа включена в настоящее изобретение в виде ссылки, но особенно соединения, для которых выше указаны страницы.

Давно известно, что вакцинация организма хозяина, животного или человека нормальным белком организма хозяина может привести к развитию аутоантител, направленных против белков организма хозяина, приводя к расстройствам, которые называют аутоиммунными заболеваниями. Аβ и его белок-предшественник АРР являются такими нормальными белками. Использование таких белков хозяина в вакцинации может вызвать нежелательные побочные эффекты. В литературе имеется некоторое доказательство того, что Аβ может активировать нейровоспалительный ответ, который может частично быть вызван повышенной активацией системы комплемента, которая уже высоко активирована у пациентов с болезнью Альцгеймера или с другими нейродегенеративными заболеваниями..

Аβ человека в присущей ему конформации β-слоя представляет мощный активатор системы комплемента человека. Он сильно связывается с хвостом коллагена Clq комплемента человека. Сверхактивация системы комплемента может привести к тому, что действие природной системы защиты меняется на противоположное и приводит к аутодеструкции клеток и тканей, включая нейроны и их процессы. Например, мембраноатакующий комплекс (membrane attack complex - MAC), являющийся природной системой защиты организма хозяина и защищающий организм хозяина от вторжения бактерий и вирусов путем инсерции в указанные бактерии и вирусы, при сверхактивации могут инсертироваться в клетку-хозяина и вызвать аутодеструкцию. Избыточная активация может дополнительно привести к стимуляции микроглии для выработки токсических соединений, например, бескислородных радикалов и опасных протеаз.

Еще одна задача, решаемая в настоящем изобретении, заключается в предупреждении возможных побочных эффектов, например, неврологических осложнений, вызванных вакцинацией животного или человека с аутоиммунным заболеванием аутоантигеном, который обладает потенциалом для дополнительной стимуляции уже избыточно активированной системы комплемента. Это может быть достигнуто в рамках настоящего изобретения путем введения пептидного антигена Аβ, особенно пальмитилированного пептидного антигена Аβ, более конкретно пальмитилированного пептидного антигена Аβ1-15, но особенно пальмитилированного пептидного антигена Аβ1-15 (ACI-24, Аβ1-15) в комбинации с ингибитором комплемента.

Таким образом, это другой вариант осуществления настоящего изобретения для обеспечения вакцинной композиции включающей дополнительно Аβ пептидный антиген, особенно Аβ пептидный антиген по настоящему изобретению, описанному в настоящем изобретении выше; ингибитор системы комплемента.

Ингибитором комплемента может быть соединение, выбранное из группы, состоящей из растворимого рецептора 1 комплемента человека, белка С5 против комплемента человека, например, гуманизированного моноклонального антитела против белка С5 или одноцепочечного фрагмента гуманизированного моноклонального антитела, ингибитора-N Cl-эстеразы и природный ингибитор С1 человека.

Модифицированный амилоидный пептидный антиген, например, пептид амилоид бета 1-15, может быть синтезирован по методу, описанному Nicolau и др., Proc Natl. Acad. Sci США 99, 2002, cc.2332-2337. Подход, описанный Nicolau и др., может быть модифицирован первым синтезируемым антигенным пептидом, который затем дополнительно модифицирован путем пересадки на смолу липофильной или гидрофобной части молекулы к концевым аминокислотным остаткам ранее сформированного пептида. В частности, защищенная аминокислота, особенно Fmoc-защищенная аминокислота, присоединена к смоле, за счет использования известной химии соединения. Защитную группу удаляют и второй защищенный аминокислотный остаток присоединяют.

В стандартном автоматизированном синтезе пептидов используют известную химию защиты, особенно химию Fmoc/tBu, и стандартные защитные группы боковой цепи затем применяют для синтеза антигенного пептида Аβ, особенно антигенного пептида Аβ1-15, путем соединения аминокислот 1-15 амилоидного белка Аβ1-42 для получения пептидного фрагмента с данной последовательностью. На заключительной стадии две дополнительные защищенные аминокислоты соединены с растущим пептидным фрагментом. Группы Mtt затем могут быть селективно расщеплены и соединены с пальмитиновой кислотой. После промывки смолы защитную группу удаляют и смолу одновременно расщепляют с последующим снятием защиты боковых цепочек, используя стандартную методологию. Конечный продукт может быть получен высокой степени чистоты, и его идентичность подтверждается методами, известными в данной области, например, электроспрей масс-спектрометрия.

Липофильная или гидрофобная часть молекулы по настоящему изобретению может быть жирной кислотой, триглицеридом или фосфолипидом, причем углеродный каркас жирной кислоты содержит по меньшей мере 10 атомов углерода. Особенно, липофильная или гидрофобная часть молекулы представляет жирную кислоту с углеродным каркасом, содержащим по меньшей мере примерно от 14 атомов углерода и примерно до 24 атомов углерода, причем каждый индивидуальный номер атома углерода, попадающий в данный диапазон, также является частью настоящего изобретения. Более конкретно, липофильная или гидрофобная часть молекулы содержит углеродный каркас, состоящий по меньшей мере из 14 атомов углерода, но особенно из 16 атомов углерода. К примерам гидрофобных частей молекул относятся, но ими не ограничиваются, пальмитиновая кислота, стеариновая кислота, миристиновая кислота, лауриновая кислота, олеиновая кислота, линолевая кислота и линоленовая кислота. В одном из вариантов осуществления настоящего изобретения липофильной или гидрофобной частью молекулы является пальмитиновая кислота.

Липосомальные антигены по настоящему изобретению могут быть получены согласно описанию в работе Nicolau и др., 2002. Модифицированный амилоидный антигенный пептид Аβ, особенно модифицированный антигенный пептид Аβ1-15, может быть восстановлен в конструкции, состоящей из липосом, особенно из липосом, полученных из димиристоилфосфатидилхолина (ДМФХ), димиристоилфосфатидилэтаноламина (ДМФЭА), димиристоилфосфатидилглицерина (ДМФГ) и холестерина, необязательно содержащих монофосфорильный липид А.

В одном из вариантов осуществления настоящего изобретения липосомы с липидом А применяют в качестве адъюванта для приготовления антиамилоидной вакцины. Димиристоилфосфатидилхолин, -глицерин и холестерин смешивают, особенно в мольном соотношении 0,9:1,0:0,7. Сильный иммуномодулятор, например, монофосфорильный липид А, затем добавляют в соответствующей концентрации, особенно в концентрации 30-50 мг на ммоль, более предпочтительно в концентрации 40 мг на ммоль фосфолипидов. Затем добавляют модифицированный антигенный пептид Аβ при мольном отношении пептида к фосфолипидам от 1:30 до 1:200, особенно при мольном отношении от 1:50 до 1:120, более предпочтительно 1:100. Растворители удаляют, например, выпариванием, и получаемую пленку гидратируют стерильным буферным раствором, например, ФСБ.

Липосомы также могут быть получены методом переточного впрыскивания, описанным, например, Wagner и др., Journal of Liposome Research, 12(3), 2002, cc.259-270. Во время впрыскивания липидных растворов в водную буферную систему липиды проявляют тенденцию к формированию «преципитатов» с последующей самосборкой в везикулы. Размер полученных частиц зависит от ряда факторов, например, от концентрации липида, скорости перемешивания, скорости впрыскивания и от выбора липидов. Система приготовления может состоять из модуля переточного впрыскивания, сосудов для полярной фазы (например, для буферного раствора ФСБ), сосуда для раствора этанола/липида и устройства для сжатия, особенно устройства для сжатия азота. Водный или полярный раствор нагнетают через модуль переточного впрыскивания, а этанольно/липидный раствор впрыскивают в полярную фазу при варьирующем приложенном давлении.

Для определения иммуногенности модифицированной антигенной конструкции Аβ соответствующее животное, выбранное из группы, состоящей из мышей, крыс, кроликов, свиней, птиц и др., но особенно мышей, особенно мышей линии C57BL/6, иммунизируют антигенным пептидом. Иммуногенность антигенной конструкции определяют зондированием образцов сыворотки с соответствующими временными интервалами после иммунизации, используя иммуноанализ, например, метод ELISA.

Модифицированную антигенную конструкцию, особенно пальмитилированную антигенную конструкцию, и, более конкретно, пальмитилированную конструкцию Аβ1-15 или пальмитилированный белок Tau5-20 [pY18] применяют для иммунизации пациента, человека или животного, с иммунной устойчивостью или пациента с активированными Т-клетками, у которого симптомы ассоциированы с амилоидозом - группой заболеваний и расстройств, ассоциированных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз или какое-либо другое ассоциированное с амилоидом заболевание, или у которого симптомы ассоциированы с таутопатиями - группой заболеваний и расстройств, вызванных или ассоциированных с тау-белком и вызванных или ассоциированных с формированием нейрофибриллярных патологических изменений, причем у указанного животного, особенно у указанного млекопитающего или человека, имеется недостаточность Т-клеток, особенно недостаточность CD4 Т-клеток.

Надмолекулярную антигенную конструкция по настоящему изобретению, особенно иммуногенную композицию и/или терапевтическую вакцину, включающую такую надмолекулярную антигенную конструкцию по настоящему изобретению, вводят животному, особенно млекопитающему или человеку, каким-либо соответствующим стандартным способом введения. В основном композиция может вводиться местно, перорально, ректально, назально или парентерально (например, внутривенно, подкожно или внутримышечно), причем указанное животное, особенно указанное млекопитающее или человек, обладает дефицитом Т-клеток, особенно дефицитом CD4 Т-клеток. Кроме того, композиция может быть инкорпорирована в матрицы устойчивого высвобождения, например, в биодеградируемые полимеры, полимеры имплантируемые поблизости от требуемого места доставки, например, в месте опухоли. Способ включает введение одной дозы, введение повторных доз с заранее определенными интервалами, и устойчивое введение на протяжении заранее определенного периода времени.

В одном из вариантов осуществления настоящего изобретения антигенную конструкцию по настоящему изобретению, особенно иммуногенную композицию и/или терапевтическую вакцину, включающую указанную антигенную конструкцию в фрамацевтически приемлемой форме, вводят в повторяющихся дозах, в частности в 1-15 дозах, более предпочтительно в 2-10 дозах, более предпочтительно в 3-7 дозах и еще более предпочтительно в 4-6 дозах, с интервалами от 1 до 10 недель, особенно с интервалами от 1 до 6 недель, с интервалами от 1 до 4 недель и еще более предпочтительно с интервалами от 2 до 3 недель. Иммунный ответ подвергают мониторингу путем получения образцов сыворотки в соответствующее время после ревакцинации, особенно на 3-10 сутки после ревакцинации, более предпочтительно на 4-8 сутки после ревакцинации и более предпочтительно на 5-6 сутки после ревакцинации и определения иммуногенности антигенной конструкции, используя известную методологию, особенно один из наиболее распространенных методов иммуноисследования, например, метод ELISA.

Иммунизация антигенной конструкцией по настоящему изобретению, особенно иммуногенной композицией и/или терапевтической вакциной, включающей антигенную конструкцию по настоящему изобретению в фармацевтически приемлемой форме, приводит к существенному и высокоспецифичному независящему от Т-клеток иммунному ответу у животных или человека, подвергшихся лечению.

Композиции надмолекулярной антигенной конструкции по настоящему изобретению вводят пациенту, человеку или животному, с иммунной устойчивостью или пациентам с активированными Т-клетками, особенно человеку или животному, у которого существенно истощены Т-клетки, особенно CD4 Т-клетки, для индукции иммунитета в отношении антигенных агентов, например, инфекционных организмов или антигенных объектов других патологических состояний, например β-амилоидного агрегирования (болезни Альцгеймера) или гиперпролиферативных расстройств, например, рака. В организме иммунизированного человека или животного вырабатываются циркулирующие в кровяном русле антитела против инфекционного организма, тем самым, снижая или инактивируя его способность стимулировать заболевание.

Композиции по настоящему изобретению вводят человеку или животному соответствующими средствами, предпочтительно инъекцией. Например, модифицированный антигенный пептид, восстановленный в липосомах, вводят подкожной инъекцией. Независимо от того, выработаны ли антитела внутри организма или получены из внешних источников, циркулирующие в организме антитела связывают антиген и снижают или инактивируют его способность стимулировать заболевание.

В некоторых вариантах осуществления настоящего изобретения надмолекулярные антигенные конструкции включают пептид, имеющий аминокислотную последовательность β-амилоида. Пептиды также могут включать или соответствовать целому амилоидному бета-пептиду и его действующих фрагментов. Кроме того, пептиды, применимые в настоящем изобретении, дополнительно включают Аβ.

Определения

Понятия «индивидуум, особенно у животное или человек, является недостаточным по Т-клеток», «недостаточность Т-клеток», «существенная недостаточность Т-клеток» или «Т-клеточная недостаточность», применяемые в контексте настоящего изобретения, относятся к отдельным в значительной степени утратившим функциональность Т-клеткам (клетке).

Понятия «полипептид», «пептид» и «белок» в контексте настоящего изобретения являются взаимозаменяемыми и относятся к средней биомолекуле, состоящей из аминокислот, связанных пептидной связью.

Понятие «пептиды» означает цепи аминокислот (обычно L-аминокислот), у которых альфа-углероды связаны через пептидные связи, сформированные в результате реакции конденсации между карбоксильной группой альфа-углерода одной аминокислоты и аминогруппы альфа-углерода другой аминокислоты. Концевая аминокислота с одного конца цепи (т.е. амино-конца) имеет свободную амино-группу, а концевая аминокислота с другого конца цепи (т.е. карбокси-конца) имеет свободную карбокси-группу. По существу, понятие «амино-конец» (также кратко обозначаемый «N-конец») относится к свободной альфа-аминогруппе в аминокислоте с амино-конца пептида или к альфа-аминогруппе (имино-группе, при участии в пептидной связи) аминокислоты по какому-либо другому расположению в составе пептида. Сходным образом, «карбокси-конец» (также кратко обозначаемый «С-конец») относится к свободной карбокси-группе в аминокислоте с карбокси-конца пептида, или к карбокси-группе аминокислоты по какому-либо другому расположению в составе пептида.

Обычно для аминокислот, составляющих пептид, порядок нумерации начинается с амино-конца и возрастает в направлении к карбокси-концу пептида. Поэтому когда определенную аминокислоту называют «последующей», это означает, что она расположена ближе к карбокси концу пептида по сравнению с предшествующей аминокислотой.

Понятие «остаток» в контексте настоящего изобретения относится к аминокислоте, которая включена в пептид амидной связью. При этом аминокислота может быть природной аминокислотой или, если нет других ограничений, может охватывать известные аналоги природных аминокислот, которые функционируют подобно природным аминокислотам (т.е. являются миметиками аминокислот). Кроме того, миметик амидной связи включает модификации каркасов пептидов, известные специалистам в данной области.

Фраза «состоящие существенным образом из» применяется в настоящем изобретении для исключения каких-либо элементов, которые могут существенно изменить важные признаки пептидов, к которым эта фраза относится. Таким образом, описание пептида «состоящего существенным образом из…» исключает какие-либо аминокислотные замещения, добавления или делеции, которые могут существенно изменить биологическое действие этого пептида.

Кроме того, специалист может определить согласно указанному выше, что отдельные замещения, делеции или добавления, которые изменяют, добавляют или делегируют отдельную аминокислоту или малый процент аминокислот (обычно менее 5%, в большинстве случаев менее 1%) в кодированной последовательности являются консервативно модифицированными вариациями, если изменения приводят к замещению аминокислоты на химически близкую аминокислоту. Группы консервативных замещений, представляющие функционально близкие аминокислоты, хорошо известны в данной области. Ниже представлены шесть групп, каждая из которых содержит аминокислоты, которые друг для друга представляют консервативные замещения:

1) Аланин (А), серин (S), треонин (Т);

2) Аспарагиновая кислота (D), глутаминовая кислота (Е);

3) Аспарагин (N), глутамин (Q);

4) Аргинин (R), лизин (К);

5) Изолейцин (I), лейцин (L), метионин (М), валин (V), и

6) Фенилаланин (F), тирозин (Y), триптофан (W).

Понятия «выделенный» или «биологически чистый» относятся к материалу, который в основном или практически не содержит компонентов, которые в норме сопутствуют этому материалу, пребывающему в нативном состоянии. Таким образом, описанные в настоящем изобретении пептиды не содержат материалы, которые в норме связаны с их окружающей средой in situ. Обычно выделенные иммуногенные пептиды, описанные в настоящем изобретении, составляют по меньшей мере примерно 80% чистого пептида, в большинстве случаев по меньшей мере примерно 90% и предпочтительно по меньшей мере примерно 95%, что следует из измерений интенсивности полосы в окрашенном серебром геле.

Чистота или гомогенность белка может быть показана рядом методов, хорошо известных в данной области, например, электрофорезом в полиакриламидном геле образца белка с последующей визуализацией путем окрашивания. Для ряда целей может потребоваться высокое разрешение, и применяют ВЭЖХ или близкие средства очистки. Если иммуногенные пептиды относительно короткие (т.е. примерно менее 50 аминокислот в длину), их часто синтезируют, используя стандартные методы синтеза пептидов.

Твердофазный синтез, в котором С-концевые аминокислоты последовательности присоединены к нерастворимой основе с последующим последовательным добавлением остающихся аминокислот в последовательности, является предпочтительным методом для химического синтеза иммуногенных пептидов, описанных в настоящем изобретении. Методы твердофазного синтеза известны специалистам в данной области.

В другом варианте иммуногенные пептиды, описанные в настоящем изобретении, синтезируют, используя методы рекомбинации нуклеиновых кислот. Обычно к ним относятся создание последовательности нуклеиновой кислоты, которая кодирует пептид, помещение нуклеиновой кислоты в вектор экспрессии под контролем определенного промотора, экспрессии пептида в организме хозяина, выделение экспрессированного пептида или полипептида и, при необходимости, ренатурирование пептида. С методами, достаточными для того, чтобы специалист в данной области мог осуществить описанные действия, можно ознакомиться в литературе.

После экспрессии рекомбинантные пептиды могут быть очищены стандартными методами, включая осаждение сульфатом аммония, аффинную хроматографию, колоночную хроматографию, гель-электрофорез и др. В значительной степени чистые композиции с гомогенностью примерно 50-95% предпочтительны, и наиболее предпочтительны композиции с гомогенностью 80-95% или более для применения в качестве терапевтических агентов. Специалист в данной области может установить, что после химического синтеза, биологической экспрессии или очистки иммуногенные пептиды могут иметь конформацию, которая существенно отличается от нативной конформации составляющих пептидов. В этом случае часто необходимо денатурировать и уменьшить антипролиферативный пептид и затем вызвать повторную складчатость пептида в предпочтительную конформацию. Методы укорочения и денатурации белков и индукции повторной складчатости известны специалистам в данной области.

Антигенность очищенного белка может быть подтверждена, например, показательной реакцией с иммунной сывороткой или с антисывороткой, выработанной против самого белка.

В контексте настоящего изобретения понятия, указанные в единственном числе, могут также означать понятия во множественном числе и понятие «один или несколько», если из контекста не следует иначе.

Понятия «обнаружение» или «обнаруженный» в контексте настоящего изобретения означают применение известных методов для обнаружения биологических молекул, например, иммунохимических или гистологических методов, и относятся к качественному или количественному определению наличия или концентрации исследуемой биомолекулы.

Понятие «выделенная» относится к биологической молекуле, которая не содержит по меньшей мере некоторых из компонентов, с которыми эта молекула естественным образом соприкасается.

Понятия «антитело» или «антитела» в контексте настоящего изобретения являются общепризнанными в данной области и относятся к молекулам или действующим фрагментам молекул, которые связываются с известными антигенами, особенно к молекулам иммуноглобулинов и к иммунологически действующим частям молекул иммуноглобулина, т.е. к молекулам, которые содержат сайт связывания, который иммуноспецифически связывает антиген. Иммуноглобулин по настоящему изобретению может быть какого-либо типа (IgG, IgM, IgD, IgE, IgA и IgY), или класса (IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2), или подкласса молекулы иммуноглобулина.

Понятие «антитела» в рамках охвата настоящего изобретения относится к моноклональным антителам, поликлональным, химерным, одноцепочечным, биспецифическим, антителам, гибридным с антителами обезьян, антителам человека и гуманизированным антителам, а также к их действующим фрагментам. К примерам действующих фрагментов молекул, которые связываются с известными антигенами, относятся фрагменты Fab и F(ab')2, включая продукты библиотеки экспрессии Fab иммуноглобулина и эпитоп-связывающие фрагменты какого-либо из антител и фрагментов, указанных выше.

Такие действующие фрагменты могут быть получены от антитела по настоящему изобретению с помощью ряда методов. Например, очищенные моноклональные антитела могут быть расщеплены ферментом, например, пепсином, и подвергнуты гель-фильтрации ВЭЖХ. Соответствующая фракция, содержащая фрагменты Fab, затем может быть собрана и сконцентрирована мембранной фильтрацией или другим методом. Более подробное описание основных методов выделения действующих фрагментов антител см., например, в работах Khaw В.А. и др., J. Nucl. Med. 23, 1982, cc.1011-1019, Rousseaux и др., Methods Enzymology, 121, 1986, cc.663-669, изд-во Academic Press.

Понятие «гуманизированного антитела» относится к типу сконструированного антитела, обладающего областями CDR, производными от молекулы-донора иммуноглобулина, не являющегося иммуноглобулином человека, а оставшиеся производные от иммуноглобулина части молекулы происходят от одного или нескольких иммуноглобулинов человека. Кроме того, остатки, поддерживающие каркас молекулы, могут быть изменены для сохранения связывающего сродства. Методы получения «гуманизированных антител» известны специалистам в данной области (см., например. Queen и др., Proc. Nati Acad Sci USA, 86, 1989, cc.10029-10032, Hodgson и др., Bio/Technology, 9, 1991, с.421).

«Гуманизированное антитело» также может быть получено с помощью нового генноинженерного подхода, который позволяет получать поликлональные антитела, типа антител человека, со сформировавшимся сродством у крупных животных, например, у кроликов (http://www.rctech.com/bioventures/therapeutic.php).

Понятие «моноклонального антитела» также хорошо известно в данной области и относится к антителу, которое в большом количестве получают в лаборатории из единственного клона и которое распознает только один антиген. Моноклональные антитела обычно получают гибридизацией в норме короткоживущей вырабатывающей антитело В-клетки с быстрорастущей клеткой, например, с раковой клеткой (иногда такие клетки называют «бессмертными»). Получаемая гибридная клетка, или гибридома, быстро размножается, создавая клон, который вырабатывает большие количества антитела.

Понятие «функционально эквивалентного антитела» в рамках охвата настоящего изобретения относится к антителу, которое в существенной степени разделяет по меньшей мере одно важное функциональное свойство с указанным выше антителом, и в настоящем изобретении такими функциональными свойствами являются: специфичность связывания с β-амилоидным белком, особенно с белком Аβ1-42, и более конкретно с областью эпитопа 4-16 белка Аβ1-42, иммунореактивность in vitro, подавление агрегирования мономеров Аβ1-42 в высокомономерные полимерные фибриллы и/или дезагрегация ранее сформированных полимерных фибрилл Аβ1-42, и/или способность нарушать β-структуру, и облегчение проявлений расстройств, ассоциированных с амилоидозом - группой заболеваний и расстройств, ассоциированных с формированием амилоидных бляшек, включая вторичный амилоидоз и возрастной амилоидоз, включая, но ими не ограничиваясь, неврологические расстройства, например, болезнь Альцгеймера (БА), включая заболевания и состояния, отличающиеся утратой когнитивного объема памяти, например, умеренное когнитивное нарушение (УКН), деменцию с тельцами Леви, синдром Дауна, наследственную церебральную геморрагию с амилоидозом исландского типа, комплекс паркинсонизма-деменции с острова Гуам, а также другие заболевания, основанные или ассоциированные с амилоидоподобными белками, например, прогрессирующий супрануклеарный паралич, рассеянный склероз; болезнь Крейцфельдта-Якоба, болезнь Паркинсона, слабоумие, связанное с ВИЧ, амиотрофический боковой склероз (АБС), сахарный диабет взрослых; эндокринные опухоли, инсульт, травматические повреждения мозга, дегенерацию желтого пятна и глаукому, при введении для лечения или профилактики. Антитела могут относиться к какому-либо классу, например, IgG, IgM или IgA и др., или к какому-либо подклассу, например, IgG1, IgG2a и др., а также к другим подклассам, указанным выше в настоящем изобретении или известным в данной области. Кроме того, антитела могут быть получены одним из методов, например, фаговым дисплеем, или получены в каком-либо организме или линии клеток, включая бактерий, насекомых, млекопитающих или другой тип клеток или клеточных линий, которые вырабатывают антитела с требуемыми свойствами, например, гуманизированные антитела. Антитела также могут быть сформированы путем комбинирования части Fab и области Fc от разных видов.

Понятие «антиген» относится к объекту или его фрагменту, который может индуцировать иммунный ответ в организме, особенно в организме животного, более конкретно в организме млекопитающего, в том числе человека. Понятие включает иммуногены и области, ответственные за антигенность или антигенные детерминанты.

В контексте настоящего изобретения понятие «растворимый» означает, что агент частично или полностью растворим в водном растворе.

В контексте настоящего изобретения понятие «иммуногенный» относится к веществам, которые вызывают или повышают выработку антител, Т-клеток и других реактивных иммунных клеток, направленных против иммуногенного агента, и влияют на иммунный ответ у людей и животных.

Иммунный ответ происходит, когда у индивидуума вырабатывается достаточно антител, Т-клеток и других реактивных иммунных клеток против введенных иммуногенных композиций по настоящему изобретению для ослабления или облегчения расстройства, подвергаемого лечению.

В данной области понятие «гибридома» относится к клеткам, полученным путем гибридизации клеток, вырабатывающих антитела, с бессмертными клетками, например, с клетками множественной миеломы. Гибридные клетки способны непрерывно вырабатывать антитело. См. выше определение понятия «моноклональное антитело», а также приводимые ниже примеры, для более подробного описания способа гибридизации.

В контексте настоящего изобретения понятие «носитель» означает структуру, в которую антигенный пептид или надмолекулярная конструкция могут быть внедрены или с которой могут быть ассоциированы, тем самым презентируя или выставляя антигенные пептиды или часть пептида иммунной системе человека или животного. Какая-либо частица, которая может быть соответствующим образом применима при лечении животного или человека, например, пузырек, частица или крупинка, может применяться в качестве носителя в контексте настоящего изобретения.

Понятие «носитель» дополнительно включает способы доставки, в которых композиции надмолекулярных антигенных конструкций, включающих антигенный пептид, могут быть транспортированы в требуемые места с помощью механизмов доставки. В одном из примеров такой системы доставки используют коллоидные металлы, например коллоидное золото.

К белкам-носителям, которые могут применяться в композициях надмолекулярных антигенных конструкций по настоящему изобретению относятся, но ими не ограничиваются, белок, связывающий мальтозу (maltose binding protein - МВР); бычий сывороточный альбумин (БСА); гемоцианин моллюска блюдечка (keyhole lympet hemocyanin - KLH); овальбумин; флагеллин; тироглобулин; сывороточный альбумин от какого-либо вида; гамма-глобулин от какого-либо вида; сингенные клетки; сингенные клетки, несущие антигены Ша; и полимеры D- и/или L-аминокислот.

В надмолекулярной антигенной конструкции по настоящему изобретению липосома может обладать двойной функцией, заключающейся в том, что она может применяться в качестве носителя, включающего надмолекулярную конструкцию согласно описанному в настоящем изобретении выше, и одновременно действует в качестве адъюванта для повышения или стимуляции иммунного ответа в соответствующем животном или человеке, которого лечат терапевтической вакциной по настоящему изобретению. Также следует учитывать, что композиции надмолекулярной антигенной конструкции по настоящему изобретению могут дополнительно включать адъюванты, которыми однако перечень не ограничивается и к которым относятся гемоцианин моллюска блюдечка (keyhole lympet hemocyanin - KLH), бычий сывороточный альбумин (БСА) и другие адъюванты, например, липид А, алюминий, кальций фосфат, интерлейкин 1 и/или микрокапсулы полисахаридов и белков, но особенно детоксифицированный липид А, например, монофосфорильный или дифосфорильный липид А, или алюминий, дополнительные консерванты, разбавители, эмульгаторы, стабилизаторы и другие компоненты, которые известны и применяются в вакцинах в предшествующем уровне техники. Кроме того, какая-либо система адъюванта, известная в данной области, может применяться в композиции по настоящему изобретению. К таким адъювантам относятся, но ими не ограничиваются, неполный адъювант Фройнда, полный адъювант Фройнда, полидисперсный В-(1,4) связанный ацетилированный маннан («ацеманнан»), titermax® (адъюванты сополимеров полиоксиэтилена-полиоксипропилена от фирмы CytRx Corporation), модифицированные липидные адъюванты от фирмы Chiron Corporation, адъюванты - производные сапонина от фирмы Cambridge Biotech, убитые бактерии Bordetella pertussis, липополисахарид (ЛПС) грамотрицательных бактерий, крупные полимерные анионы, например, сульфат декстрана, и неорганические гели, например, квасцы, алюминий гидрохлорид или алюминий фосфат.

Кроме того, понятие «эффективное количество» означает количество антигенной/иммуногенной композиции, которая при введении человеку или животному вызывает иммунный ответ. Эффективное количество легко определяют специалисты в данной области с помощью обычных процедур.

В контексте настоящего изобретения понятие «пациент с иммунной устойчивостью» относится к пациенту, животному или человеку, у которого проявляется ограниченная способность к ответу на антигены, особенно на антигены, не являющиеся собственными, но особенно на новые антигены, например, новые антигены, имеющиеся при вновь возникающих заболеваниях. Такое ограничение может быть, по меньшей мере частично, из-за хронологического возраста CD4+ Т-клеток. Кроме того, понятие «пациент с иммунной устойчивостью» может проявлять ослабленный длительный иммунный ответ CD4+ Т-клеток на экспозицию антигена из-за нарушений в пролиферации и секреции цитокина у Т-клеток памяти во время обратных иммунных ответов.

В контексте настоящего изобретения понятие «пациент с активированными Т-клетками» относится к пациенту, животному или человеку, у которого проявляется активирование Т-клеток и у которого дополнительное стимулирование ответа Т-клеток может привести к медицинскому риску.

В контексте настоящего изобретения понятие «пациент с ослабленным иммунитетом» относится к пациенту, животному или человеку, у которого иммунная система ослаблена из-за возраста, заболевания, например ВИЧ или рака, или из-за лечения, например, лечения против воспалительных заболеваний, к которым относятся, но которыми перечень не ограничивается, ревматоидный артрит, псориаз, системная красная волчанка, грануломатоз Вегенера и др.

В рамках охвата настоящего изобретения показано, что индуцированный ответ в виде антитела на антигенную композицию по настоящему изобретению почти совершенно не зависит от Т-клеток. В связи с этим применяют модель голых мышей, которых вакцинируют и измеряют ответы в виде антител, измеряемых для оценки ответа в виде Аβ-специфического антитела, индуцированного антигенной композицией по настоящему изобретению у иммунизированных голых мышей. Голые мыши несут мутацию Foxninu и поэтому обладают пониженной функцией Т-клеток из-за утраты функционирующего тимуса.

Из приводимых ниже примеров следует, что антигенная композиция по настоящему изобретению индуцирует сильный и длительный анти-Аβ IgG ответ на модели мышей. Персистенция ответа в виде антитела близка у мышей дикого типа и у голых мышей, что является четким показателем того, что механизм действия в существенной степени независим от Т-клеток. Конкретно вакцинация голых мышей индуцирует очень близкую кинетику выработки антител при сравнении с мышами дикого типа, хотя и с повышенным титром антитела со сходным профилем IgG. Персистенция ответа антитела и распределение изотипа IgG близки у диких (Wt) и голых мышей, что является другим показателем того, что эти параметры независимы от Т-клеток в контексте вакцинации ACI-24.

Результаты, полученные при исследовании на моделе голых мышей, которые являются показателем механизма действия, независимого от Т-клеток, по выработке Аβ-антител в ответ на лечение антигенной композицией по настоящему изобретению, дополнительно поддерживаются исследованием Аβ специфического ответа в виде антитела у мышей с истощенными и неистощенными CD4 клетками. Антигенная композиция по настоящему изобретению может быть сопоставлена с вакциной, о которой известно, что она зависит от CD4 Т-клеток (Т-хелперных клеток), например, с овальбумином и алюминием гидроксидом (OVA/алюминием гидроксидом). При таком сравнении можно показать, что антигенная композиция по настоящему изобретению индуцирует высокие титры анти-Аβ антител, близкие к титрам, которые наблюдают у мышей без истощения CD4, и таким образом с независящим от Т-клеток ответом антитела против Аβ.

Из приведенного выше следует, что антигенная композиция по настоящему изобретению может индуцировать высокие титры анти-Аβ антител без участия Т-клеток, специфических Т-хелперных клеток, что позволяет ее классифицировать в качестве TI независимого антигена/вакцины.

Независящий от Т-клеток механизм действия благоприятен в плане снижения риска несоответствующей активации Т-клеток и ассоциированных нежелательных воспалительных ответов, например, энцефалита.

Кроме того, независимый от Т-клеток механизм действия представляет низкий риск клинической опасности, что делает антигенную композицию по настоящему изобретению особенно пригодной для терапевтического применения.

В другом объекте настоящего изобретения антигенная композиция настоящего изобретения может применяться для преодоления иммунной устойчивости у людей - пациентов с болезнью Альцгеймера. Этот объект настоящего изобретения поддерживается приводимыми ниже примерами, в которых на модели обезьян показано, что антигенная композиция по настоящему изобретению индуцирует анти-Аβ IgG ответ у макак крабоедов. Наименьшая доза, индуцирующая анти-Аβ IgG ответ, находится в диапазоне 50-150 мкг, особенно 65-120 мкг, особенно 70-100 мкг, особенно 76-80 мкг модифицированного антигенного пептида.

В другом варианте осуществления настоящего изобретения предусмотрен способ преодоления иммунной устойчивости у людей - пациентов с болезнью Альцгеймера, особенно у тех из них, у которых имеется недостаточность Т-клеток, особенно недостаточность CD4 Т-клеток, включающий введение указанному пациенту терапевтически эффективной дозы антигенной композиции по настоящему изобретению, особенно антигенной композиции, содержащей 50-150 мкг, особенно 65-120 мкг, особенно 70-100 мкг, особенно 75-80 мкг модифицированного антигенного пептида, особенно пальмитилированного антигенного пептида, особенно пальмитилированного Аβ 1-15 антигенного пептида.

Перечень последовательностей

SEQ ID NO: 1 контрольная последовательность Т5: Tau 379-408 [pS396, pS404]

SEQ ID NO: 2 последовательность 1 (T1): Tau 5-20 [pY18]

SEQ ID NO: 3 последовательность 8 (T8): Tau 206-221 [рТ212, pS214]

SEQ ID NO: 4 последовательность 9 (Т9): Tau 196-211 [pS202, pT205

SEQ ID NO: 5 последовательность 3 (Т3): Tau 393-408 [pS396, pS404]

SEQ ID NO: 6 последовательность 4 (T4): Tau 401-418 [pS404, pS409]

SEQ ID NO: 7 последовательность 2 (T2): Tau 200-216 [pS202+pT205 и pT212+pS214]

SEQ ID NO: 8 антигенный пептид Аβ 1-15

SEQ ID NO: 9 антигенный пептид Аβ 1-16

SEQ ID NO: 10 антигенный пептид Аβ 1-16(?14)

SEQ ID NO: 11 антигенный пептид Аβ 4-11

SEQ ID NO: 12 антигенный пептид Аβ 22-35

SEQ ID NO: 13 антигенный пептид Аβ 29-40

SEQ ID NO: 14 антигенный пептид Аβ 1-5

Примеры

Пример 1. Ответ на антитело у самок голых мышей Задача настоящего исследования заключается в оценке ответа в виде выработки амилоид-бета (Аβ)-специфического антитела, индуцированного партией ACI-24 у самок голых мышей. Голые мыши, несущие мутацию Foxnlnu, обладают сниженной функцией Т-клеток из-за утраты должным образом функционирующей тимусной железы. Таким образом, цель настоящего изобретения заключается в анализе, является ли ответ в виде выработки антитела, индуцированный ACI-24, независимым от Т-клеток.

Голым мышам с теневым фенотипом C57BL/6 и соответствующим однопометным животным в возрасте 11 или 13 недель вводят подкожную инъекцию (п.к.). Мышей иммунизируют 3 раза с интервалами 2 недели и отбирают кровь через неделю после каждой иммунизации. Суммарные анти-Аβ IgG ответы измеряют методом ELISA. Кроме того, исследуют изотипический образец анти-Аβ IgG.

Чтобы проверить отсутствие Т-хелперных клеток у голых мышей, оценивают процент клеток CD3+ CD4+ с помощью сортировщика флуоресцентно-активированных клеток (fluorescence-activated cell sorter -FACS).

1.1 Методы

Получение вакцины ACI-24

Липосомы получают растворением димиристоилфосфатидилхолина (ДМФХ, фирма Lipoid, Швейцария), димиристоилфосфатидилглицерина (ДМФГ, фирма Lipoid, Швейцария) и холестерина (фирма Solvay, Нидерланды) при мольном соотношении 9:1:7 в EtOH при 40-60°С. Пальмитилированный Аβ 1-15 (Pall-15, последовательность Аβ человека) растворяют в 1% октил-β-D-глюкопиранозид (β-OG, фирма Pentapharm) при 60°С в ФСБ рН 11,5. Раствор липида/этанола стерилизуют фильтрацией, вносят инъекцией в раствор β-OG/ФСБ и немедленно разводят в ФСБ. Полученные липосомы стерилизуют фильтрацией и концентрируют с помощью двойной ультрафильтрации до достижения определенной концентрации липида. Монофосфорильный липид А (МФЛА, фирма Avanti Polar Lipids, Inc. AL, США) добавляют в то же время, что и фосфолипиды.

1.1.2 Иммунизация

На фирме JSW Life Sciences голых мышей (B6.Cg-Foxlnu/J) теневым фенотипом C57BL/6 и соответствующим однопометным животным (11 мышей/группу) трижды вводят подкожными инъекциями ACI-24 или ФСБ с двухнедельным интервалом между введениями (0, 14, 28 сутки) в соответствии с табл.1. Образцы плазмы из нижнечелюстного сплетения берут за 7 суток до проведения первых инъекций и на 7, 21, 35, 56, 70, 84 и 98 сутки после первых инъекций. Титры Аβ1-42-специфических IgG и IgM антител и изотипического IgG определяют методом ELISA. Образцы крови также берут на 77 или на 63 сутки после первой иммунизации для анализа методом FACS для определения процента CD3+/CD4+ клеток.

Подсчет Аβ-специфических антител

Аβ1-42-специфические IgG антитела определяют методом ELISA. На планшеты наносят 10 мкг/мл Аβ 1-42 (фирма Bachem, Бубендорф, Швейцария) в течение ночи при 4°С. После промывки с помощью 0,05% Tween 20 в ФСБ и блокирования 1% БСА, серийные разведения сыворотки добавляют в планшеты и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют со щелочной фосфатазой (ЩФ), конъюгированной с антителом против IgG мыши (фирма Jackson Immunoresearch West Grove, Пенсильвания, США), пероксидазой хрена (HRP), конъюгированной со специфическими антителами против изотипов мыши IgM или IgG (IgG1-AP, IgG2a-биотин, IgG3-биотин6 (все от фирмы Pharmingen BD, Сан-Диего, Калифорния, США) или IgG2b-HRP (фирма Zymed Laboratories, Сан-Франциско, Калифорния) в течение 2 ч при 37°С. Для антител IgG2a и IgG3 проводят дополнительное инкубирование в течение 45 мин при комнатной температуре со стрептавидином-HRP. После последней промывки планшеты инкубируют с субстратом щелочной фосфатазы (pNPP) или с субстратом HRP (ABTS) и считывают при 405 нм, используя ридер для планшетов ELISA. Результаты выражают относительно серийных разведении коммерчески доступного антитела (6Е10, фирма Covance, Emery ville, Калифорния, США) или в виде оптической плотности (ОП).

1.1.3 Подсчет клеток CD3+/CD4+

Образцы крови мыши лизируют аммонием хлоридом по просветления, затем центрифугируют при 400×g в течение 7 мин и осадки ресуспендируют в ФСБ, содержащем EDTA. Затем клетки блокируют блокирующим реагентом CD16/CD32 и окрашивают CD4 (РЕ конъюгат) и CD3 (РЕ-Су5) антителами в течение 30 мин при 4°С. Образцы промывают с помощью ФСБ, ресуспендируют в фиксирующем растворе (DB Cellfix, разведенном 1:40 в BD FACSFlow) и помещают в цитометр BD FACS Calibur. Оценивают процент прошедших клеток, которые положительно окрашены по CD3+ и CD4+ (Т-хелперных клеток).

Приводимая ниже табл.1 показывает распределение мышей по разным группам.

Таблица 1
Распределение мышей по разным группам
Группа Количество животных и их пол Лечение/Объема Партия
вакцины
Способ Способ
введенияб
Уровень дозирования
Количество Pal1-15 мкг/дозув
Количество МФЛА мкг/дозуг
1 11 самок голых мышей ФСБ 107К2314 - П.к. 0 0
2 11 самок голых мышей ACI-24-125 0,2 мл ACI24 0408-А D П.к. 77 -
2 11 самок мышей Wt ACI-24-125 0,2 мл ACI24 0408-А D П.к. 77 -
а: теоретически рассчитанный объем
б: п.к.: подкожно
в: измеренное количество, определенное после анализа
г: теоретически рассчитанное количество

1.2 Результаты

Ни одно из животных не умерло преждевременно и в ходе лечения не выявлено побочных эффектов. У всех B6.Cg-Foxnlnu/J животных имеется фенотип голых мышей, хотя у однопометные животных дикого типа (wild - Wt) мех нормальный.

Подсчет клеток CD3+/CD4+

Окрашивание клеток CD3+/CD4+ с последующим анализом методом FACS показывает существенное снижение числа Т-хелперных клеток (клетки CD3+/CD4+) у голых мышей по сравнению с животными Wt (фиг.1).

Процент прошедших клеток, которые были положительно окрашены по CD3 и CD4, от голых мышей, получающих или ФСБ, или ACI-24, и мышей Wt, получающих ACI-24. Каждая колонка представляет среднее значение и стандартное отклонение для групп из 11 мышей. Правая панель: схематическое представление анализа FACS в двух группах: голых мышей и мышей Wt.

Анализ иммунного ответа

Титры у мышей wt и голых мышей исследуют, чтобы установить, действительно ли ответ, индуцированный ACI-24, зависит от функции Т-клеток. У мышей обеих линий, Wt и голых мышей, вакцина ACI-24 (партия класса типа GMP №4) индуцирует сильные анти-Аβ IgG ответы по сравнению с ФСБ (фиг.2; двухфакторный анализ ANOVA иммунизации: Р<0,0001, ревакцинация Р<0,015 и ревакцинация иммунизации*, Р<0,015). После первой иммунизации титры у голых мышей сходны с титрами мышей Wt. Во все другие дни ревакцинации титры у голых мышей существенно выше, чем титры у мышей Wt (двухфакторный анализ ANOVA). Однако при анализе однофакторным дисперсионным анализом ANOVA титры у голых мышей остаются существенно более высокими только на 35 сутки.

Для контроля эффекта ревакцинации исследуют титры после каждой инъекции (т.е. на 7, 21 и 35 сутки). У голых мышей, подвергнутых лечению вакциной ACI-24, нет существенного различия между указанными сутками ревакцинации, выявляя отсутствие эффекта ревакцинации. В группе мышей Wt, подвергнутых лечению вакциной ACI-24, присутствует эффект ревакцинации после второй инъекции (однофакторный анализ ANOVA на 21 сутки по сравнению с 7 сутками).

Для проверки персистенции иммунного ответа исследуют титры после последней инъекции (35, 56, 70, 84 и 98 сутки). И у голых мышей, и у мышей Wt, подвергнутых лечению ACI-24, титры остаются высокими даже через 3 месяца после последней иммунизации (однофакторный анализ ANOVA: нет существенного различия между 7 сутками и 98 сутками в каждой группе). У мышей Wt, обработанных ACI-24, титры на 98 сутки снижаются незначительно при сравнении с титрами на 35 сутки, однако не установлено существенного снижения для голых мышей.

Рассматриваемые вместе, эти результаты показывают, что ACI-24 индуцирует сильный и устойчивый ответ в виде выработки антитела и у голых мышей, и у мышей Wt.

Анализ анти-Аβ IgG антитела в плазме голых мышей и мышей Wt, получающих вакцину ACI-24 на 7, 21, 35, 56, 70, 84 и 98 сутки после первой иммунизации. Результаты выражают в виде средней величины + стандартное отклонение, полученное в группах из 11 мышей.

Вакцина ACI-24 индуцирует ответ в виде выработке анти-Аβ IgM антитела, который существенно отличается от ФСБ на 7 и 35 сутки и в голых мышах, и в мышах Wt (фиг.3). В обеих группах титры IgM выше на 7 сутки после первой иммунизации и существенно снижаются на 35 сутки. Ответы в виде IgM антитела сходны у голых мышей, и у мышей Wt, обработанных вакциной ACI-24 в дни проведения ревакцинаций.

Анализ анти-Аβ IgM антител в плазме голых мышей и мышей Wt, получавших вакцину ACI-24 проводят на 7 и 35 сутки после первой иммунизации. Результаты выражают в виде средней величины + стандартное отклонение, полученное в группах из 11 мышей.

В обеих группах (и голых мышей, и мышей дикого типа) вакцина ACI-24 индуцирует анти-Аβ антитела изотипов IgG1, IgG2a, и IgG2b и IgG3 с IgG2b в качестве крупного подкласса (фиг.4).

Профили подклассов IgG у голых мышей и у мышей дикого типа близки.

Анализ анти-Аβ IgG1, IgG2a, IgG2b, IgG3 антител в плазме голых мышей и мышей дикого типа, получающих вакцину ACI-24 на 7 и 35 сутки после первой иммунизации. Результаты выражают в виде ОП при разведении 1/200 (IgG1) 1/1600 (IgG2a) и 1/6400 (IgG2b) и 1/1600 (IgG3), которая показывает среднюю величину + стандартное отклонение, полученное в группах из 11 мышей.

При сравнении титров IgG2a и IgG2b в одном и том же разведении антитела IgG2b преобладают и у мышей Wt, и у голых мышей (фиг.5). В соответствии с титрами IgG, титры IgG2b у голых мышей существенно выше, чем у мышей Wt на 7 и 35 сутки.

Анализ анти-Аβ IgG2a и IgG2b антител в плазме голых мышей и мышей Wt, получающих вакцину ACI-24 на 7 и 35 сутки после первой иммунизации. Результаты выражают в виде ОП при разведении 1/3200, показывающей среднюю величину + стандартное отклонение, полученное в группах из 11 мышей.

Несмотря на малый процент клеток CD3 и CD4 у голых мышей, вакцина ACI-24 индуцирует сильный анти-Аβ IgG ответ. Персистенция ответа в виде антитела и распределение изотипа IgG близки у мышей Wt и у голых мышей, подтверждая, что эти параметры независимы от Т-клеток в контексте вакцинации ACI-24. При сравнении с иммунокомпетентными мышами иммунизация вакциной ACI-24 индуцирует идентичную кинетику антитела, повышенный титр антитела со сходным профилем IgG у мышей с недостаточностью Т-клеток, показывая, что ACI-24 индуцирует независящий от Т-клеток ответ в виде антитела и у голых мышей, и у мышей Wt.

Пример 2. Эффективность ACI-24 у мышей с истощением CD4 - истощение происходит до иммунизации

Задача настоящего исследования заключается в оценке ответа в виде антитела, специфичного в отношении амилоида бета (Аβ), индуцированного ACI-24 у C57BL/6 мышей с истощением и без истощения CD4. Эту вакцину сравнивают с овальбумином (ovalbumin - OVA) и алюминием гидроксидом (Alum) - вакциной, о которой известно, что она зависит от CD4 Т-клеток (Т-хелперных клеток). Мышам C57BL/6 вводят внутрибрюшинной инъекцией анти-CD4 моноклональное антитело и подкожно их иммунизируют ACI-24 или OVA/ алюминием гидроксидом через трое суток. Образцы крови отбирают на 4, 7, 14 и 21 сутки после иммунизации. Сортировку клеток по флуоресценции (Fluorescence-activated cell sorter - FACS) проводят на 21 сутки после иммунизации для подтверждения истощения CD4. Совокупные анти-Аβ IgG ответы измеряют методом ELISA в каждом взятом образце крови.

2.1 Методы

2.1.1 Получение вакцины ACI-24

Липосомы получают согласно описанному в примере 1.1.

2.1.2 Получение вакцины OVA/ алюминий гидроксид Вакцину OVA получают разведением 10 мг OVA (фирма Sigma) в 1 мл стерильной воды и дополнительно разводят в ФСБ для получения концентрации 1 мг/мл. Конечный раствор 0,5 мг/мл OVA вносят в 5 мг/мл алюминия гидроксида (Alhydrogel 2%; фирма Brenntag Biosector, Frederikssund, Дания), приготовленного в 0,9% NaCl.

2.1.3 Истощение CD4

Истощения клеток CD4 достигают внутрибрюшинной инъекцией (200 мкл) анти-CD4 антитела (клон YTS191.1; фирма AbD Serotec, Оксфорд, Великобритания), разведенного в ФСБ (100 мкг/дозу/мышь), за трое суток до иммунизации (сутки - 3). Всех животных исследуют методом FACS на 21 сутки после иммунизации.

2.1.4 Иммунизации

Пяти взрослым мышам C57BL/6 (5 самок/группу) вводят подкожно инъекции 200 мкл/мышь ACI-24 или OVA/ алюминия гидроксида на 0 сутки (трое суток после истощения CD4) по табл.2. Образцы крови берут на 4, 7 и 14 сутки, а также с день умерщвления (21 сутки). Получают плазму от всех образцов крови и анти-Аβ1-42-специфический IgG и анти-OVA-специфический IgG определяют методом ELISA.

2.1.5 Анализ с помощью сортировщика флуоресцентно-активированных клеток (fluorescence-activated cell sorter - FACS)

Кровь от всех животных собирают на 21 сутки после иммунизации для анализа FACS для подтверждения истощения CD4. Лизис красных клеток крови проводят путем инкубирования образцов крови с помощью лизирующего буфера АСК (фирма Invitrogen, Paisley, Великобритания) в течение 10 мин при 4°С. Оставшиеся клетки промывают в холодном ФСБ и инкубируют с АРС-меченым анти-CDS (клон КТ3; фирма AbD Serotec) и FITC-меченым анти-CD4 (клон RM4-5; фирма AbD Serotec) при 4°С в темноте в течение 30 мин. Затем клетки промывают в холодном ФСБ, ресуспендируют в 1% параформальдегиде в ФСБ и исследуют на жидкостном цитометре CyAn ADP (фирма Beckman Coulter GMBH, Lausanne, Швейцария). Процент прошедших клеток, положительно окрашенных в отношении CD3+/CD4+, перерабатывают и определяют, используя программное обеспечение Summit V4.3.01 (Beckman Coulter GMBH).

Табл. 2 иллюстрирует распределение мышей по разным группам.

Таблица 2
Распределение мышей по разным группам
Группа Количество животных и их пола Лечение и объема Лечение и объемб Способ Уровень дозирования
Количество Pall-15
мкг/дозув
Количество МФЛА
(мкг/дозув,г)
Количество OVA/ алюминия гидроксида
(мкг/дозу)
F 5 самок Истощение CD4 (200 мкл) ACI-24 (200 мкл) D 83.2 15
G 5 самок ACI-24 (200 мкл) D 83,2 15
Н 5 самок Истощение CD4 (200 мкл) OVA/ алюминий гидроксид (200 мкл) 100/1000
I 5 самок OVA/ алюминий гидроксид (200 мкл) 100/1000
а: в.б.: внутрибрюшинно
б: п.к.: подкожно
в: измеренное количество, определенное после анализа
г: сумма МФЛА представителей А+В

2.1.6 Количественная оценка Аβ-специфических антител

Ответ в виде Аβ1-42-специфического IgG определяют методом ELISA. Планшеты покрывают 10 мкг/мл Аβ1-42 (фирма Bachem, Бубендорф, Швейцария) в течение ночи при 4°С. После промывки с помощью 0,05% Tween 20 в ФСБ и блокирования с помощью 1% БСА серийные разведения сыворотки вносят в планшеты и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют со щелочной фосфатазой (ЩФ), конъюгированной с антителом против мышиного IgG (фирма Jackson Immunoresearch West Grove, Пенсильвания, США) в течение 2 ч при 37°С. После заключительной промывки планшеты инкубируют с субстратом ЩФ (pNPP) и прочитывают при 405 нм, используя ридер для планшетов ELISA. Результаты выражают относительно серийных разведении коммерчески доступного антитела (6Е10, фирма Covance, Emeryville, Калифорния, США).

2.1.7 Подсчет OVA-специфических антител

OVA-специфические IgG антитела определяют методом ELISA в течение ночи при 4°С. Затем на планшеты наносят 30 мкг/мл OVA (фирма Sigma, A5503), промывают с помощью ФСБ-0,05% Tween 20 и блокируют 1% БСА, серийные разведения сыворотки добавляют в планшеты и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют с ЩФ, конъюгированной с общим антителом против IgG мыши (фирма Jackson Immunoresearch, Пенсильвания, США), в течение 2 ч при 37°С. После заключительной промывки планшеты инкубируют с pNPP и прочитывают при 405 нм, используя ридер для планшетов ELISA. Результаты выражают в виде оптической плотности (ОП).

2.2 Результаты

Установлено, что ни одно из животных не умерло преждевременно, и не выявлено побочных эффектов из-за истощения CD4 после иммунизации ACI-24 или OVA/ алюминием гидроксидом. Массы тела в разных группах сходны, хотя на 21 сутки у мышей, иммунизированных ACI-24, наблюдают существенные изменения при сравнении истощенных и неистощенных мышей (двухфакторный анализ ANOVA, Р<0,05). Другие существенные изменения наблюдают между группами, хотя их не было между сопоставимыми обработками и, следовательно, они не являются значимыми.

Анализ массы тела у мышей с истощением CD4 и без такого истощения, иммунизированных OVA/ алюминием гидроксидом. Результаты выражают в виде средней величины + стандартное отклонение при n=5 для каждой группы.

2.2.1 Подсчет клеток CD3+/CD4+

Окрашивание CD3+/CD4+ с последующим анализом методом FACS показывает пониженное содержание числа CD3+/CD4+ (Т-хэлперных клеток) у животных в группах с истощением CD4 (фиг.6). Существенное различие установлено у мышей с истощением CD4 и без такого истощения после иммунизации OVA/ алюминием гидроксидом (фиг.6, однофакторный анализ ANOVA, P<0,05).

2.2.2 Иммунный ответ после иммунизации ACI-24

Титры анти-Аβ у мышей с истощением и без истощения CD4 исследуют для выяснения, является ли ответ, индуцированный ACI-24, независимым от CD3+/CD4+ (Т-хэлперные клетки). Вакцина ACI-24 индуцирует сильный анти-Аβ IgG ответ, начиная с 7 суток и до 21 суток. В целом мыши с истощением CD4 проявляют повышенные, хотя и несущественные анти-Аβ титры с 7 суток до последнего отбора крови (21 сутки) (фиг.7).

Титры анти-Аβ IgG антител в плазме мышей C57BL/6 на 4, 7, 14 и 21 сутки после иммунизации ACI-24. Результаты выражают в виде средней величины + стандартное отклонение, полученной в группах по 5 мышей.

2.2.3 Иммунные ответы после иммунизации OVA/ алюминием гидроксидом

Титры анти-OVA IgG исследуют, чтобы выяснить, достигнуто ли истощение CD4, поскольку высокие титры IgG против OVA зависят от клеток CD3+/CD4+ (Т-хэлперные клетки). Получают незначительные титры на 4 и 7 сутки и у животных с истощением CD4, и у животных без такого истощения, когда ОП записывают при 1/100 или 1/800. На 14 сутки титры анти-OVA IgG существенно ниже у мышей с истощением CD4 при сравнении с мышами без такого истощения (фиг.8, двухфакторный анализ ANOVA Р<0,001);

полученные данные подтверждают, когда ОП записывают при 1/800 (фиг.9, двухфакторный анализ ANOVA P<0,05). Титры анти-OVA на 21 сутки идентичны у мышей с истощением CD4 и без такого истощения, подтверждая, что популяция CD4 Т-клеток восстанавливается в таких временных рамках (с - 3 до 21 суток).

Титры анти-OVA IgG антител в плазме мышей C57BL/6 на 4, 7, 14 и 21 сутки после иммунизации OVA/ алюминием гидроксидом. Результаты выражают в виде ОП средней величины + стандартное отклонение, полученной в группах по 5 мышей при прочтении при 1/100.

Титры анти-OVA IgG антител в плазме мышей C57BL/6 на 4, 7, 14 и 21 сутки после иммунизации OVA/ алюминием гидроксидом. Результаты выражают в виде ОП средней величины + стандартное отклонение, полученной в группах по 5 мышей при прочтении при 1/800.

Несмотря на малый процент клеток CD3+/CD4+ у мышей с истощением CD4, вакцина ACI-24 индуцирует высокие титры анти-Аβ, близкие к титрам у мышей без такого истощения. Согласно сделанным прогнозам, титры IgG против OVA у мышей с истощением CD4 существенно ниже, чем титры, наблюдаемые у мышей без истощения CD4 через 14 суток после иммунизации, подтверждая, что истощение CD4 оказывает прямое воздействие на классический Т-зависимый ответ в виде выработки антитела. Рассматриваемые вместе, результаты показывают, что истощение CD4 было успешным и что у мышей C57BL/6 вакцина ACI-24 индуцирует независящий от Т-клеток ответ в виде антитела против Аβ.

Пример 3. Эффективность вакцины ACI-24 у мышей с истощением CD4 - истощение происходит каждую неделю перед иммунизацией

Задача настоящего изобретения заключается в оценке амилоид-бета (Аβ)-специфического ответа, индуцированного вакциной ACI-24 у мышей C57BL/6 с истощением CD4 и без такого истощения. Такую вакцину сравнивают с вакциной овальбумина (OVA) и алюминия гидроксида, для которой известна зависимость от Т-клеток CD4 (Т-хэлперных клеток). Мышам C57BL/6 каждую неделю вводят инъекцией анти-CD4 моноклональное антитело внутрибрюшинно и подкожно иммунизируют с помощью ACI-24 или OVA/ алюминия гидроксида через трое суток после первой анти-CD4 инъекции. Образцы крови отбирают на 7, 14 и 21 сутки после иммунизации. Сортировку клеток по флуоресценции (Fluorescence-activated cell sorter - FACS) проводят каждый раз в день отбора крови для подтверждения истощения CD4. Совокупные анти-Аβ IgG ответы измеряют методом ELISA в каждом взятом образце крови.

3.1 Методы

3.1.1 Получение вакцины ACI-24

Липосомы получают согласно описанию в примере 1.1

3.1.2 Получение вакцины OVA/ алюминий гидроксид Вакцину OVA получают разведением 10 мг OVA (фирма Sigma) в 1 мл стерильной воды и дополнительно разводят в ФСБ для получения концентрации 1 мг/мл. Конечный раствор 0,5 мг/мл OVA вносят в 5 мг/мл алюминия гидроксида (Alhydrogel 2%; фирма Brenntag Biosector, Frederikssund, Дания), приготовленного в 0,9% NaCl.

3.1.3 Истощение CD4

Истощения клеток CD4 в группах А и С достигают внутрибрюшинной инъекцией (200 мкл) анти-CD4 антитела (клон YTS191.1; фирма AbD Serotec, Оксфорд, Великобритания), разведенного в ФСБ (100 мкг/дозу/мышь), за трое суток до иммунизации (сутки - 3) и после иммунизации еженедельно (4, 11 и 18 сутки). В группах В и D вводят инъекцией ФСБ. Анализ FACS проводят для всех животных каждый раз при взятии крови (на 7, 14 и 21 сутки).

3.1.4 Иммунизации

Взрослым мышам линии C57BL/6 (8 самок/группу) вводят подкожно инъекциями 200 мкл/мышь ACI-24 или OVA/ алюминия гидроксида через трое суток после первого истощения CD4 (0 сутки) согласно табл.3. Кровь берут на 7, 14 и 21 сутки. Получают плазму от всех образцов крови, и анти-Аβ1-42-специфический IgG и анти-OVA-специфический IgG определяют методом ELISA.

Кровь у всех животных берут на 7, 14 и 21 сутки после иммунизации для анализа FACS для подтверждения истощения CD4. Лизис красных клеток крови проводят путем инкубирования препаратов крови с лизирующим буфером АСК-(фирма Invitrogen, Paisley, Великобритания) в течение 10 мин при 4°С. Оставшиеся клетки промывают в холодном ФСБ и инкубируют с АРС-меченым анти-CD3 (клон КТ3; фирма AbD Serotec) и FITC- меченым анти-CD4 (клон RM4-5; фирма AbD Serotec) при 4°С в темноте в течение 30 мин. Затем клетки промывают в холодном ФСБ, ресуспендируют в 1% параформальдегиде в ФСБ и исследуют на жидкостном цитометре CyAn ADP (фирма Beckman Coulter GMBH, Lausanne, Швейцария). Процент прошедших клеток, положительно окрашенных в отношении CD3+/CD4+, перерабатывают и определяют, используя программное обеспечение Summit V4.3.01 (Beckman Coulter GMBH).

Табл. 3 иллюстрирует распределение мышей по разным группам.

Таблица 3
Распределение мышей по разным группам
Группа Количество животных и их пол Лечение и объема Лечение и объемб Способ Уровень дозирования
Количество Pall-15
мкг/дозув
Количество МФЛА
(мкг/дозув,г)
Количество OVA/ алюминия гидроксида
(мкг/дозу)
А 8 самок Истощение CD4 (200 мкл) ACI-24 (200 мкл) D 83,2 15
В 8 самок ФСБ (200 мкл) ACI-24 (200 мкл) D 83,2 15
С 8 самок Истощение CD4 (200 мкл) OVA/ алюминий гидроксид (200 мкл) 100/1000
D 8 самок ФСБ (200 мкл) OVA/ алюминий гидроксид (200 мкл) 100/1000
а: внутрибрюшинное введение
б: подкожное введение
в: измеренное количество, определенное после анализа
г: сумма представителей МФЛА А+В

3.1.5 Определение количества Аβ-специфических антител

Аβ1-42-специфический IgG ответ определяют методом ELISA. Планшеты покрывают 10 мкг/мл Аβ1-42 (Bachem, Бубендорф) в течение ночи при 4°С. После промывки с помощью 0,05% Tween 20 в ФСБ и Switzerland блокирования 1% БСА, серийные разведения сыворотки добавляют в планшеты и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют со щелочной фосфатазой (ЩФ), конъюгированной с антителом против IgG мыши (фирма Jackson Immunoresearch West Grove, Пенсильвания, США) в течение 2 ч при 37°С. После последней промывки планшеты инкубируют с субстратом щелочной фосфатазы (pNPP) и считывают при 405 нм, используя планшетный ридер ELISA. Результаты выражают, ссылаясь на серийные разведения коммерчески доступного антитела (антитело 6Е10, фирма Covance, Emery ville. Калифорния, США).

3.1.6 Подсчет OVA-специфических антител

OVA-специфические IgG антитела определяют методом ELISA. Планшеты покрывают 30 мкг/мл OVA (фирма Sigma, A5503) в течение ночи при 4°С. После промывки с помощью ФСБ-0,05% Tween-20 и блокирования с помощью 1% БСА серийные разведения сыворотки добавляют в планшеты и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют со щелочной фосфатазой, конъюгированной с общим антителом против IgG мыши (фирма Jackson Immunoresearch, Пенсильвания, США) в течение 2 ч при 37°С. После последней промывки планшеты инкубируют с pNPP и считывают при 405 нм, используя планшетный ридер ELISA. Результаты выражают в единицах оптической плотности (ОП).

3.2 Результаты

Хотя одно животное умерщвляют по причинам, не связанным с лечением/иммунизацией (№3 в группе С), ни одно из животных не умерло преждевременно, и не наблюдают побочных эффектов из-за истощения CD4, иммунизации ACI-24 или OVA/ алюминием гидроксидом. Масса тела животных в разных группах также не подвергалась влиянию разных вариантов лечения.

3.2.1 Подсчет клеток CD3+/CD4+

Окрашивание клеток CD3+/CD4+ с последующим анализом методом FACS показывает существенное снижение числа Т-хелперных клеток (клетки CD3+/CD4+) у мышей в группах с истощением CD4 во все дни взятия крови (Р<0,001, двухфакторный анализ ANOVA) (фиг.10).

Процент прошедших клеток, которые были положительно окрашены по CD3 и CD4, в группах иммунизации ACI-24 и OVA/ алюминием гидроксидом во все дни (7, 14 и 21 сутки). Результаты выражают в виде процента средней величины CD3+/CD4+ + стандартного отклонения, полученной в группах из 10 мышей.

3.2.2 Иммунный ответ после иммунизации ACI-24

Титры анти-Аβ у мышей с истощением CD4 и без такого истощения исследуют для проверки, действительно ли ответ, индуцированный ACI-24, не зависит от CD3+/CD4+ (Т-хэлперные клетки). Вакцина ACI-24 индуцирует сильный анти-Аβ IgG ответ, начиная с 7 и до 21 суток. Нет существенного отличия титров анти-Аβ при их сравнении у мышей с истощением CD4 и без такого истощения (фиг.11).

Титры анти-Аβ IgG антител в плазме мышей C57BL/6 на 7, 14 и 21 сутки после иммунизации ACI-24. Результаты выражают в виде средней величины + стандартное отклонение, полученное в группах из 10 мышей.

3.2.3 Иммунные ответы после иммунизации OVA/ алюминием гидроксидом

Титры анти-OVA IgG исследуют для подтверждения истощения CD4, поскольку высокие титры IgG против OVA зависят от клеток CD3+/CD4+ (Т-хелперных клеток). Незначительные титры наблюдают на 7 сутки и у животных с истощением CD4, и у животных без истощения, когда ОП записывают при 1/100 или 1/800. На 14 сутки титры анти-OVA IgG существенно ниже у мышей с истощенными CD4 по сравнению с мышами, у которых нет такого истощения (фиг.12, двухфакторный анализ ANOVA P<0,001); полученные данные подтверждают на 14 и 21 сутки, когда ОП записывают при 1/800 (фиг.13, двухфакторный анализ ANOVA Р<0,001 и Р<0,01, соответственно).

Титры анти-OVA IgG антител в плазме C57BL/6 мышей на 7, 14 и 21 сутки после иммунизации OVA/ алюминием гидроксидом. Результаты выражают в виде ОП средней величины + стандартное отклонение, полученное в группах по 10 мышей при прочтении при 1/100. Титры анти-OVA IgG в плазме мышей C57BL/6 на 7, 14 и 21 сутки после иммунизации OVA/ алюминием гидроксидом. Результаты выражают в виде ОП средней величины + стандартное отклонение, полученное в группах из 10 мышей при прочтении при 1/800.

Несмотря на малый процент клеток CD3 и CD4 у мышей с истощением CD4, вакцина ACI-24 индуцирует высокие титры анти-Аβ, близкие к титрам у мышей без истощения CD4. Подтверждая сделанное предположение, титры IgG против OVA у мышей с истощением CD4 существенно ниже тех титров, которые наблюдают у мышей без истощения CD4 на 14 (ОП 1/100) и 21 сутки после иммунизации (1/100 и 1/800 ОП), подтверждая, что истощение CD4 непосредственно воздействует на классический Т-зависимый ответ в виде антитела. Вместе эти результаты показывают, что истощение CD4 прошло успешно, и что у мышей C57BL/6 вакцина ACI-24 индуцирует независимый от CD4 Т-клеток ответ в виде антитела против Аβ.

Пример 4. Иммуногенность ACI-24 у макак крабоедов

Задача настоящего изобретения заключается в оценке иммуногенности ACI-24 у макак крабоедов (Масаса fascicularis). Макак крабоедов выбирают для настоящего исследования, поскольку аминокислотная последовательность амилоидного пептида полностью гомологична при сравнении обезьян и человека. Обезьяны экспрессируют β-амилоид (Аβ) в качестве собственного белка и поэтому может иметь определенный уровень иммунологической устойчивости против этого пептида. Для того чтобы начать анализ и определить, является ли иммунизация вакциной ACI-24, содержащей пальмитилированный пептид Аβ1-15 (Pall-15) человека, следует нарушить иммунную устойчивость у этих обезьян.

Для определения иммуногенности ACI-24 обезьянам подкожно (п.к.) вводят 6 доз ACI-24 с 4-х недельными интервалами. Ответ в виде антитела исследуют путем измерения титров анти-Аβ IgM и IgG антител в сыворотке иммунизированных обезьян в разные сроки после вакцинации методом ELISA.

4.1 Методы

4.1.1 Получение вакцины ACI-24

Липосомы получают растворением димиристоилфосфатидилхолина (ДМФХ, Lipoid, Швейцария), димиристоилфосфатидилглицерина (ДМФГ, фирма Lipoid, Швейцария) и холестерина (фирма Solvay, Нидерланды) при мольном соотношении 9:1:7 в EtOH при 40-60°С. Пальмитилированный Аβ1-15 (Pall-15, последовательность Аβ1-15 человека) растворяют в 2% октил-β-D-глюкопиранозиде (β-OG, фирма Fluka) в ФСБ. Раствор липида/этанола вносят инъекцией в раствор β-OG/ФСБ и немедленно разводят в ФСБ. Полученные липосомы концентрируют ультра-диафильтрацией для достижения требуемой концентрации липида. Монофосфорильный липид А (МФЛА, фирма Avanti Polar Lipids, Inc. AL, США) добавляют одновременно с фосфолипидами. Разные вакцинные препараты ACI-24-125 (R/ACI/PALl-15/Pool/140607+180607), ACI-24-30 (Diluted/R/ACI/PALl-15/Pool/140607+180607) и ACI-Empty (R/ACI/Pall-15/110607/E) получают на фирме Polymun Scientific GmbH (Австрия) и отгружают на фирму Maccine Ltd. (Сингапур). Теоретические и полученные в ходе анализа количества Pall-15, МФЛА, холестерина и ДМФХ представлены в приложении (табл.2).

4.1.2 Иммунизация

18 обезьян, ранее не подвергавшихся манипуляциям, распределяют в одну из пяти разных групп, согласно представленным данным в табл.4. В группе 1 животным вводят ФСБ. В группе 2 вводят пустые липосомы, т.е. липосомы с МФЛА, но без Pall-15 (обозначаемые «ACI-24-пустые»). В четырех группах вводят вакцину ACI-24, содержащую разные дозы Pall-15, т.е. ACI-24-30, ACI-24-125, ACI-24-500 и ACI-24-1000. Обезьян иммунизируют подкожно (п.к.) 6 раз каждые 4 недели, т.е. на 0, 28, 56, 84, 112 и 140 сутки.

Табл.4 иллюстрирует распределение обезьян по группам.

Таблица 4
Распределение обезьян по разным группам
Группа Количество животных и их пол Лечениеа/ Объема Партия вакцины Уровень дозирования
Количество Pall-15
мкг/дозув
Количество МФЛА
мкг/дозув
1 2 самца, 1 самка ФСБ/0,8 мл - 0 0
2 1 самец, 2 самки ACI-24-пустые/ 0,8 мл R/ACI/Pall-15/110607/Е 0 82
3 3 самца ACI-24-30 /0,2 мл Разведенная /R/ACI/PAL1-15/Pool/140607+180607 28 9
4 2 самца, 1 самка ACI-24-125/0,2 мл R/ACI/PAL1-15/Pool/140607+180607 78 22
5 3 самок ACI-24-500/0,8 мл R/ACI/PAL1-15/Pool/140607+180607 311 89
6 1 самец, 2 самки ACI-24-1000/1,6 мл R/ACI/PAL1-15/Pool/140607+180607 621 176
а: теоретически рассчитанную дозу выражают в мкг и указывают в вакцине цифрами в конце обозначения ACI-24
б: теоретически рассчитанный объем
в: измеренное количество, определенное после анализа

4.1.3 Получение образцов крови

Еженедельно отбирают образцы крови (в общей сложности 8 мл), начиная с -1 до 24 недели, и отделяют сыворотку крови и белые кровяные клетки.

Образцы цельной крови, объемом примерно 4 мл, отобранные из бедренной вены в гладкие пробирки, сворачиваются при комнатной температуре в течение времени, составляющего до одного часа. Затем сыворотку разделяют центрифугированием при 4000 об/мин в течение 10 мин. Сыворотку разделяют на аликвоты объемом 1 мл и половину образцов хранят при -80°С в Maccine. Оставшиеся аликвоты отгружают в замороженном виде на фирму AC Immune на 6, 10, 14, 18, 20 и 24 неделю после начала лечения.

Образцы цельной крови, объемом примерно 4 мл, отобранные из бедренной вены в пробирки с EDTA (2×2 мл). Сразу после отбора образцов крови контролируют лизис клеток крови с помощью камеры гематоцитометрии Neubauer и экструзии трипана синего. Установлено, что не более 20% лизированных клеток крови содержится при немедленно проведенной оценке в собранных образцах крови с августа 2007 до конца периода исследования. Проводят анализ содержимого пробирок после отбора крови. Одну пробирку с 2 мл цельной крови разделяют на 2×1 мл аликвоты и замораживают при -80°С до отправки на фирму AC Immune. Белые клетки крови выделяют из дополнительных 2 мл, используя метод градиента Histopaque. Два мл крови наслаивают на 2 мл Histopaque-1077 (фирма Sigma) в центрифужные пробирки объемом 15 мл. Затем градиент центрифугируют в течение 30 мин в режиме 400 g с остановкой без тормоза. Белые клетки крови, обнаруживаемые на разделе сред Histopaque/плазма, собирают, промывают изотоническим фосфатным буферным солевым раствором и центрифугируют в режиме 400 g в течение 5 мин. После двух промывок осажденные центрифугированием клетки ресуспендируют в 2 мл холодной среды для заморозки (70% RPMI; 20% ФСБ; 10% ДМСО). Затем клетки помещают в предварительно охлажденный контейнер для заморозки клеток Nalgene и хранят при -80°С в течение примерно 24 ч, после чего обе емкости помещают в жидкий азот до отправки на фирму АС Immune в сухом льду для анализа.

4.1.4 Подсчет Аβ -специфических антител

Аβ1-42-специфические IgM антитела определяют методом ELISA. На планшеты наносят 10 мкг/мл Aβ1-42 (фирма Bachem, Бубендорф, Швейцария) или 10 мкг/мл Аβ человека Аβ1-15 (фирма NeoMPS, Франция) в течение ночи при 4°С. После промывки с помощью ФСБ-0,05% Tween 20 и блокирования с помощью 1% БСА в планшеты добавляют серийные разведения сыворотки и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют с пероксидазой хрена (horse radish peroxidase - HRP), конъюгированной с антителами против IgG или IgM обезьян (фирма KPL Inc, Gaithersburg, Мэрилэнд, США) в течение 2 ч при 37°С. После заключительной промывки планшеты инкубируют с субстратом HRP (ABTS) и прочитывают при 405 нм, используя ридер для планшетов ELISA.

4.1.5 Подсчет МФЛА-специфических антител

МФЛА-специфические IgG антитела определяют методом ELISA. Планшеты покрывают 10 мкг/мл МФЛА (фирма Avanti Polar Lipids, Inc. AL, США) в течение ночи при 4°С. После промывки с помощью ФСБ-0,05% Tween 20 и блокирования 1% БСА в планшет добавляют серийные разведения сыворотки и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют с пероксидазой хрена (horse radish peroxidase - HRP), конъюгированной с антителом против IgG обезьян (фирма KPL Inc. Gaithersburg, Мэриленд, США) в течение 2 ч при 37°С. После заключительной промывки планшеты инкубируют с субстратом HRP (ABTS) и прочитывают при 405 нм, используя ридер для планшетов ELISA.

4.1.6 Определение респондеров на вакцину

Сыворотку обезьяны, которая показывает ОП в два раза выше величины ОП, полученной у той же обезьяны перед первой иммунизацией, рассматривают в качестве респондера на вакцину.

4.2 Результаты

Оценка ответа в виде выработки антитела, индуцированного ACI-24, у макаки крабоеда

Введенная подкожной инъекцией вакцина ACI-24 индуцирует сильный Аβ-специфический IgG у 9 обезьян (фиг.14). Реагирующих обезьян вакцинируют ACI-24-30 (1 обезьяна, №2066), ACI-24-125 (2 обезьяны, №№6178 и 033 В), ACI-24-500 (все 3 обезьяны, 7815, 4С73, 194А) или ACI-24-1000 (все 3 обезьяны, №№740В, 5951 и 4 В2Е). У обезьян, вакцинированных ФСБ или пустыми липосомами, не отмечают каких-либо выявляемых анти-Аβ IgG антител, согласно ожидаемому (фиг.14).

ACI-24 индуцирует титры анти-Аβ IgM у 3 обезьян после вакцинации ACI-24-30 (1 обезьяна, №2066), ACI-24-125 (1 обезьяна, №033 В) или ACI-24-500 (1 обезьяна, №7815; фиг.15).

ACI-24 также индуцирует анти-МФЛА IgG ответ у 2 обезьян после вакцинации ACI-24-30 (1 обезьяна, №2066) или ACI-24-500 (1 обезьяна, №7815) (фиг.16).

Анализ анти-Аβ IgG антител в сыворотке макак крабоедов в разные сутки после первой иммунизации. Обезьян иммунизируют подкожно ФСБ, пустыми липосомами или ACI-24 в разных дозах на 1, 28, 56, 84, 112 и 140 сутки. Результаты выражают в виде кратного увеличения относительно контроля (ОП каждого дня, поделенная на ОП, полученную перед иммунизацией). Каждая графа представляет группу одной дозы. Числа означают номера животных.

Анализ анти-МФЛА IgM антител в сыворотке макак крабоедов в разные сутки после первой иммунизации. Обезьян иммунизируют ФСБ, пустыми липосомами или ACI-24 в разных дозах подкожно на 1, 28, 56, 84, 112 и 140 сутки. Результаты выражают в виде кратного увеличения относительно контроля (ОП каждого дня, поделенная на ОП, полученную перед иммунизацией). Числа означают номера животных.

Анализ анти-МФЛА IgG антител в сыворотке макак крабоедов в разные сутки после первой иммунизации. Обезьян иммунизируют ФСБ, пустыми липосомами или ACI-24 в разных дозах подкожно на 1, 28, 56, 84, 112 и 140 сутки. Результаты выражают в виде кратного увеличения относительно контроля (ОП каждого дня, поделенная на ОП, полученную перед иммунизацией). Числа означают номера животных.

Таким образом, ACI-24 индуцирует анти-Аβ IgG ответ у макак крабоедов. Вакцина ACI-24-125, содержащая 78 мкг Pal 1-15, представляет наименьшую дозу, индуцирующую анти-Аβ IgG ответ. Таким образом, ACI-24 способен индуцировать ответ у обезьян, подтверждая, что ACI-24 также может преодолевать иммунную устойчивость у людей с БА.

Пример 5. Оценка ответа в виде антител, индуцированного ACI-24 у голых мышей и мышей, недостаточных по CD40L, CD 14 или TLR4

Задача настоящего изобретения заключается в оценке ответа в виде амилоид-бета (Аβ)-специфического антитела, индуцированного вакциной ACI-24 у голых мышей и у мышей, недостаточных по CD40L, CD 14 и TLR4.

Голые мыши несут мутацию the Foxnlnu, обладающую сниженной функцией Т-клеток из-за утраты должным образом функционирующей тимусной железы. Поэтому одна из задач настоящего изобретения заключается в анализе того, возможен ли ответ антитела, индуцированный вакциной ACI-24, независимый от Т-клеток.

Мыши с нокаутом CD40L проявляют недостаточность ответов в виде выработки первичных и вторичных антител к Т-зависимым антигенам, но нормально отвечают на антигена, независящие от Т-антигенов (Renshaw, J Ехр Med, 180, 1994, с.1889; Borrow, J.Exp.Med., 183, 1996, с.2129; Xu, Immunity, 1, 1994, с.423). Экспрессия CD40L на CD4 Т-клетках также принципиально важна для переключения изотипа В-клетками. Мышей с недостаточностью по CD40L исследуют для определения, действительно ли существует потребность в CD40L/CD40 в ответе в виде антитела, индуцированного ACI-24.

CD 14 и TLR4 являются молекулами, участвующими в ответе на липополисахарид (ЛПС). TLR4 вместе с CD 14 и белком-2 дифференциации миелоида формирует рецептор распознавания конфигурации, инициирующий врожденный иммунный ответ на ЛПС. Монофосфорильный липид А (МФЛА) является низкотоксичным производным ЛПС и применяется в качестве адъюванта в вакцине ACI-24. Потребность CD 14 и TLR4 в распознавании МФЛА для ответа в виде антитела, индуцированного ACI-24, определяют в мышах, недостаточных или по CD 14, или по TLR4.

Всем мышам подкожно (п.к.) вводят инъекцией ACI-24. Мышей иммунизируют трижды с интервалами в 2 недели и берут кровь с разными временными интервалами. Суммарные анти-Аβ IgG ответы измеряют методом ELISA.

5.1 Методы

5.1.1 Мыши

Мышей, недостаточных по TLR4 (TLR4 нокаут), CD14 (CD14 нокаут) или CD40L (CD40L нокаут), и голых мышей (все происходят от линии мышей С57В1/6) получают от фирмы Jackson Laboratories (Bar Harbor, Мэн, США).

5.1.1.1 TLR4 нокаут - B6.B10ScN-Tlr41ps-del/JthJ (инвентарный номер фирмы Jackson: 007227)

Эта спонтанная мутация представляет делецию размером 7 т.о. в гене Tlr4, которая выражается в отсутствии и иРНК, и белка, и таким образом проявляет дефектный ответ на стимуляцию ЛПС. Функционально близкая мутация Tlr4Lps-d, обнаруженная у мышей С3Н/HeJ, является точечной мутацией, которая вызывает аминокислотное замещение. Аллель нормального ответа ЛПС, Tlr41ps-n, имеется у большинства других С3Н и C57BL/10 подлиний и большинства линий мышей. Такая линия может применяться для исследования сигнального метаболического пути Toll и чувствительности к грамотрицательной бактериальной инфекции.

5.1.1.2 CD14 нокаут - B6.129S-Cdl4tmlFrm/J (инвентарный номер фирмы Jackson: 003726)

Мыши, гомозиготные и нулевые по CD14, являются жизнеспособными и фертильными. Белковый продукт CD14 не выявляют у выделенных тиогликолятом брюшных (Т-ЕР) макрофагов методом вестерн-блоттинга. В отличие от макрофагов дикого типа Т-ЕР, макрофаги Т-ЕР, полученные от таких животных, не могут секретировать TNF-альфа и IL-6 в ответ на липополисахарид (ЛПС). Такой ответ наблюдают, когда CDH-нулевые Т-ЕР макрофаги подвергаются действию целых бактерий (в форме биочастиц Е.coli), очевидно по CD14-независимому механизму.

5.1.1.3 Голые мыши - B6.Cg-Foxnlnu/J (инвентарный номер фирмы Jackson: 000819)

Два основных дефекта гомозиготы мышей со спонтанной мутацией голой кожи (Foxninu, раньше мутация обозначалась «Hfhilnu») заключаются в нарушенном росте шерсти и нарушенном развитии эпителия тимуса. Хотя у мышей нет шерсти, они рождаются с функциональными, но не без роста шерсти фолликулами. Циклы роста шерсти и особенности очевидны, особенно у пигментированных мышей, но нарушенные фолликулы не позволяют шерсти должным образом выступать из фолликул. Гомозиготные щенки могут быть выявлены уже в возрасте 24 ч по отсутствию вибрисс или по слабому развитию и изогнутости вибрисс. Голые мыши также являются бестимусными, из-за того, что нарушено развитие «зачатка тимуса». В результате гомозиготные голые мыши утрачивают Т-клетки и испытывают отсутствие опосредованного клетками иммунитета. Однако нет дефекта у предшественников Т-клеток, и при должном содержании некоторое количество зрелых Т-клеток может быть обнаружено, особенно у взрослых мышей. Из-за дефекта хэлперной Т-клеточной активности ответы на тимус-зависимые антигены при выявлении в основном ограничиваются IgM. Гомозиготные голые мыши проявляют частичный дефект в развитии В-клеток, возможно из-за отсутствия функциональных Т-клеток.

5.1.1.4 CD40L нокаутные мыши - B6.129S2-Cd401gtmlImx/J (номер в каталоге фирмы Jackson Stock: 002770)

Гомозиготные мыши по целевой мутации являются жизнеспособными и фертильными. Гомозиготные мутантные мыши не имеют видимых фенотипических нарушений. Процент субпопуляций В- и Т-клеток в норме. Гомозиготы действительно проявляют избирательную недостаточность по гуморальному иммунитету (низкие базальные уровни изотипов в сыворотке и невыявляемый IgE), а также нарушенные вторичные антиген-специфичные ответы при иммунизации тимус-зависимым антигеном. Фенотип мышей напоминает Х-связанный гипе-IgM синдром человека.

5.1.2 Получение вакцины ACI-24

Липосомы получают по описанию, описанному в примере 1.1

Препарат вакцины ACI-24 (партия: ACI24-0709-A) получают на фирме Polymun Scientific GmbH (Австрия) и отправляют в Университет города Цуриха (Швейцария)

5.1.3 Иммунизация

Мышам C57BL/6, голым мышам, мышам CD40L нокаутным, мышам CD14 нокаутным и мышам TLR4 нокаутным (6 мышей/группу) вводят подкожно ACI-24 за три приема с 2-недельным интервалом между введениями (0, 14, 28 сутки) в соответствии с табл.5. Одна группа мышей C57BL/6, которым вводят ФСБ, служит отрицательным контролем. В другой контрольной группе вводят пептид Аβ 1-15. Образцы плазмы собирают на 0, 7, 14, 28 и 56 сутки после первой инъекции. Титры Аβl-42-специфического IgG антитела определяют методом ELISA.

5.1.4 Количественная оценка Аβ-специфических антител

Аβ1-42-специфические IgG антитела определяют методом ELISA. Планшеты покрывают 10 мкг/мл Аβ1-42 (фирма Bachem, Бубендорф, Швейцария) в течение ночи при 4°С. После промывки с помощью 0,05% Tween 20 в ФСБ и блокирования 1% БСА, серийные разведения сыворотки добавляют в планшеты и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют со щелочной фосфатазой (ЩФ), конъюгированной с антителом против IgG мыши (фирма Jackson Immunoresearch West Grove, Пенсильвания, США). После последней промывки планшеты инкубируют с субстратом щелочной фосфатазы (pNPP) или с субстратом HRP (ABTS) и считывают при 405 нм, используя ридер для планшетов ELISA. Результаты выражают относительно серийных разведении коммерчески доступного антитела (6Е10, фирма Covance, Emeryville, Калифорния, США).

Таблица 5
Распределение мышей по разным группам
Группа Штаммы мышей Количество животных и их пол Лечение/ Объема Партия
вакцины
Способ
введенияб
Уровень дозирования
Количество Pall-15
мкг/дозуа
Количество МФЛА
мкг/дозув
1 C57BL/6 дикий тип 6 самок мышей ACI-24 0,2 мл ACI-24-0709-А П.к. 77,6 11,6
2 CD40L нокаут 6 самок мышей ACI-24 0,2 мл ACI-24-0709-А П.к. 77,6 11,6
Голые 6 самок мышей ACI-24 0 2 мл ACI-24-0709-А П.к. 77,6 11,6
CD14 нокаут 6 самок мышей ACI-24 0,2 мл ACI-24-0709-А П.к. 77.6 11,6
5 TLR4 нокаут 6 самок мышей ACI-24 0,2 мл ACI-24-0709-А П.к. 77,6 11,6
5 C57BL/6 дикий тип 6 самок мышей Аβ1-15 0,2 мл Lot 1010533 П.к. 80 -
5 C57BL/6 дикий тип 6 самок мышей ФСБ - П.к. - -
а: теоретически рассчитанный объем
б: П.к.: подкожное
в: измеренное количество, определенное после анализа

5.2 Результаты

5.2.1 Анализ ответа в виде выработки антитела

Титры анти-Аβ IgG мышей Wt, голых и CD14, CD40L или TLR4 нокаутных мышей исследуют для того, чтобы определить, действительно ли ответ, индуцированный ACI-24, зависит от Т-клеток и/или от CD14, CD40L или TLR4.

У мышей Wt вакцина ACI-24 индуцирует сильные анти-Аβ IgG ответы по сравнению с ФСБ (фиг.17; двухфакторный анализ ANOVA Р<0,05 на 7, 28 и 56 сутки).

У CD40L нокаутных мышей вакцина ACI-24 индуцирует сильные анти-Аβ IgG ответы по сравнению с ФСБ (фиг.17; двухфакторный анализ ANOVA P<0,05 на 7, 28 и 56 сутки), и титры не являются существенно более низкими по сравнению с титрами анти-Аβ IgG, индуцированными у мышей Wt (Р<0,05 для всех временных точек).

После первой иммунизации (на 7 и 14 сутки) титры у голых мышей близки титрам мышей Wt. В другие дни взятия крови титры голых мышей существенно выше, чем титры мышей Wt (двухфакторный анализ ANOVA Р<0,001 на 28 и 56 сутки). Пептид Аβ1-15 не индуцирует каких-либо анти-Аβ IgG титров, что соответствует прогнозу.

Титры у CD14 нокаутных мышей также близки титрам, наблюдаемым у мышей Wt во все дни проведения анализов (фиг.18, Р>0,05).

Напротив, титры анти-Аβ IgG индуцируются после 1 или 2 иммунизации вакциной ACI-24 у TLR4 нокаутных мышей, и эти титры существенно ниже, чем титры, наблюдаемые у мышей Wt на 7, 14 и 28 сутки (двухфакторный анализ ANOVA Р<0,001 на 7, 14 и 28 сутки).

Рассматриваемые вместе, эти результаты показывают, что ACI-24 индуцирует сильный ответ в виде антитела, который независим от Т-клеток, CD40L и CD 14, но зависит от TLR4.

5.3 Заключение

Вакцина ACI-24 индуцирует сильный анти-Аβ IgG ответ у мышей Wt и у голых мышей, показывая, что ответ антитела не зависит от Т-клеток в связи с вакцинацией ACI-24. Ответ в виде выработки антитела также не зависит от CD40L, что дополнительно поддерживает независимость Т-клеток. Ответ в виде выработки антитела у мышей с CD14 нокаутом также близок мышам Wt, показывая, что CD14 не требуется в качестве рецептора для МФЛА, адъюванта ACI-24, для индукции ответа в виде выработки антитела. В итоге, потребность в TLR4 для индуцированного ACI-24 ответа в виде выработки антитела ясно продемонстрирована полным отсутствием ответа в виде выработки антитела у мышей с TLR4 нокаутом.

Пример 6. Ответ в виде выработки анти-pTau антитела у самок голых мышей

Задача настоящего исследования заключается в оценке ответа в виде выработки анти-pTau антитела, индуцированного инъекцией вакцины ACI-33 (Tau5-20 [pY18]) у самок голых мышей. Голые мыши несут мутацию Foxnlnu, обладают сниженной функцией Т-клеток из-за утраты должным образом функционирующей тимусной железы. Таким образом, целью настоящего исследования является выяснение, является ли ответ в виде выработки антитела, индуцированный ACI-33, независимым от Т-клеток.

Голым мышам, произошедшим от линии мышей C57BL/6 и соответствующим однопометным животным дикого типа в возрасте 11 или 13 недель, вводят подкожную инъекцию. Мышей иммунизируют 3 раза с интервалами в 2 недели и после каждой иммунизации через неделю берут кровь. Общие ответы в виде анти-pTau (Tau5-20 [pY18]) пептида IgG измеряют методом ELISA. Кроме того, модель изотипа ответа в виде выработки антитела исследуют после трех иммунизации для оценки распределения разных подклассов IgG, а также IgM. Также исследуют титры антител против соответствующих non-pTau (Tau5-20), полной длины (441аа) тау-белка и фосфорилированного полной длины (441 аминокислота) Т тау-белка.

Для подтверждения отсутствия Т-хелперных клеток у голых мышей оценивают процент CD3+/CD4+ клеток с помощью сортировщика флуоресцентно-активированных клеток (fluorescence-activated cell sorter -FACS).

6.1 Методы

6.1.1 Получение вакцины ACI-33

Липиды димиристоилфосфатидилхолин (ДМФХ), димиристоилфосфатидилглицерин (ДМФГ) и холестерин, а также адъювантный монофосфорильный липид А (МФЛА) (все от фирмы Avanti Polar Lipids Inc. AL, США) и тау-производный тетрапальмитилированный фосфопептид Таи5-20 [pY18] (human Tau 5-20 человека с фосфогруппой по Y18; 5,2 мг) взвешивают в круглодонных стеклянных колбах объемом 250 мл (мольное соотношение 9:1:7:0,2:0,1, соответственно). Затем добавляют хлороформ (30 мл) и после аккуратного взбалтывания при комнатной температуре раствор упаривают под низким давлением при 40°С и затем под высоким вакуумом в течение 1 ч. Получаемую тонкую пленку заново гидратируют добавлением ФСБ (60 мл) и аккуратно взбалтывают при комнатной температуре в течение 18 ч. Суспензию липосом (партия ACI-33-090818-A) затем разливают по аликвотам, которые хранят при 2-8°С. Итоговое мольное соотношение пептида/ фосфолипида составляет 1:100. Вакцины отгружают на фирму JSW Life Sciences GmbH (Австрия).

6.1.2 Иммунизация

На фирме JSW Life Sciences GmbH голым мышам (B6.Cg-Foxnlnu/J), происходящим от мышей линии C57BL/6, и соответствующим однопометным мышам дикого типа (6 самок мышей/группу) вводят подкожно инъекции ACI-33 трижды с интервалами в 2 недели между введениями (на 0, 14, 28 сутки) согласно табл.6. Образцы плазмы из лицевой вены/артерии берут за 7 суток до и через 2, 4, 7, 21, 35 и 56 суток после первых инъекций. Титры Tau5-20 [pY18]-специфических IgG и IgM антител и варианты IgG изотипов определяют методом ELISA. Титры специфических IgG антител против non-pTau5-20, полной длины (441 аминокислота) тау-белка и фосфорилированного полной длины (441 аминокислота) тау-белка также определяют методом ELISA. Образцы крови также собирают на 7 сутки для анализа FACS для определения процента клеток CD3+/CD4+.

6.1.3 Подсчет антител, специфичных в отношении тау-пептида Специфические IgG антитела против Tau5-20 [pY18] измеряют методом ELISA в 5 образцах сыворотки крови (полученной на 2, 7, 21, 35 и 56 сутки). Tau5-20-, полной длины (441 аминокислота) тау-белок и фосфорилированный полной длины (441 аминокислота) тау-белок -специфический IgG определяют в сыворотке на 35 сутки. Tau5-20 [pY18]-специфические антитела изотипов IgM и IgG определяют методом ELISA в образце сыворотки крови, полученном на 35 сутки. Планшеты покрывают 10 мкг/мл соответствующего тау-пептида и 1 мкг/мл соответствующего тау-белка в течение ночи при 4°С. После промывки каждой лунки с помощью ФСБ-0,05% Tween 20 и блокирования 1% БСА в ФСБ-0,05% Tween 20 добавляют серийные разведения сыворотки в планшеты и инкубируют при 37°С в течение 2 ч. После промывки планшеты инкубируют с общим антителом против IgG мыши, конъюгированным с щелочной фосфатазой (фирма Jackson Laboratories, Baltimore, Пенсильвания, США), или с изотипическими специфическими антителами (антителами против IgM мыши, конъюгированными с пероксидазой хрена, антителами против IgGI мыши, конъюгированными с биотином, от фирмы Pharmingen BD Сан-Диего, Калифорния, США; антителами против IgG2a мыши, конъюгированными с биотином, от фирмы Invitrogen Калифорния, США, и антителами против IgG2b мыши, конъюгированными с пероксидазой хрена, от фирмы Zymed Laboratories, Сан-Франциско, Калифорния) в течение 2 ч при 37°С. После промывки планшеты инкубируют с pNPP (para-nitro-phenyl-phosphate - пара-нитро-фенил-фосфатом), фосфатным субстратом для ЩФ или 2,2'-азино-бис(3-этилбензтиазолин-6-сульфоновой кислотой (ABTS - 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)), субстратом для HRP и считывают результаты при 405 нм, используя ридер для планшетов ELISA. Проводят дополнительную стадию для антител, конъюгированных с биотином, при этом планшеты инкубируют в течение 45 мин в стрептавидин-HRP (фирма R&D Systems, Миннеаполис, Миннесота, США) до измерения, используя ABTS. Результаты выражают в виде ОП (оптической плотности) относительно ненасыщенной ОП для IgG, изотипов IgG и IgM.

6.1.4 Подсчет клеток CD3+/CD4+

Образцы крови мышей лизируют хлоридом аммония до просветления, затем центрифугируют при 400 g в течение 7 мин и пеллеты ресуспендируют в ФСБ, содержащем EDTA. Затем клетки блокируют с помощью блокирующего реагента CD16/CD32 и окрашивают CD4 (конъюгат с РЕ) и CD3 (РЕ-Су5) антителами в течение 30 мин при 4°С. Образцы промывают с помощью ФСБ, ресуспендируют в фиксирующем растворе (DB Cellfix, разведенном 1:40 в проточной жидкости BD FACS Flow) и получают результат на цитометре BD FACS Calibur. Оценивают процент прошедших клеток, которые окрашиваются положительно по CD3+ и CD4+ (Т-хэлперные клетки).

Таблица 6
Иммунизация мышей
Группа Количество животных и их пол Лечение/ объема Партия
вакцины
Процесс Способ
введенияб
Уровень дозирования
Количество Т1
(мкг/дозув)
Количество МФЛА
(мкг/дозув)
1 6 самок голых мышей ACI-33 0,2 мл ACI-33-090818-А ACI-A П.к. 12,6 15,8
2 6 самок мышей Wt ACI-33 0,2 мл ACI-33-090818-А ACI-A П.к. 12,6 15,8
а: теоретически рассчитанный объем
б: П.к.: подкожная инъекция
в: измеренное количество, определенное после анализа

6.2 Результаты

6.2.1 Общие наблюдения

Ни одно из животных не умерло преждевременно и в ходе лечения не выявлено побочных эффектов. У всех животных B6.Cg-Foxnlnu/J имеется фенотип голых мышей, хотя у однопометные животных дикого типа (wild - Wt) мех нормальный.

Подсчет клеток CD3+/CD4+

Окрашивание клеток CD3+/CD4+ с последующим анализом методом FACS показывает существенное снижение числа Т-хелперных клеток (клеток CD3+/CD4+) у голых мышей по сравнению с животными Wt (фиг.19).

6.2.2 Подсчет CD3+/CD4+ клеток

CD3+/CD4+ окрашивание с последующим анализом FACS показывает существенное снижение числа Т-хэлперных клеток (CD3+/CD4+ клетки) у голых мышей по сравнению с животными wt (фиг.19).

6.2.3 Анализ иммунного ответа

Титры анти-Tau5-20 [pY18] IgG, полученного в результате вакцинации ACI-33, исследуют для определения иммуногенности вакцины у мышей wt и у голых мышей. Титры анти-Tau5-20 [pY18] IgG у голых мышей исследуют для выяснения, является ли ответ, индуцированный вакциной ACI-33, независимым от функции Т-клеток. Вакцина индуцирует анти-Tau5-20 [pY18] IgG ответ у голых мышей, и не было существенного различия между ответом в виде антитела, индуцированного ACI-33, у мышей wt или у голых мышей во все исследуемые временные точки (фиг.20; однофакторный анализ ANOVA Р<0,05 для всех взятых образцов крови у голых мышей и мышей wt).

Вакцина ACI-33 индуцирует у мышей обоих типов анти-Tau5-20 [pY18] IgG ответ после подкожной инъекции, который достигает максимума после 2 иммунизации (27 сутки) (фиг.20).

Вакцина ACI-33 индуцирует титры антител того же профиля для другого подкласса IgG и IgM между голыми мышами и мышами wt, поскольку нет существенных различий между двумя типами мышей после 3 подкожных иммунизации вакциной (фиг.21, однофакторный анализ ANOVA P>0,05 IgGI у голых мышей относительно IgGI у мышей дикого типа (wt), IgG2a/2b у голых мышей относительно IgG2a/2b у мышей wt, IgG3 у голых мышей относительно IgG3 у мышей wt, IgM у голых мышей относительно IgM у мышей wt). У мышей обоих типов наблюдают существенно более низкий уровень IgGI по сравнению с IgG2b и IgM (фиг.21, однофакторный анализ ANOVA, голые мыши: Р<0,01 IgGI относительно IgG2b или IgM; мыши Wt: Р<0,05 IgGI относительно IgG2b или IgM). Кроме того, у голых мышей наблюдают существенно более низкий уровень IgGI по сравнению с IgG3 (фиг.21, однофакторный анализ ANOVA, у голых мышей: Р<0,05 IgGI относительно IgG3) и уровень IgG2a также ниже по сравнению с IgG2b, IgG3 и IgM (фиг.21, однофакторный анализ ANOVA, у голых мышей: Р<0,05 IgG2a относительно IgG2b, IgG3 или IgM).

Титры IgG, индуцированные после 3 подкожных инъекций ACI-33, также исследуют на разные тау-пептиды (анти-Tau5-20 [pY18] и анти-Tau5-20) и белки (анти-фосфорилированный полной длины (441 аминокислота) тау-белок = анти-pTau белку и анти-полной длины (441 аминокислота) тау-белок = анти-Tau белку (фиг.22). Нет отличий в титрах разных пептидов и белков между мышами wt и голыми мышами. В группе голых мышей имеется существенное различие, и у анти-Tau5-20 [pY18] титры выше, чем анти-Tau5-20 титры (фиг.22, однофакторный анализ ANOVA, Р<0,05 анти-Tau5-20 [pY18] титры относительно анти-Tau5-20 титров).

6.3 Заключение

Несмотря на малое процентное содержание CD3+и CD4+ клеток у голых мышей, вакцина ACI-33 индуцирует сильный анти-Tau5-20 [pY18] IgG ответ. Персистенция ответа в виде антитела и распределение изотипа IgG близки у диких мышей (wt) и у голых мышей, подтверждая, что эти параметры не зависят от Т-клеток в связи с вакцинацией ACI-33. При сравнении с иммунокомпетентными мышами иммунизация ACI-33 индуцирует идентичный титр антител и кинетику со сходным профилем IgG у мышей с недостаточностью Т-клеток. Кроме того, титры антител в отношении разных тау-пептидов и белков сходны у иммунокомпетентных мышей и мышей с недостаточностью Т-клеток. Эти данные показывают, что ACI-33 индуцирует независящий от Т-клеток ответ в виде антител и у голых мышей, и у мышей wt.

1. Применение антигенной композиции, включающей антигеннный пептид, происходящий из амилоидного белка или амилоидоподобного белка, причем указанный антигенный пептид модифицирован липофильной или гидрофобной частью молекулы, которая облегчает инсерцию в липидный двойной слой липосомного носителя/адъюванта, и презентирован в виде часто повторяющейся матрицы на поверхности липосомы, для лечения заболевания, состояния или расстройства, которое вызвано или связано с амилодными или амилоидоподобными белками, в популяции пациентов, страдающих от недостаточности Т-клеток при индукции иммунного ответа.

2. Применение по п. 1 для лечения животных или человека.

3. Применение по п. 1, причем указанная композиция эффективна в качестве стимулятора иммунитета.

4. Применение по п. 1, причем иммунная система указанного пациента ослаблена из-за возраста, заболевания, например, ВИЧ или рака, или из-за лечения, например лечения воспалительных заболеваний, включая, но ими не ограничиваясь, ревматоидный артрит, псориаз, системную красную волчанку, гранулематоз Вегенера и др.

5. Применение по п. 1, где указанный пациент страдает от аутоиммунного заболевания.

6. Применение по п. 1, где указанная недостаточность Т-клеток обусловлена возрастом, иммуносупрессией или болезнью.

7. Применение по любому из пп. 1-6, причем у указанных пациентов истощены CD4 Т-клетки.

8. Применение по п. 7, причем указанные пациенты проявляют пониженную экспрессию CD14 и/или CD40L на CD4 Т-клетках.

9. Применение по п. 1, в котором антиген не содержит эпитопов Т-клеток.

10. Применение по п. 1, причем антиген является конформационным антигеном, который целиком или частично имеет конформацию бета-слоя.

11. Применение по п. 1, в котором размер липофильной или гидрофобной части молекулы в комбинации с общим результирующим зарядом антигенного пептида и носителя/адъюванта, к которому пептид присоединяется, в который инкорпорируется или в котором восстанавливается таким образом, что антигенный пептид становится свободным, стабилизированным и презентированным в конформации с высокой биологической активностью, что позволяет иммунной системе целевого организма свободно взаимодействовать с антигенными детерминантами, содержащимися в антигенной конструкции, в своей свободной, стабилизированной конформации с высокой биологической активностью, что приводит к сильному иммунному ответу.

12. Применение по п. 1, в котором липофильная или гидрофобная часть молекулы представлена жирной кислотой, триглицеридами, диглицеридом, стероидом, сфинголипидом, гликолипидом или фосфолипидом.

13. Применение по п. 12, в котором липофильная или гидрофобная часть молекулы представлена жирной кислотой, особенно жирной кислотой с углеродным каркасом, состоящим по меньшей мере из 10 атомов углерода.

14. Применение по п. 13, в котором гидрофобная часть молекулы представлена пальмитиновой кислотой.

15. Применение по п. 14, в котором пептидный антиген включает две части пальмитиновой кислоты.

16. Применение по п. 14, в котором пептидный антиген включает четыре части, представленные пальмитиновой кислотой.

17. Применение по одному из пп. 1-6 и 9-16, в котором липосома включает адъювант.

18. Применение по п. 17, где адъювант выбран из группы, состоящей из липида А, детоксифицированного липида А, монофосфорильного липида А или дифосфорильного липида А и алюминий гидроксида.

19. Применение по пп. 1-6 и 9-16, в котором указанный антигенный пептид, производный от амилоидного белка или амилоидоподобного белка, является пептидом Аβ, прионным белком, тау-белком, альфа-синуклеином, гентингтином.

20. Применение по п. 19, в котором антигенный пептид является производным от N-конца пептида Аβ.

21. Применение по п. 19, в котором N-конец пептида Аβ включает:
а) Аβ 1-30,
б) Аβ 1-20 или
в) Аβ 1-16.

22. Применение по п. 20, в котором указанный фрагмент Аβ пептида включает:
а) от 4 до 20 аминокислот,
б) от 5 до 16 аминокислот,
в) от 6 до 12 аминокислот или
г) от 4 до 8 аминокислот.

23. Применение по п. 20, в котором указанным фрагментом пептида Аβ является:
а) Аβ1-15,
б) Аβ1-16 или
в) Аβ1-5.

24. Применение по любому из пп. 1-6 и 9-16, в котором антигенный пептид, производное тау-белка, является фосфопептидом, имитирующим крупный патологический фосфо-эпитоп тау-белка.

25. Применение по п. 24, в котором указанный тау-белок является белком человека.

26. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность, идентичную последовательности SEQ ID NO: 2 по меньшей мере на 95%, и обладает, по существу, той же иммуногенной активностью, что и указанный антигенный пептид с последовательностью SEQ ID NO: 2, в котором аминокислотный остаток, соответствующий аминокислотному остатку 18 (P-Tyr18) в последовательности SEQ ID NO: 2, фосфорилирован.

27. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность, идентичную последовательности SEQ ID NO: 3 по меньшей мере на 95%, и обладает, по существу, той же иммуногенной активностью, что и указанный антигенный пептид с последовательностью SEQ ID NO: 3, в котором по меньшей мере один, особенно по меньшей мере два аминокислотных остатка, соответствующих аминокислотным остаткам 212 (Р-Thr212) и 214 (P-Ser214) в последовательности SEQ ID NO: 3, фосфорилированы.

28. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность, идентичную последовательности SEQ ID NO: 4 по меньшей мере на 95%, и обладает, по существу, той же иммуногенной активностью, что и указанный антигенный пептид с последовательностью SEQ ID NO: 4, в котором по меньшей мере один, особенно по меньшей мере два аминокислотных остатка, соответствующих аминокислотным остаткам 202 (P-Ser202) и 205 (P-Thr205) в последовательности SEQ ID NO: 4, фосфорилированы.

29. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность, идентичную последовательности SEQ ID NO: 5 по меньшей мере на 95%, и обладает, по существу, той же иммуногенной активностью, что и указанный антигенный пептид с последовательностью SEQ ID NO: 5, в котором по меньшей мере один, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 396 (P-Ser396) и 404 (P-Ser404) в последовательности SEQ ID NO: 5, фосфорилированы.

30. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность, идентичную последовательности SEQ ID NO: 6 по меньшей мере на 95%, и обладает, по существу, той же иммуногенной активностью, что и указанный антигенный пептид с последовательностью SEQ ID NO: 6, в котором по меньшей мере один, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 404 (P-Ser404) и 409 (P-Ser409) в последовательности SEQ ID NO: 6, фосфорилированы.

31. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность, идентичную последовательности SEQ ID NO: 7 по меньшей мере на 95%, и обладает по существу той же иммуногенной активностью, что и указанный антигенный пептид с последовательностью SEQ ID NO: 7, в котором по меньшей мере один, особенно по меньшей мере два, особенно по меньшей мере три, но особенно все аминокислотные остатки, соответствующие аминокислотным остаткам 202 (Р-Ser202), 205 (P-Thr205), 212 (P-Thr212) и 214 (P-Ser214) последовательности SEQ ID NO: 7, фосфорилированы.

32. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность SEQ ID NO: 2.

33. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность SEQ ID NO: 3.

34. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность SEQ ID NO: 4.

35. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность SEQ ID NO: 5.

36. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность SEQ ID NO: 6.

37. Применение по п. 25, в котором указанный антигенный пептид, производное тау-белка, имеет аминокислотную последовательность SEQ ID NO: 7.

38. Применение по одному из пп. 20-24, причем указанный пациент имеет заболевание или расстройство, вызванное или ассоциированное с амилоидом или амилоидоподобными белками.

39. Применение по одному из пп. 25-37, причем указанный пациент имеет заболевание или расстройство, вызванное или ассоциированное с тау-белком или тау-подобными белками.

40. Применение по п. 38, причем ассоциированное с амилоидом заболевание или расстройство отличается утратой когнитивного объема памяти у индивидуума, в частности у животного или человека.

41. Применение по п. 40, причем указанное заболевание или расстройство составляет группу амилоидоза.

42. Применение по п. 41, причем указанное заболевание является неврологическим расстройством.

43. Применение по п. 42, причем указанное заболевание является заболеванием или расстройством, выбранным из группы, включающей болезнь Альцгеймера (БА), умеренное когнитивное нарушение (УКН), деменцию с тельцами Леви, синдром Дауна, наследственную церебральную геморрагию с амилоидозом исландского типа; комплекс паркинсонизма-деменции с острова Гуам; прогрессирующий супрануклеарный паралич, рассеянный склероз; болезнь Крейцфельдта-Якоба, болезнь Паркинсона, слабоумие, связанное с ВИЧ, амиотрофический боковой склероз (АБС), сахарный диабет взрослых; старческий амилоидоз сердца; эндокринные опухоли, инсульт, травматические повреждения мозга, дегенерацию желтого пятна и глаукому.

44. Применение по п. 43, причем указанным заболеванием является болезнь Альцгеймера.

45. Применение по п. 39, причем тау-ассоциированным заболеванием или расстройством является нейродегенеративное расстройство.

46. Применение по п. 45, причем указанное нейродегенеративное заболевание или расстройство вызвано или ассоциировано с формированием нейрофибриллярных патологических изменений.

47. Применение по п. 46, причем нейродегенеративным заболеванием или расстройством является таупатия.

48. Применение по п. 47, причем указанным нейродегенеративным заболеванием или расстройством является заболевание или расстройство, выбранное из группы, включающей болезнь Альцгеймера, болезнь Крейцфельдта-Якоба, деменцию боксеров, синдром Дауна, болезнь Герстманна-Штройслера-Шейнкера, миозит с включенными тельцами и церебральную амилоидную ангиопатию прионного белка, травматические повреждения мозга, амиотрофический боковой склероз/комплекс паркинсонизма-деменции с острова Гуам, заболевание двигательных нейронов с нейрофибриллярными сплетениями, не являющееся заболеванием с острова Гуам, аргирофильную зернистую деменцию, кортико-базальную дегенерацию, диффузные нейрофибриллярные узлы с кальцификацией, лобно-височное слабоумие с паркинсонизмом, связанное с хромосомой 17, болезнь Галлервордена-Шпатца, множественную системную атрофию, болезнь Ниманна - Пика, тип С, болезнь Пика, прогрессивный субкортикальный глиоз, прогрессирующий супрануклеарный паралич, подострый склерозирующий панэнцефалит, исключительно клубочковую деменцию, постэнцефалитический паркинсонизм, миотоническую дистрофию.

49. Применение по п. 48, причем указанным нейродегенеративным расстройством является болезнь Альцгеймера.

50. Применение по п. 2, причем у животного или человека не проявляется какой-либо побочный воспалительный эффект при лечении антигенной композицией, как определено в п. 1.

51. Способ лечения заболевания, состояния или расстройства, которое вызвано или связано с амилоидными или амилоидоподобными белками, посредством введения пациентам, страдающим от недостаточности Т-клеток антигенной композиции, как определено в любом из предшествующих пунктов в количестве, достаточном для индукции независимого от Т-клеток иммунного ответа.



 

Похожие патенты:

Изобретение относится к области биохимии, в частности к способам получения гликозилированного конъюгата молекулы с повторяющимся мотивом для связывания с антителом, включающим стадии: 1) получение клеток; 2) культивирование клеток; 3) выделение гликозилированного конъюгата молекулы с повторяющимся мотивом из клеток; 4) необязательную очистку выделенного гликозилированного конъюгата молекулы с повторяющимся мотивом.

Изобретение относится к биотехнологии, а именно к способу очистки G-CSF (гранулоцитарный колониестимулирующий фактор) в последовательности очистки, применяющей хроматографию.

Представленная группа изобретений относится к области биотехнологии и касается способов сбора функциональных клеток (варианты). Охарактеризованные решения заключаются в имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель, где популяция клеток мобилизована в емкость с помощью любого из белков HMGB1, HMGB2, HMGB3, S100A8, S100A9 или гиалуроновой кислоты или смеси любых двух или более из указанных.

Изобретение относится к новым молекулам-ингибиторам JNK, способам получения антител к указанным молекулам-ингибиторам JNK, а также к соответствующим антителам и клеткам, продуцирующим указанные антитела.

Изобретение относится к биохимии. Описаны способы определения наличия или метастазов опухоли, скрининга наличия опухоли среди популяции высокого риска, прогноза для пациента, имеющего опухоль, определения эффективности хирургического вмешательства, радиационной терапии или химиотерапии.

Изобретение относится к области биотехнологии, конкретно к получению вариантов плазминогена и плазмина, содержащих одну или несколько точковых мутаций в каталитическом домене, которые снижают или предотвращают аутокаталитическую потерю протеазной активности плазмина, и может быть использовано в медицине.

Изобретение относится к области иммунологии и медицины. Предложено пептидное производное для выработки в организме специфических антител, взаимодействующих с изоформой 2 фактора элонгации трансляции 1A (eEF1A2), но не взаимодействующих с изоформой 1 фактора элонгации трансляции 1A (eEF1A1), содержащее фрагмент аминокислотной последовательности eEF1A2 с 330 по 343 положения.

Настоящее изобретение относится к области биотехнологии. Предложено терапевтическое антитело и терапевтический фрагмент антитела для повышения продукции тромбоцитов, включающие пептид-миметик тромбопоэтина (ТРО), содержащий последовательность IEGPTLRQWLAARA и встроенный как дополнение к С-концу константной области легкой цепи и/или в положении менее 20 аминокислот ниже С-конца шарнирной области тяжелой цепи.

Настоящее изобретение относится к биотехнологии и представляет собой α1,6-глюкан-содержащее соединение Helicobacter pylori. Настоящее изобретение также раскрывает конъюгат для индукции иммунного ответа против H.pylori, содержащий указанное соединение, конъюгированное с белком-носителем.

Изобретение относится к области биотехнологии, конкретно к интернализации терапевтических молекул внутрь клетки, и может быть использовано в медицине. Получают композицию для доставки молекул нуклеиновых кислот в клетки, содержащую по меньшей мере один пептид с по меньшей мере 92% идентичностью к GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); или YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), присоединенный к одной или нескольким молекулам нуклеиновых кислот.

Группа изобретений относится к медицине и касается применения производного Аллоферона-1 Phe(p-NH2)-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly в качестве средства, обладающего высокой иммуномодулирующей и противовирусной активностью.
Изобретение относится к фармацевтической промышленности и представляет собой питательную композицию для стимулирования у человека по меньшей мере одного типа клетки врожденного иммунитета, содержащую источник жиров или липидов, источник белков и лактоферрин, присутствующий на уровне по меньшей мере 10 мг/100 ккал и произведенный отличным от человеческого организма источником, при этом лактоферрин характеризуется по меньшей мере 48% гомологией с аминокислотной последовательностью AVGEQELRKCNQWSGL в фрагменте (349-364) HLf, где введение питательной композиции стимулирует по меньшей мере один тип клетки врожденного иммунитета, выбранной из группы, состоящей из макрофагов, нейтрофилов, дендритных клеток и их комбинаций.

Группа изобретений относится к медицине и касается композиции для подкожного введения, содержащей ПЭГинтерферон альфа и вспомогательные вещества, в частности, динатрия эдетата дигидрат, натрия ацетата тригидрат, уксусную кислоту ледяную, осмотический агент.

Изобретение относится к новым соединениям формулы (I), которые обладают свойствами ингибитора HCV NS5B РНК-полимеразы. Соединения могут быть использованы для лечения или профилактики инфекции, вызванной вирусом гепатита С (HCV). В формуле (I) : X представляет собой СН или N, R1 выбран из группы, состоящей из R1a, R1c: где R1a возможно замещен C1-6алкилом, C1-6алкокси или гидрокси, и где R1c возможно замещен C1-6алкилом; R2 представляет собой (а) арил, выбранный из фенила, или (б) NRaRb, где указанный арил возможно замещен (CH2)nNRcRd; Ra и Rb вместе с атомом азота, к которому они присоединены, представляют собой 5-членный циклический амин, замещенный группой (CH2)nNRcRd, где n означает число от нуля до двух; Rc и Rd независимо представляют собой водород, O2SR4, где R4 представляет собой C16алкил; R3 представляет собой CR4aR4bR4c, где: 1) R4a, R4b и R4c независимо выбраны из С1-3алкила.

Группа изобретений относится к ветеринарии, а именно к способу иммунной активации для повышения вылупляемости оплодотворенного куриного яйца, зараженного Е. coli.

Изобретение относится к области медицины, а именно к педиатрии и неонатологии, и может быть использовано для лечения конъюгационных гипербилирубинемий у детей раннего возраста.

Группа изобретение относится к области ветеринарии и предназначена для повышения резистентности новорожденных телят и поросят. Заявленный способ получения препарата включает применение неспецифического иммуноглобулина, выделенного из сыворотки крови животных путем обработки полиэтиленгликолем с включением микроэлементов.

Настоящее изобретение относится к медицине, а именно к терапии и иммунологии, и касается лечения болезни Дего. Для этого вводят эффективное количество ингибитора комплемента в виде монотерапии или в составе общепринятой комплексной терапии.

Изобретение относится к медицине, а именно к лечению рецидивно-ремиттирующего рассеянного склероза. Для этого пациенту, нуждающемуся в таком лечении, вводят модулятор рецептора S1P перорально в суточной дозе 0.5 мг.
Изобретение относится к химико-фармацевтической промышленности, а именно к настойке из травы Echinacea, обладающей иммуномодулирующей, иммуностимулирующей, антимикробной, противовоспалительной, противовирусной, активностью и к способу ее получения.

Изобретение относится к медицине, а именно к терапии, и касается лечения инфекционных заболеваний и может быть использовано для эффективного лечения и профилактики различных инфекционных вирусных заболеваний.
Наверх