Антитело к противоопухолевому антигену и способы применения

Авторы патента:


Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения
Антитело к противоопухолевому антигену и способы применения

 


Владельцы патента RU 2598711:

ТЕ РИДЖЕНТС ОФ ТЕ ЮНИВЕРСИТИ ОФ КАЛИФОРНИЯ (US)

Изобретение относится к области биохимии, в частности к антителу, которое связывается с ассоциированным с опухолью антигеном EphA2. Изобретение может быть использовано для терапии, диагностики и скрининга раковых заболеваний. 4 н.п. ф-лы, 83 ил., 7 табл., 7 пр.

 

Перекрестная ссылка

Эта заявка заявляет приоритет предварительной заявки на патент США №61/366823, поданной 22 июля 2010, которая включена в настоящую заявку во всей полноте посредством ссылки.

Заявление о том, что исследование финансировалось из федерального бюджета

Это изобретение было сделано при правительственной поддержке по гранту № СА058207, присужденного Национальным институтом здоровья. Правительство имеет бесспорные права на изобретение.

Введение

Расширенные исследования транскрипционных паттернов рака привели к открытию молекулярных мишеней для различения злокачественного новообразования с самого начала и самых агрессивных раков от тех, которые являются менее агрессивными. Раки часто сверхэрепрессируют множество белков, включая определенные антигены клеточной поверхности, например, рецепторы клеточной поверхности. Антитела, которые связываются с такими сверхэкспрессируемыми антигенами клеточной поверхности, могут способствовать выявлению и лечению таких раков. Для производства антител к поверхностным рецепторам раковых клеток применяется множество подходов, которые можно использовать как потенциально терапевтические. Идентификация сверхэкспрессируемых рецепторов клеточной поверхности и антител, которые связываются с ними, представляет путь для разработки раковой терапии, особенно для подтипов рака с плохим прогнозом и устойчивостью к традиционной терапии. CD44 и EphA2 представляют собой два сверхэкспрессируемых рецептора клеточной поверхности, и по транскрипционному профилированию и протеомному анализу известно, что они сверхэкспрессируются при базальных раках молочной железы.

Антитела, специфические к рецепторам клеточной поверхности, сверхэкспрессируемых при множестве раков, используются для разработки целевой иммунотерапии. Например, HER2, CD20 и EGFR сверхэкспрессируются во множестве опухолей и антитела, распознающие эти рецепторы, разработаны для лечения метастатического рака молочной железы (трастузамаб), лимфомы (ритуксимаб) и колоректального рака (цетуксимаб). Несколько терапевтических подходов, включая конъюгаты антитело-лекарство, иммунотоксины и целевую доставку нуклеиновых кислот, требуют антител, которые не только связываются с рецептором, но также интернализируются клеткой после связывания.

Сущность изобретения

В настоящей заявке раскрыты антитела, которые связываются с ассоциированным с опухолью антигеном CD44 или с ассоциированным с опухолью антигеном EphA2, а также соответствующие композиции и способы, где они используются. Способы применения включают в себя методы терапии, диагностики и скрининга рака. В определенных вариантах воплощения изобретения антитела связывают антиген клеточной поверхности млекопитающего (например, антиген клеточной поверхности млекопитающего, представленный на дрожжах), в других они подвергаются эндоцитозу после связывания с клетками млекопитающего.

В одном воплощении изобретения предоставляется изолированное моноклональное антитело, которое специфически связывается с эпитопом CD44, который специфически связывается с антителом F2-1A6, или конкурирует с антителом F2-1A6 за связывание с CD44. Упомянутое антитело может эндоцитироваться (клеткой), когда связывается с CD44 на поверхности живой клетки млекопитающего. В одном варианте воплощения упомянутое антитело содержит VH CDR1 из F2-1A6, VH CDR2 из F2-1A6 и VH CDR3 из F2-1A6. В другом воплощении изобретения, упомянутое антитело содержит VL CDR1 из F2-1A6, VL CDR2 из F2-1A6 и VL CDR3 из F2-1A6. В еще одном воплощении изобретения упомянутое антитело конкурирует за связывание с эпитопом CD44 с антителом, содержащим полноразмерный VH из F2-1A6 и полноразмерный VL из F2-1A6.

В другом воплощении изобретения предоставляется изолированное моноклональное антитело, которое специфически связывается с эпитопом CD44, который специфически связывается с антителом F2-1H9, или конкурирует с антителом F2-1H9 за связывание с CD44. Упомянутое антитело может эндоцитироваться (клеткой), когда связывается с CD44 на поверхности живой клетки млекопитающего. В одном варианте воплощения упомянутое антитело содержит VH CDR1 из F2-1H9, VH CDR2 из F2-1H9 и VH CDR3 из F2-1H9. В другом варианте воплощения изобретения упомянутое антитело содержит VL CDR1 из F2-1H9, VL CDR2 из F2-1H9 и VL CDR3 из F2-1H9. В еще одном варианте воплощения изобретения упомянутое антитело содержит полноразмерный VH из F2-1H9 и полноразмерный VL из F2-1H9.

В другом варианте воплощения изобретения предоставляется изолированное моноклональное антитело, которое специфически связывается с эпитопом CD44, который специфически связывается с антителом, выбранным из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 и НН3; или конкурирует с антителом, выбранным из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 и НН3 за связывание с CD44. В одном варианте воплощения, упомянутое антитело содержит: VH CDR1 из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или НН3; VH CDR2 из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или НН3; и VH CDR3 из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или НН3. В другом варианте воплощения изобретения упомянутое антитело содержит: VL CDR1 из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или НН3; VL CDR2 из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или НН3; и VL CDR3 из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или НН3. В другом варианте воплощения изобретения упомянутое антитело содержит: полноразмерный VH из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или НН3; и полноразмерный VL из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или НН3.

В другом варианте воплощения изобретения предоставляется изолированное моноклональное антитело, которое специфически связывается с эпитопом EphA2, который специфически связывается антителом 2D6, или конкурирует с антителом 2D6 за связывание с EphA2. Упомянутое антитело может эндоцитироваться, когда связывается с EphA2 на поверхности живой клетки млекопитающего.

В другом варианте воплощения изобретения предоставляется изолированное моноклональное антитело, которое специфически связывается с эпитопом EphA2, который специфически связывается антителом D2-1A7, или конкурирует с антителом D2-1А7 за связывание с EphA2. Упомянутое антитело может эндоцитироваться, когда связывается с EphA2 на поверхности живой клетки млекопитающего.

В другом варианте воплощения изобретения предоставляется изолированное моноклональное антитело, которое специфически связывается с эпитопом EphA2, который специфически связывается с антителом D2-1A9, или которое конкурирует с антителом D2-1A9 за связывание с EphA2. Упомянутое антитело может эндоцитироваться, когда связывается с EphA2 на поверхности живой клетки млекопитающего.

В другом аспекте изобретения предоставляется изолированное моноклональное антитело, которое специфически связывается с эпитопом EphA2, который специфически связывается с антителом D2-1B1, или которое конкурирует с антителом D2-1B1 за связывание с EphA2. Упомянутое антитело может эндоцитироваться, когда связывается с EphA2 на поверхности живой клетки млекопитающего.

В другом варианте воплощения изобретения предоставляется изолированное моноклональное антитело, которое специфически связывается с эпитопом EphA2, который специфически связывается с антителом, выбранным из А3Н9, A3G3, A3D10, A3D1, А3С8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 и 15Н11, или которое конкурирует с антителом, выбранным из А3Н9, A3G3, A3D10, A3D1, А3С8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 и 15Н11, за связывание с EphA2. В одном варианте воплощения изобретения упомянутое антитело содержит: VH CDR1 из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11; VH CDR2 из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11; и VH CDR3 из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. В другом варианте воплощения изобретения упомянутое антитело содержит: VL CDR1 из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11; VL CDR2 из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11; и VL CDR3 из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11.

В определенных вариантах воплощений изобретения любое из вышеупомянутых моноклональных антител представляет собой одноцепочечный Fv (scFv), IgG, Fab, (Fab')2 или (scFv')2. Любое из упомянутых антител может быть помечено и/или конъюгировано со средством против рака.

В одном варианте воплощения изобретения предоставляется липидная наночастица, содержащая внешнюю поверхность и внутреннее пространство, упомянутое внутреннее пространство содержит средство против рака, при этом любое одно или более из вышеупомянутых изолированных антител присоединено к поверхности упомянутой липидной наночастицы. В одном варианте воплощения изобретения, когда липидная наночастица контактирует с экспрессирующимся на клеточной поверхности EphA2 или CD44 на клеточной поверхности, упомянутое антитело связывается с EphA2 на клеточной поверхности или CD44 на клеточной поверхности и липидная наночастица эндоцитируется.

В одном варианте воплощения изобретения предоставляется композиция, содержащая фармацевтически приемлемый носитель и любое из вышеупомянутых антител или любую из вышеупомянутых липидных наночастиц. Упомянутая композиция может быть разработана для парентерального введения. Альтернативно, упомянутая композиция может быть разработана для внутривенного, интратекального или внутрижелудочкового введения или для конвекционной доставки. В одном варианте воплощения изобретения предоставляется набор, содержащий композицию.

В другом варианте воплощении изобретения предоставляется способ лечения пациента, имеющего рак, упомянутый способ, содержащий введение упомянутому пациенту некоего количества любого из вышеупомянутых антител или любой из вышеупомянутых липидных наночастиц, отличающийся тем, что упомянутое количество является достаточным для замедления роста рака. В одном варианте воплощения изобретения упомянутое антитело интернализируется раковой клеткой.

В одном варианте воплощения изобретения предоставляется способ детекции раковых клеток у пациента, включающий в себя контакт любого одного из вышеупомянутых антител с клеткой упомянутого пациента, которая подозревается как раковая, и детекцию упомянутого антитела, связавшегося с клеткой.

В другом варианте воплощения изобретения предоставляется изолированная нуклеиновая кислота, содержащая нуклеотидную последовательность, кодирующую аминокислотную последовательность из: VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела из клона F2-1A6; VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела из клона F2-1A6; VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела из клона F2-1H9; VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела из клона F2-1H9; VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела, выбранного из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 и HH3; или VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела, выбранного из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 и HH3. В одном варианте воплощения изобретения упомянутая нуклеиновая кислота содержит нуклеотидную последовательность, кодирующую аминокислотную последовательность из: VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела из клона F2-1A6 и VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела из клона F2-1A6; VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела из клона F2-1H9 и VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела из клона F2-1H9; или VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела, выбранного из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 и HH3 и VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела, выбранного из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 и HH3.

В другом варианте воплощения изобретения предоставляется изолированная нуклеиновая кислота, содержащая нуклеотидную последовательность, кодирующую аминокислотную последовательность из: VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела из клона 2D6, VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела из клона 2D6, VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела из клона D2-1A7, VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела из клона D2-1A7.VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела из клона D2-1A9, VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела из клона D2-1A9, VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела из клона D2-1B1, VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела из клона D2-1B1; VH, содержащего VH CDR1, VH CDR2 и VH CDR3 антитела, выбранного из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 и 15Н11; VL, содержащего VL CDR1, VL CDR2 и VL CDR3 антитела, выбранного из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 и 15Н11; или изолированная нуклеиновая кислота, содержащая нуклеотидную последовательность, кодирующую аминокислотную последовательность из 1) и 2); 3) и 4); 5) и 6); 7) и 8); или 9) и 10).

В одном варианте воплощения изобретения предоставляется вектор экспрессии, который содержит любую из вышеупомянутых нуклеиновых кислот. В другом варианте воплощения изобретения предоставляется рекомбинантная клетка-хозяин ("генетически модифицированная клетка-хозяин"), содержащая упомянутый вектор. В одном варианте воплощения изобретения клетка экспрессирует анти-EphA2 антитело или анти-CD44 антитело.

Краткое описание фигур

Фигура 1. Дисплей (представление) антигенных доменов на поверхности дрожжей. Панель А, внеклеточный домен (ECD) рецептора EphA2 был представлен на поверхности дрожжей и распознан посредством анти-EphA2 антитела и рекомбинантным мышиным Эфрином A1 (R&D, Minneapolis), как определено путем анализа проточной цитометрии. Панель В, линкерный домен CD44 (домен 1 или D1) был представлен на поверхности дрожжей и распознан посредством анти-CD44 кроличьего моноклонального антитела, как определено путем анализа проточной цитометрии. Как анти-EphA2, так и анти-CD44 антитела не распознавали нерелевантный белок, представленный на поверхности дрожжей.

Фигура 2. Восстановление фаговых антител из представленных на дрожжах антигенов. Панель А, сравнение восстановления фагового антитела, известного связыванием с EphA2 (2D6) с дрожжей, на которых представлен EphA2 ECD (Y-EphA2) по сравнению с дрожжами, на которых представлен нерелевантный белок (Y-CON). Анти-EphA2 фаговые антитела 2D6 общим числом 1011 инкубировались с каждым из представленных на дрожжах антигенов. Панель В, влияние элюирующего буфера на титр EphA2 фагового антитела, элюированного с поверхности дрожжей, на которых представлен EphA2 ECD. Анти-EphA2 фаговые антитела 2D6 общим числом 1011 инкубировались с каждым из представленных на дрожжах антигенных белков перед элюированием. Панель С, влияние введенного фагового титра на элюированный фаговый титр. Указанный титр анти-EphA2 фагового антитела 2D6 инкубировался с дрожжами, на которых представлен EphA2 ECD или нерелевантный белок, и определялся титр элюированного фага.

Фигура 3. Стратегия селекции интернализирующихся антиген-специфических фаговых антител. Панель А, после двух циклов селекции на интернализацию на клеточной линии базального рака молочной железы MDAMB231, пул фаговых антител вначале инкубировался с нерелевантными контрольными дрожжами для удаления любых связавшихся с дрожжами антител, после чего следовал пэннинг дрожжей, представляющих или EphA2 ECD, или CD44 домен 1. Панель В, сигнал связывания пула поликлональных фаговых антител к EphA2 ECD или CD44 домену 1 после 2 циклов пэннинга был подсчитан с использованием проточной цитометрии. Нерелевантные контрольные дрожжи окрашивались библиотекой неселектированных фаговых антител (R0), поликлональными фагами цикла 1 (R1) и цикла 2 (R2). Панель С, частота антиген-специфичных фаговых антител после одного и двух циклов селекции на антиген, представленный на дрожжах. Частота связывания определялась путем анализа 96 случайно отобранных фаговых антител на связывание с антигеном, представленным на дрожжах, путем проточной цитометрии. Индуцированные дрожжевые клетки, представляющие нерелевантный белок, EphA2-ECD или CD44 домен 1, были окрашены неселектированной фаговой библиотекой (R0) и поликлональными фагами из R1 и R2, соответственно. Неиндуцированные дрожжевые клетки (только дрожжи), нерелевантная фаговая библиотека (фаговый контроль) и библиотека неселектированных фаговых антител использовались как контроль.

Фигура 4. Специфичность связывания моноклинальных фаговых антител, полученных биопэннингом с дрожжевым антигеном. Панель А, связывание моноклональных фаговых антител с антигенными доменами, представленными на дрожжах, как определено посредством проточной цитометрии. Индуцированные дрожжевые клетки, представляющие нерелевантный белок (Y-CON), EphA2-ECD (Y-EphA2 BCD), CD44 линкерный домен (Y-CD44 ECD D1) и CD44 полноразмерный BCD (Y-CD44 ECD), окрашивались моноклональными фаговыми антителами, изолированными после Y-EphA2 и Y-CD44 D1 селекции. Панель В показывает связывание моноклональных фаговых антител с MDAMB231 клетками, как определено при помощи проточной цитометрии. Панель С показывает различное связывание моноклональных фаговых антител с клеточными линиями рака молочной железы, включая люминальные клеточные линии рака молочной железы SUM52PE и MCF7, и клеточную линию базального рака молочной железы MDAMB231.

Фигура 5. Характеризация scFv антител с помощью вестерн-блота и проточной цитометрии. Панель А, анти-EphA2 scFv 2D6 или D2-1A7 и анти-CD44 scFv F2-1A6 были использованы для иммунопреципитации являющихся их мишенями антигенов из клеток MDAMB231. Антиген определялся при помощи вестерн-блоттинга с использованием или анти-EphA2 антитела D7 (Upstate Biotech, Billerica), или анти-CD44 антитела Ab-4 (NeoMarkers, Fremont). Панель В, EphA2 антитела D2-1A7, D2-1A9 и 2D6 конкурируют с эфрином А1 за связывание с клетками MDAMB231. Способность фаговых антител D2-1A7, D2-1A9 и 2D6 связываться с клетками MDAMB231 в присутствии возрастающих концентраций EphA2 лиганда эфрина А1 определялась путем проточной цитометрии.

Фигура 6. Фаговые антитела, специфичные к EphA2 и CD44, эндоцитируются клетками MDAMB231. Культивируемые клетки инкубировались с нерелевантным фагом (панель А), анти-EphA2 фагом D2-1A7 (панель В) и D2-1A9 (панель С), анти-CD44 фагом F2-1A6 (панели D и Е) в течение 3 ч при 37°С, после чего промывались глицин буфером. Эндоцитоз определялся путем детекции внутриклеточного фага анти-fd антителом, и анализировался с помощью конфокальной микроскопии.

Фигура 7. Аминокислотные последовательности полноразмерных VH и VL антител, специфичных к CD44 из различных клонов. Также указаны каркас и участки, определяющие комплементарность. SEQ ID NOs относится к полноразмерному вариабельному участку.

Фигура 8. Аминокислотные последовательности полноразмерных VH и VL антител, специфичных к EphA2 из различных клонов. Также указаны каркас и участки, определяющие комплементарность. SEQ ID NOs относится к полноразмерному вариабельному участку.

Фигуры 9А и 9В. Аминокислотные последовательности и кодирующие последовательности нуклеиновых кислот для полноразмерных антител из клона 2D6.

Фигуры 10А и 10В. Аминокислотные последовательности и кодирующие последовательности нуклеиновых кислот для полноразмерных scFv антител из клона D2-1А7.

Фигуры 11А и 11В. Аминокислотные последовательности и кодирующие последовательности нуклеиновых кислот для полноразмерных scFv антител из клона D2-1А9.

Фигуры 12А и 12В. Аминокислотные последовательности и кодирующие последовательности нуклеиновых кислот для полноразмерных scFv антител из клона D2-1В1.

Фигуры 13А и 13В. Аминокислотные последовательности и кодирующие последовательности нуклеиновых кислот для полноразмерных scFv антител из клона F2-1А6.

Фигуры 14А и 14В. Аминокислотные последовательности и кодирующие последовательности нуклеиновых кислот для полноразмерных scFv антител из клона F2-1Н9.

Фигуры 15A и 15В. Аминокислотная последовательность (SEQ ID NO:90) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:91) для полноразмерных scFv антител из клона Е8Н11.

Фигуры 16А и 16В. Аминокислотная последовательность (SEQ ID NO:58) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:59) для полноразмерных scFv антител из клона Е8Н7.

Фигуры 17А и 17В. Аминокислотная последовательность (SEQ ID NO:92) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:93) для полноразмерных scFv антител из клона E8G12.

Фигуры 18А и 18В. Аминокислотная последовательность (SEQ ID NO:63) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:64) для полноразмерных scFv антител из клона E8F11.

Фигуры 19А и 19В. Аминокислотная последовательность (SEQ ID NO:72) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:73) для полноразмерных scFv антител из клона Е8С9.

Фигуры 20А и 20В. Аминокислотная последовательность (SEQ ID NO:85) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:86) для полноразмерных scFv антител из клона D6G9.

Фигуры 21А и 21В. Аминокислотная последовательность (SEQ ID NO:127) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:128) для полноразмерных scFv антител из клона D6D3.

Фигуры 22А и 22В. Аминокислотная последовательность (SEQ ID NO:129) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:130) для полноразмерных scFv антител из клона А3Н9.

Фигуры 23А и 23В. Аминокислотная последовательность (SEQ ID NO:135) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:136) для полноразмерных scFv антител из клона A3G3.

Фигуры 24А и 24В. Аминокислотная последовательность (SEQ ID NO:137) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:138) для полноразмерных scFv антител из клона A3D10.

Фигуры 25А и 25В. Аминокислотная последовательность (SEQ ID NO:305) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:306) для полноразмерных scFv антител из клона A3D1.

Фигуры 26А и 26В. Аминокислотная последовательность (SEQ ID NO:307) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:308) для полноразмерных scFv антител из клона A3C8.

Фигуры 27А и 27В. Аминокислотная последовательность (SEQ ID NO:309) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:310) для полноразмерных scFv антител из клона 1А3.

Фигуры 28А и 28В. Аминокислотная последовательность (SEQ ID NO:311) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:312) для полноразмерных scFv антител из клона 1А5.

Фигуры 29А и 29В. Аминокислотная последовательность (SEQ ID NO:313) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:314) для полноразмерных scFv антител из клона 1А8.

Фигуры 30А и 30В. Аминокислотная последовательность SEQ ID NO:315) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:316) для полноразмерных scFv антител из клона 1А12.

Фигуры 31А и 31В. Аминокислотная последовательность (SEQ ID NO:317) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:318) для полноразмерных scFv антител из клона 1В2.

Фигуры 32А и 32В. Аминокислотная последовательность (SEQ ID NO:319) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:320) для полноразмерных scFv антител из клона 1С2.

Фигуры 33А и 33В. Аминокислотная последовательность (SEQ ID NO:321) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:322) для полноразмерных scFv антител из клона 1С7.

Фигуры 34А и 34В. Аминокислотная последовательность (SEQ ID NO:323) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:324) для полноразмерных scFv антител из клона 1D8.

Фигуры 35А и 35В. Аминокислотная последовательность (SEQ ID NO:325) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:326) для полноразмерных scFv антител из клона 15Н11.

Фигуры 36А и 36В. Аминокислотная последовательность (SEQ ID NO:327) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:328) для полноразмерных scFv антител из клона D1C5.

Фигуры 37А и 37В. Аминокислотная последовательность (SEQ ID NO:329) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:330) для полноразмерных scFv антител из клона D1D1.

Фигуры 38А и 38В. Аминокислотная последовательность (SEQ ID NO:331) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:332) для полноразмерных scFv антител из клона HI В 8 (также обозначаемого в настоящей заявке как "НВ8").

Фигуры 39А и 39В. Аминокислотная последовательность (SEQ ID NO:333) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:334) для полноразмерных scFv антител из клона Н1С2 (также обозначаемого в настоящей заявке как "НС2").

Фигуры 40А и 40В. Аминокислотная последовательность (SEQ ID NO:335) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:336) для полноразмерных scFv антител из клона Н1С4 (также обозначаемого в настоящей заявке как "НС4").

Фигуры 41А и 41В. Аминокислотная последовательность (SEQ ID NO:337) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:338) для полноразмерных scFv антител из клона Н1Е3 (также обозначаемого в настоящей заявке как "НЕ3").

Фигуры 42А и 42В. Аминокислотная последовательность (SEQ ID NO:339) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:340) для полноразмерных scFv антител из клона H1F1 (также обозначаемого в настоящей заявке как "НР1").

Фигуры 43А и 43В. Аминокислотная последовательность (SEQ ID NO:127) и последовательность кодирующей нуклеиновой кислоты (SEQ ID NO:128) для полноразмерных scFv антител из клона Н1Н3 (также обозначаемого в настоящей заявке как "HH3").

Фигура 44. Аминокислотные последовательности полноразмерных VH и VL антител, специфичных к CD44 из различных клонов. Также указаны каркас и участки, определяющие комплементарность. SEQ ID NOs относится к полноразмерному вариабельному участку. Представлены VH последовательности Е8Н11 (SEQ ID NO:90); Е8Н7 (SEQ ID NO:342); E8G12 (SEQ ID NO:343); E8F11 (SEQ ID NO:344); E8C9 (SEQ ID NO:345); D6G9 (SEQ ID NO:346); и D6D3 (SEQ ID NO:347). Представлены VL последовательности Е8Н11 (SEQ ID NO:348); Е8Н7 (SEQ ID NO:349); E8G12 (SEQ ID NO:350); E8F11 (SEQ ID NO:351); E8C9 (SEQ ID NO:352); D6G9 (SEQ ID NO:353); и D6D3 (SEQ ID NO:354).

Фигуры 45А и 45В. Аминокислотные последовательности полноразмерных VH и VL антител, специфичных к CD44 из различных клонов. Также указаны каркас и участки, определяющие комплементарность. SEQ ID NOs относится к полноразмерному вариабельному участку. Представлены VH последовательности D1C5 (SEQ ID NO:355); D1D1 (SEQ ID NO:356); HB8 (SEQ ID NO:357); HC2 (SEQ ID NO:358); HC4 (SEQ ID NO:359); HE3 (SEQ ID NO:360); HF1 (SEQ ID NO:361); и HH3 (SEQ ID NO:347). Представлены VL последовательности D1C5 (SEQ ID NO:362); D1D1 (SEQ ID NO:363); HB8 (SEQ ID NO:364); HC2 (SEQ ID NO:365); HC4 (SEQ ID NO:366); HE3 (SEQ ID NO:367); HF1 (SEQ ID NO:368); и HH3 (SEQ ID NO:354).

Фигура 46. Аминокислотные последовательности полноразмерных VH и VL антител, специфичных к EphA2 из различных клонов. Также указаны каркас и участки, определяющие комплементарность. SEQ ID NOs относится к полноразмерному вариабельному участку. Представлены VH последовательности А3Н9 (SEQ ID NO:369); A3G3 (SEQ ID NO:370); A3D10 (SEQ ID NO:371); A3D1 (SEQ ID NO:372); и A3C8 (SEQ ID NO:373). Представлены VL последовательности А3Н9 (SEQ ID NO:374); A3G3 (SEQ ID NO:375); A3D10 (SEQ ID NO:376); A3D1 (SEQ ID NO:377); и A3C8 (SEQ ID NO:378).

Фигура 47. Аминокислотные последовательности полноразмерных VH и VL антител, специфичных к EphA2 из различных клонов. Также указаны каркас и участки, определяющие комплементарность. SEQ ID NOs относится к полноразмерному вариабельному участку. Представлены VH последовательности 1А3 (SEQ ID NO:379); 1А5 (SEQ ID NO:380); 1A8 (SEQ ID NO:381); 1A12 (SEQ ID NO:382); 1B2 (SEQ ID NO:383); 1C2 (SEQ ID NO:384); 1C7 (SEQ ID NO:385); и 1D8 (SEQ ID NO:386). Представлены VL последовательности 1А3 (SEQ ID NO:387); 1А5 (SEQ ID NO:388); 1A8 (SEQ ID NO:389); 1A12 (SEQ ID NO:390); 1B2 (SEQ ID NO:391); 1C2 (SEQ ID NO:392); 1C7 (SEQ ID NO:393); и 1D8 (SEQ ID NO:394).

Определения

Следующие аббревиатуры могут быть использованы в настоящей заявке: CDR, участок, определяющий комплементарность; Fab, антиген-связывающий фрагмент иммуноглобулина с вариабельным доменом и первым константным доменом; FACS, сортировка флюоресцентно активированных клеток; IgG, иммуноглобулин G; KD, константа равновесия при диссоциации; kon, константа скорости ассоциации; koff, константа скорости диссоциации; mAb, моноклональное антитело; MFI, средняя интенсивность флюоресценции; PBS, фосфатно-солевой буфер; ПЦР, полимеразная цепная реакция; scFv, одноцепочечный формат вариабельных участков антитела; VH, вариабельный участок тяжелой цепи; VL, вариабельный участок легкой цепи; ТАА, ассоциированный с опухолью антиген; EGFR, рецептор эпидермального фактора роста; ECD, внеклеточный домен; IMAC, аффинная хроматография на иммобилизированных ионах металла; ILs, иммунолипосомы; IPTG, изопропил-β-D-тиогалактопиранозид; 2-МЕА, 2-меркаптоэтиламин; DTT, дитиотриэтол; TEA, триэтиламин; TBS-T, Трис-буферный солевой Tween-20; Ni-NTA, никель-нитрилтрехуксусная кислота; РЕ, фикоэритрин; НМЕС, эпителиальные клетки млекопитающего, являющегося человеком.

При использовании здесь, "EphA2" означает член семейства рецепторных тирозинкиназ, который может связывать ЭфринА лиганды, и также может быть назван "киназой эпителиальных клеток (ECK)". Термин "EphA2" может относиться к любым природным изоформам EphA2. Аминокислотная последовательность EphA2 известна и ее можно найти под номером доступа GenBank No. NP_004422.2.

Как используется здесь, "CD44" означает рецептор для гиалуроновой кислоты (НА) и также может называться "фагоцитный гликопротеин I", "рецептор гиалуроновой кислоты" или "CD44 антиген". Например, термин "CD44" может означать любую из природных изоформ CD44. Аминокислотная последовательность известна и самую длинную изоформу CD44 можно найти под номером доступа GenBank No. NP_000601.3.

Термины "полипептид", "пептид" или "белок" используются здесь взаимозаменяемо для обозначения линейных последовательностей аминокислотных остатков, связанных одна с другой пептидными связями между альфа-амино и карбоксильными группами расположенных рядом остатков. Кроме того, аминокислоты, в дополнение к 20 "стандартным" генетически кодируемым аминокислотам, включают аналоги аминокислот. Далее, следует заметить, что тире в начале или конце аминокислотной последовательности указывает или на пептидную связь со следующей последовательностью одного или более аминокислотных остатков, или на ковалентную связь с карбоксильной или гидроксильной концевой группой. Однако отсутствие тире не должно означать, что такие пептидные связи или ковалентная связь с карбоксильной или гидроксильной концевой группой не присутствуют, если в репрезентации аминокислотных последовательностей пропуск такового является обычным.

"Антитело" охватывает соединения, содержащие антиген-связывающий белок, отдельно или как препарат, содержащий их в большом количестве, имеющий один или более полипептидов, которые могут генетически кодироваться генами иммуноглобулинов или фрагментами генов иммуноглобулинов, или который содержит CDR, полученные или происходящие из иммуноглобулинов, и который связывается с представляющим интерес антигеном. Легкие цепи классифицируются как каппа или лямбда. Тяжелые цепи могут классифицироваться как гамма, мю, альфа, дельта или эпсилон, что в свою очередь определяет классы иммуноглобулина, IgG, IgM, IgA, IgD и IgE, соответственно.

Примером антитела является таковое, имеющее структурную единицу тетрамера, составленного из двух пар полипептидных цепей, каждая часть имеет одну "легкую" и одну "тяжелую" цепь. N-терминальный участок каждой цепи определяет вариабельный участок, который опосредует связывание антигена. Термины вариабельная легкая цепь (VL) и вариабельная тяжелая цепь (VH) относятся к легким и тяжелым цепям, соответственно.

"Антитело" также охватывает одноцепочечные антитела, которые содержат тяжелую цепь и легкую цепь, связанные вместе как один полипептид, каждая из связанных тяжелых или легких цепей, безотносительно этого обозначается здесь как тяжелая цепь или легкая цепь. Антитело может также относиться к антителам только с тяжелой цепью, таким как тяжелоцепочечные или HCAbs.

Как отмечено выше, "антитело" охватывает интактные иммуноглобулины, а также антиген-связывающие фрагменты антител. Таким образом, термин "антитело", при использовании здесь, также включает антиген-связывающий участок антитела, который может быть произведен путем модификации целых антител или синтезирован de novo с использованием методологий рекомбинантных ДНК. Примеры включают, но не ограничиваются тем самым. Fab', Fab'2, scFv, нанотела, унитела и диатела. "Нанотело" означает наименьший антиген-связывающий фрагмент одноцепочечного антитела, также обозначаемый как VHH или однодоменные антитела (dAbs).

"Моноклональное антитело" означает композицию, содержащую одно или более антител, полученных из популяции по существу гомогенных антител, т.е. популяции отдельных антител, которые идентичны за исключением любых естественным образом появляющихся мутаций, которые могут присутствовать в незначительном количестве. Моноклональные антитела являются высокоспецифичными, будучи направлены против единственного антигенного сайта и обычно к единственному эпитопу на антигене. Модификатор "моноклональный" указывает на характер антитела как полученного из по существу гомогенной популяции антител, и не требует того, что антитело было произведено по любому определенному способу или являлось единственным антителом в композиции.

Одноцепочечный Fv ("scFv") полипептид является ковалентно связанным VH::VL гетеродимером, который может экспрессироваться из нуклеиновой кислоты, включающей VH- и VL- кодирующие последовательности, соединенные либо напрямую, либо соединенные кодирующим полипептид линкером (Huston, et al. (1988) Proc. Nat. Acad. Sci. USA, 85: 5879-5883). Множество структур доступны для конвертации легкой и тяжелой полипептидных цепей из V участка антитела в scFv молекулу, которая будет складываться в трехмерную структуру, по существу подобную структуре антиген-связывающего сайта. Кроме диател, scFvs могут также присутствовать как тритела или тетратела.

Следует заметить, что хотя различные фрагменты антител определяются в терминах расщепления интактного антитела, специалисты поймут, что такие фрагменты могут синтезироваться de novo или химически, или с использованием рекомбинантной ДНК-методологии.

Термин "антитело" охватывает поликлональные и моноклональные антитела, и кроме того, охватывает антитела любого класса (например, IgM, IgG и их подклассы). "Антитело" также охватывает гибридные антитела, биспецифические антитела, гетероантитела, химерные антитела, гуманизированные антитела и их функциональные фрагменты, которые сохраняют связывание антигена. "Биспецифические антитела" могут походить на единичные антитела (или фрагменты антител), но имеют два различных антиген-связывающих сайта (вариабельных участка). Гетероантитела относятся к двум или более антителам или связывающим антитела фрагментам (например. Fab), связанным вместе, каждое антитело или фрагмент имеют различную специфичность. Антитела могут быть конъюгированы с другими компонентами, и/или могут связываться с подложкой (например, твердой подложкой), такой как полистироловая пластинка или шарик, тестовая полоска и тому подобное.

Вариабельный участок легкой или тяжелой цепи иммуноглобулина составлен из "каркасного" участка (FR), прерываемого тремя гипервариабельными участками, также называемыми "участками, определяющими комплементарность" или "CDR".

Протяженность каркасного участка и CDR может быть определена на основе баз данных, известных специалистам. См., например, "Sequences of Proteins of Immunological Interest," E. Kabat et al., Sequences of proteins of immunological interest, 4th ed. U.S. Dept. Health и Human Services, Public Health Services, Bethesda, MD (1987), Lefranc et al. IMGT, the international ImMunoGeneTics information system®. Nucl. Acids Res., 2005, 33:D593-D597 (www.imgt.org/textes/IMGTScientificChart/), и/или V Base на vbase.mrc-cpe.cam.ac.uk/). Последовательности каркасных участков различных легких или тяжелых цепей сравнительно консервативны в пределах видов. Каркасный участок антитела, в котором комбинируются каркасные участки компонентов легкой и тяжелой цепей, служит для определения позиции и выравнивания CDR. CDR первоначально служат для связывания эпитопа антигена. Все CDR и каркасные участки, предоставляемые настоящим изобретением, определяются в соответствии с Kabat et al., supra, если не указано иное.

"Анти-EphA2 антитело" или "анти-CD44 антитело" означает антитело, которое специфически связывается с EphA2 или CD44, предпочтительно с высокой аффинностью. Специфическое антитело к EphA2 или CD44 не демонстрирует сопоставимого связывания с другими антигенами, несвязанными с EphA2 или CD44, по сравнению со связыванием EphA2 или CD44.

Термин "высокая аффинность" при использовании в отношении антитела означает антитело, которое специфически связывается с ("распознает") свою цель(и) со значением аффинности (KD) менее или эквивалентным 10-6 М, менее чем 10-7 М, менее чем 10-8 М, предпочтительно менее чем 10-9 М, менее чем 10-10 М или менее чем 10-11 М. Более низкое KD значение соответствует более высокой аффинности связывания (т е. более сильному связыванию), так что KD значение 10-7 указывает на более высокую аффинность связывания, чем KD значение 10-6.

"Антиген-связывающий сайт" или "связывающий участок" означает часть молекулы антитела (например, фрагмент молекулы иммуноглобулина или scFv), которая участвует в иммунореактивном связывании антигена. Антиген-связывающий сайт формируется аминокислотными остатками N-концевых вариабельных ("V") участков тяжелой ("Н") и/или легкой ("L") цепей. Три высоко дивергентных региона внутри V участков тяжелой и легкой цепей обозначаются как "гипервариабельные участки", которые вставлены между более консервативными фланкерными регионами, известными как "каркасные участки " или "FRs". Таким образом, термин "FR" относится к аминокислотным последовательностям, которые в природе находятся между и рядом с гипервариабельными участками в иммуноглобулинах. В тетрамерной молекуле антитела три гипервариабельных участка легкой цепи и три гипервариабельных участка тяжелой цепи расположены друг относительно друга в трехмерном пространстве, формируя антиген-связывающую "поверхность". Эта поверхность опосредует распознавание и связывание целевого антигена. Три гипервариабельных участка каждой из тяжелой и/или легкой цепей обозначаются как " участки, определяющие комплементарность " или "CDR" и определяются, например, основываясь на Kabat et al., supra.

"F2-1A6 антитело" означает антитело, экспрессируемое клоном F2-1A6, или антитело, синтезированное другим образом, но имеющее такие же CDR и, необязательно, такие же каркасные участки, как в антителе, экспрессируемом клоном F2-1A6 и имеющем по существу такую же специфичность связывания антигена. Подобным образом, антитела 2D6, D2-1A7, D2-1A9, D2-1B1, F2-1H9 и тому подобные (например, антитела Е8Н11, Е8Н7, E8G12, E8F11 и Е8С9; антитела D6G9 и D6D3; антитела D1C5 и D1D1; антитела НВ8, НС2, НС4, НЕ3, HF1 и HH3; антитела А3Н9, A3G3, A3D10, A3D1 и A3C8; антитела 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7 и 1D8; и антитело 15Н11) относятся к антителам, экспрессируемым соответствующим клоном(ами) и/или к антителам, синтезируемым другим способом, но имеющим такие же CDR и необязательно, такие же каркасные участки, как эталонные антитела, и имеющих по существу такую же специфичность связывания антигена. CDR этих антител определены Kabat et al., supra, как показано на фигурах 7, 8 и 44-47, и таблицах ниже.

"Эпитоп" является участком антигена (например, участком ЕрhА2 внеклеточного домена (ECD)), с которым связывается антитело. Эпитопы могут формироваться как из смежных аминокислот, так и из несмежных аминокислот, оказавшихся рядом при укладке (например, третичной укладке) белка. Эпитопы, сформированные из смежных аминокислот, обычно удерживаются при воздействии денатурирующих растворителей, тогда как эпитопы, формируемые при укладке, обычно теряются при обработке денатурирующими растворителями. Эпитоп обычно включает по меньшей мере 3, и более обычно, по меньшей мере 5 или 8-10 аминокислот в линейной или пространственной конформации. Методы определения пространственной конформации эпитопов включают, например, рентгенокристаллографию и 2-мерный ядерно-магнитный резонанс. См., например, Epitope Mapping Protocols in Methods in Molecular Biology, Vol.66, Glenn E. Morris, Ed (1996). Несколько коммерческих лабораторий предлагают услуги картирования эпитопов. Эпитопы, связанные антителом, иммунореактивным с ассоциированным с мембраной антигеном, могут оставаться на поверхности клетки (например, во внеклеточной области трансмембранного белка), поэтому такие эпитопы считаются доступными на клеточной поверхности, доступными для растворителя и/или экспонирующимися на клеточной поверхности.

"Изолированный" относится к представляющему интерес объекту (например, белку, например, антителу), который находится в среде, отличной от той, в которой объект может присутствовать в природе. "Изолированный" объект отделен от всех или некоторых компонентов, которые ему сопутствуют в природе, и может быть частично обогащен. "Изолированный" также относится к состоянию объекта, отделенного от всех или некоторых компонентов, которые сопутствуют ему во время производства (например, химический синтез, рекомбинантная экспрессия, культуральная среда и тому подобное). Антитело по изобретению может быть в значительной степени чистым. "В значительной степени чистый" может относиться к композициям, в которых по меньшей мере 75%, по меньшей мере 85%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98%, по меньшей мере 99%, или более чем 99% всей композиции являются объектом интереса (например, антителом по изобретению).

Фразы "специфично связывае(ю)тся с," "специфичен к," "иммунореактивный" и "иммунореактивность," и "специфичность связывания антигена," когда относятся к антителу, относятся к реакции связывания с антигеном, которая очень предпочтительна для антигена или его фрагмента, как определяется по присутствию антигена в присутствие гетерогенной популяции антигенов (например, белков и других биопрепаратов, например, в ткани). Таким образом, при указанных условиях иммуноанализа, определенные антитела связываются с определенным антигеном и не связываются в значимом количестве с другими антигенами, присутствующими в образце. Специфическое связывание с антигеном при таких условиях может требовать антитело, которое выбирается по своей специфичности к определенному антигену. Например, анти-CD44 антитела могут специфично связываться с CD44 и не демонстрировать сопоставимого связывания (например, не демонстрировать детектируемого связывания) с другими белками, присутствующими в образце ткани. См. Harlow и Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York, для описания форматов и условий иммуноанализов, которые могут быть использованы для определения специфической иммунореактивности.

Подробное описание изобретения

Здесь раскрыты антитела, которые специфично связываются с опухолью, ассоциированной с антигеном CD44, и антитела, которые специфично связываются с опухолью, ассоциированной с антигеном EphA2, а также соответствующие композиции и способы их использования. Способы использования охватывают способы терапии рака, диагностики и скрининга.

Если антитела специфичны к CD44, антитела содержат по меньшей мере один, два или все три CDR из VH антитела из (например, полученного путем экспрессии) клона F2-1А6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3. Антитела также охватывают те, которые содержат по меньшей мере один, два или все три CDR из VL антитела из клона F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3. Антитела также охватывают те, которые содержат по меньшей мере один, два или все три CDR, независимо выбранные из каждого из VL и VH антитела из клона F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3. Альтернативно, антитела конкурируют за связывание с CD44 (например, связывание с одним и тем же эпитопом) и антителом из клона F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3.

Если антитела специфичны к EphA2, антитела содержат по меньшей мере одну, две или все три тяжелые цепи (VH) участка(ов), определяющих комплементарность (CDR(s)) антитела из клона 2D6, D2-1A7, D2-1A9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Антитела также охватывают те, которые содержат по меньшей мере одну, две или все три легкие цепи (VL) участка(ов), определяющих комплементарность (CDR(s)) антитела из клона 2D6, D2-1A7, D2-1A9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Антитела также охватывают те, которые содержат по меньшей мере один, два или все три CDR, независимо выбранные из каждого из VL и VH антитела из клона 2D6, D2-1A7, D2-1A9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Альтернативно антитела конкурируют за связывание с EphA2 (например, связывание с одним и тем же эпитопом) и антителом из клона 2D6, D2-1A7, D2-1A9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11.

Антитело настоящего изобретения может также содержать все VH CDR и/или VL CDR антитела из клона F2-1A6, F2-1H9, 2D6, D2-1A7, D2-1A9, D2-1B1, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1, HH3, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Антитела могут содержать полноразмерный VH цепи антитела из клона F2-1A6, F2-1H9, 2D6, D2-1A7, D2-1A9, D2-1B1, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1, HH3, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Антитела могут также или альтернативно содержать полноразмерный VL цепи антитела из клона F2-1A6, F2-1H9, 2D6, D2-1A7, D2-1A9, D2-1B1, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1, HH3, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11.

Антитело может быть полноразмерным антителом (т.е. антителом, содержащим по меньшей мере одну полноразмерную VH последовательность и по меньшей мере одну полноразмерную VL последовательность) или фрагмент, такой как одноцепочечный Fv (scFv), Fab, (Fab')2, (ScFv)2 и тому подобные. Антитело может быть IgG (например, IgG2) или любого другого изотипа, или может быть биспецифичным антителом.

Антитела могут быть конъюгированы, например, с лекарством против рака, меткой или компонентом, который улучшает или усиливает период полувыведения из сыворотки (например, поли(этиленгликоль) (PEG)), эндоцитоз или другую биологическую функцию или характеристику. Антитело также может находиться в композиции, содержащей фармацевтически приемлемое вспомогательное вещество, например, в композиции, подходящей для инъекции (например, в единичной дозированной лекарственной форме). Настоящее изобретение также предоставляет композиции, которые включают одно или более различных антител, выбранных из антител, описанных в настоящей заявке и/или антител, содержащих один или более CDR из этих антител, содержащих мутанты или производные этих антител. Композиция может включать одно или более антител, таких как F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1, HH3, 2D6, D2-1A7, D2-1A9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11.

Способы настоящего изобретения включают те, которые предназначены для введения одному или более пациентам антител, раскрытых здесь, в достаточном количестве для лечения пациента, имеющего рак, экспрессирующий антиген(ы), специфически связывающиеся с антителом или антителами пациента. Антитела, предоставляемые изобретением, также могут использоваться для диагноза/прогноза или визуализации рака.

Нуклеиновые кислоты, предоставляемые в настоящей заявке, кодируют одно или более антител, которые описаны здесь. Клетки хозяева, содержащие такие нуклеиновые кислоты, также предоставлены здесь, а также те, которые производят антитела по изобретению (например, путем секреции). Также предоставлены наборы для приготовления композиций, содержащих антитела по изобретению, или для выполнения способов по изобретению.

Антитела

Предпочитаемые антитела имеют высокую аффинность (например, демонстрируют значения KD 10-7 М или ниже) к одному или более ассоциированными с опухолью антигенами (ТАА), EphA2 или CD44, которые экспонируются на клеточной поверхности раковых клеток в течение по меньшей мере некоторой части клеточного цикла. Рассматриваются также антитела, имеющие более низкую аффинность (например, имеющие значения KD от 10-5 М до 10-6 М) для EphA2 или CD44. Раковые клетки, например, включают те, которые происходят из клеток рака молочной железы (например, MDAMB231), и другие. Антитела по изобретению включают те, которые интернализируются клеткой после связывания с антигеном, например, антигеном на поверхности живой клетки млекопитающего, например, путем эндоцитоза, такого как рецептор-опосредованный эндоцитоз.

Антитела по изобретению включают те, которые конкурентно связываются с эпитопом CD44 с антителом из клона F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3. Антитела также охватывают те, которые конкурентно связываются с эпитопом на EphA2 с антителом из клона 2D6, D2-1A7, D2-1A9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Способность определенного антитела распознать такой же эпитоп, как и другое антитело, может быть определена по способности одного антитела конкурентно ингибировать связывание второго антитела (например, конкурентно связывать) с антигеном (например, как определено анализами конкурентного связывания, такими как те, которые раскрыты в опубликованном патенте США №20090291085). Конкурентное ингибирование связывания также может обозначаться как перекрестная реактивность антител.

Любой из множества анализов конкурентного связывания может быть использован для количественной оценки конкуренции между двумя антителами за один антиген. Например, для этой цели может быть использован анализ сэндвич ELISA. Методы анализа перекрестной реактивности хорошо известны специалистам в данной области (см., например, Dowbenko et al. (1988) J. Virol. 62: 4703-4711).

Антитело считается конкурентно ингибирующим связывание второго антитела с антигеном, если связывание второго антитела с антигеном уменьшается по меньшей мере на 30%, обычно по меньшей мере приблизительно на 40%, 50%, 60% или 75%, и часто по меньшей мере приблизительно на 90%, в присутствии первого антитела с использованием любого из анализов, использующих анализ конкурентного связывания.

В этом можно удостовериться путем предоставления одной или более изолированных, являющихся мишенью TAA(s), EphA2 и/или CD44, прикрепленных к твердой подложке и анализирующих способность антитела связывать являющуюся мишенью ТАА или конкурировать с антителом, описанным в настоящей заявке, за связывание с являющейся мишенью ТАА (например, с использованием поверхностного плазменного резонанса).

Как отмечено выше, антитела по изобретению охватывают те, которые конкурируют с одним или более из следующих антител: 2D6, D2-1A7, D2-1A9, D2-1B1, F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1, HH3, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 и 15Н11. Кроме того, антитела могут иметь аффинность связывания с EphA2 или CD44, сравнимую или более чем приблизительно 1×10-6 М (т.е. антитела могут демонстрировать значения KD ниже чем 10-6 М, например, приблизительно 10-7 М, 10-8 М, 10-9 М, 10-10 М или даже более высокую аффинность связывания, такую как значение KD приблизительно 10-11 М или 10-12 М).

В соответствующем варианте воплощения антитела по изобретению охватывают те, которые связываются с тем же самым эпитопом, что и F2-1A6 или F2-1H9 или с эпитопом 2D6, D2-1A7, D2-1A9 или D2-1B1, или с эпитопом Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3, или с эпитопом А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Картирование эпитопа может быть осуществлено с использованием пар антител в концентрациях, приводящих к скорому насыщению, и по меньшей мере 100 относительных единиц (RU) связавшегося антитела. Количество связавшегося антитела определяется для каждого члена пары, и затем два антитела смешиваются вместе, давая конечную концентрацию, эквивалентную концентрации, используемой для измерения отдельных антител. Антитела, распознающие различные эпитопы, показывают значительное дополнительное возрастание связанных RU, когда вводятся вместе, тогда как антитела, распознающие идентичные эпитопы, показывают только минимальное возрастание RU. Антитела можно называть перекрестно-реактивными, если, когда их «вводят» одновременно, они показывают значительное дополнительное возрастание (например, возрастание по меньшей мере в приблизительно 1,4 раза, возрастание по меньшей мере в приблизительно 1,6 раза, или возрастание по меньшей мере в приблизительно 1,8 или 2).

Эпитопы антител также могут быть установлены множеством других стандартных техник (см., например, Geysen et al (1987) J. Immunol. Meth 102:259-274). Эта техника включает синтез большого числа перекрывающихся пептидов EphA2 или CD44. Синтезированные пептиды затем скринируются против одного или нескольких прототипичных антител (например, 2D6 и так далее) и по специфичности связывания и аффинности могут быть идентифицированы характерные эпитопы, специфически связываемые этими антитипами. Эпитопы, идентифицированные таким образом, могут быть беспрепятственно использованы для конкурентных анализов, как описано в настоящей заявке, для идентификации перекрестно-реагирующих антител.

Пептиды для эпитопного картирования могут быть беспрепятственно приготовлены с использованием «Multipin» технологий пептидного синтеза (см., например, Geysen et al (1987) Science 235:1184-1190). С использованием известной последовательности одного или более EphA2 и/или CD44, частично перекрывающиеся полипептидные последовательности могут синтезироваться индивидуально последовательным образом на пластиковых штырьках на матрице одного или более 96-луночном(ых) планшете(ах) для микроанализа.

Анти-CD44

Антитела настоящего изобретения включают те, которые специфично связываются с CD44. Анти-CD44 антитела охватывают те, которые конкурентно связываются с эпитопом (например, в домене 1) из CD44 с F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3. Эпитоп, с которым связываются анти-CD44 антитела находится в протяженной аминокислотной последовательности CD44 от остатка в позиции 21 до 169, как указано ниже.

QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFE TCRYGFIEGHWIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLP NAFDGPITITIVNRDGTRYVQKGEYRTNPEDIY (SEQ ID NO:1)

Номера позиций остатков CD44 определяются на основе последовательности, представленной в CDRs GenBank No. NP_000601.3 или UniProt под номером доступа No. Р16070.

Антигены, которые имеют эпитопы, сходные с CD44, также могут быть мишенями для связывания антителами по изобретению. При связывании с CD44, антитело по изобретению может быть интернализировано клеткой, экспрессирующей CD44 белок.

Эпитопы, к которым анти-CD44 антитела имеют аффинность, экспонируются на клеточной поверхности многих раковых клеткок, особенно на плазматической мембране клеток, и доступны растворителям. Эпитопы могут быть доступны для антител по изобретению, если клетки живые. Например, эпитопы могут присутствовать на раковых клетках, происходящих из раков молочной железы, раков ободочной кишки, аденомы, плоскоклеточной карциномы головы и шеи (HNSCC), раков простаты, раков поджелудочной железы и так далее. Раковые клетки, к которым анти-CD44 антитела имеют аффинность, также могут быть из любого рака, который является метастазирующим и/или обладает потенциалом к метастазированию.

Дополнительные примеры антител по изобретению охватывают те, которые имеют такую же специфичность связывания и содержат по меньшей мере два CDR, каждый из которых независимо разделяет по меньшей мере приблизительно 80%, по меньшей мере приблизительно 87%, по меньшей мере приблизительно 93%, по меньшей мере приблизительно 94% или до 100% идентичности аминокислотной последовательности с аминокислотной последовательностью VH CDR антител, показанных на фигурах 7, 44 и 45 (45А и 45В) и в таблицах ниже (например. VH CDR1 из F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3). Антитело по изобретению также может включать все три CDR из любого VH CDR каждого антитела, показанного на фигурах 7, 44 и 45, таким образом, что каждый VH CDR в антителе по изобретению выбирается из одного антитела, показанного на фигурах 7, 44 и 45, или в таблицах ниже (например, таблица 1) и каждый VH CDR независимо разделяет по меньшей мере приблизительно 80%, по меньшей мере приблизительно 87%, по меньшей мере приблизительно 93%, по меньшей мере приблизительно 94% или до 100% идентичности аминокислотной последовательности с аминокислотной последовательностью VH CDR антитела, показанного на фигурах 7, 44 или 45 или в таблицах ниже (например, таблица 1). Например, тяжелая цепь антитела по изобретению может содержать два VH CDR или все три VH CDR из F2-1A6. Альтернативно, тяжелая цепь может содержать два VH CDR или все три VH CDR из F2-1H9. Как дополнительные примеры, тяжелая цепь антитела по изобретению может содержать два VH CDR или все три VH CDR любого одного из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 и HH3.

Сходным образом для легкой цепи, антитело по изобретению будет иметь такую же специфичность связывания, и может содержать по меньшей мере два CDR, каждый из которых независимо имеет аминокислотную последовательность, по меньшей мере приблизительно на 80%, по меньшей мере приблизительно на 87%, по меньшей мере приблизительно на 93%, по меньшей мере приблизительно на 94% или до 100% идентичную аминокислотной последовательности VL CDR каждого антитела, показанного на фигурах 7, 44 и 45 (45А и 45В) или в таблицах ниже (например VL CDR1 из F2-1A6; например, VL CDR1 из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3). Антитело по изобретению может также или альтернативно включать все три VL CDR из любого из антител, показанных на фигурах 7, 44 и 45, или в таблицах ниже (например, таблица 2) и каждый VL CDR независимо разделяет по меньшей мере приблизительно 80%, по меньшей мере приблизительно 87%, по меньшей мере приблизительно 93%, по меньшей мере приблизительно 94% или до 100% идентичности аминокислотной последовательности с аминокислотной последовательностью VL CDR антитела, показанного на фигурах 7, 44 или 45, или в таблицах ниже. Например, легкая цепь антитела по изобретению может содержать два VL CDR или все три VL CDR из F2-1A6. Альтернативно, легкая цепь может содержать два VL CDR или все три VL CDR из F2-1H9. Как дополнительные примеры, легкая цепь антитела по изобретению может содержать два VL CDR или все три VL CDR из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3.

Необязательно, антитела могут содержать такие же (т.е. на 100% идентичные), подобные или отличные каркасные последовательности (FR) в любой из соответствующих каркасных последовательностях в тяжелой или легкой цепи, представленной на фигурах 7, 44 и 45 или в таблицах ниже (например, таблицы 1 и 2, ниже), при условии, что специфичность связывания по существу сохраняется. Если каркасные последовательности подобны, каркасная последовательность может быть по меньшей мере приблизительно на 85%, по меньшей мере приблизительно на 86%, по меньшей мере приблизительно на 90%, по меньшей мере приблизительно на 93%, по меньшей мере приблизительно на 96%, по меньшей мере приблизительно на 98% или до 100% идентична соответствующей каркасной последовательности в любом из антител, показанных на фигурах 7, 44 и 45 или в таблицах ниже (например, таблицы 1 и 2, ниже).

Антитело настоящего изобретения может, следовательно, содержать полноразмерную VH и/или полноразмерную VL последовательность, которая по меньшей мере на 80% идентична, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, до 100% идентична аминокислотной последовательности полноразмерной VH или VL последовательности, показанной на фигурах 7, 44 или 45 или в таблицах ниже. Например, антитело по изобретению может содержать полноразмерный VH и/или полноразмерный VL из F2-1A6. Альтернативно, антитело по изобретению может содержать полноразмерный VH и/или полноразмерный VL из F2-1H9. Как дополнительные примеры, антитело по изобретению может содержать полноразмерный VH и/или полноразмерный VL из Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3. Примеры антител настоящего изобретения, которые связываются с CD44, перечислены в таблицах ниже (например, таблицы 1 и 2).

Таблица 1. Rs и CDRs тяжелой цепи антител, которые специфически связываются с CD44
Клон VH FR1 VH CDR1 VH FR2
Клон VH FR1 VH CDR1 VH FR2
F2-1A6 QVQLVQSGAEVKKPGESLKISCKGSGYSFT (SEQ ID NO:2) SYWIG (SEQ ID NO:3) WVRQMPGKGLEWMG (SEQ ID NO:4)
F2-1H9 QVQLQESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:5) SYRMH (SEQ ID NO: WVRQAPGKGLEWVA (SEQ ID NO:7)
D1C5 QVQLQQSGGGVVQPGRSLRLSCAASGFTFS (SEQ ID NO:28) SYGIH (SEQ ID NO:36) WVRQAPGKGLEWVA SEQ ID NO:7)
D1D1 QVQLVESGGGLVKPGGSLRLSCAASGFTFS (SEQ ID NO:24) TYTMS (SEQ ID NO:65) WARQAPGKGLEWVS (SEQ ID NO:21)
НВ8 QVQLVESGGGWQPGRSLRLSCAASGFTFS (SEQ ID NO:131) NYAMI (SEQ ID NO:132) WVRQAPGKGLEWVS (SEQ ID NO:133)
НС2 QVQRVESGGGVVQPGRSLRLSCAASGFTFS (SEQ ID NO:134) SYAMS (SEQ ID NO:32) WVRQAPGKGLEWVS (SEQ ID NO:133)
НС4 QVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:74) TLAMG (SEQ ID NO:33) WVRQAPGKGLEWVS (SEQ ID NO:133)
НЕ3 QVQLQESGGGLVKPGGSLRLSCEASGFTFS (SEQ ID NO:433) SYSMN (SEQ ID NO:37) WVRQAPGKGLEWVS (SEQ ID NO:133)
HF1 QVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:74) NYALI (SEQ IDNO:78) WVRQAPGKGLEWVS (SEQ ID NO:133)
HH3 QVQLQESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:5) SYAMS (SEQ ID NO:32) WVRQAPGKGLEWVS (SEQ ID NO:133)
Е8Н11 QVQLVESGGGWQPGRSLRLSCAASGFTFS (SEQ ID NO:131) SYGMH (SEQ ID NO:41) WVRQAPGKGLEWVA (SEQ ID NO:7)
Е8Н7 QVQLQESGGGLVQPGGSLRLSCSASGFTFS (SEQ ID NO:180) SYAMH (SEQ ID NO:29) WVRQAPGKGLEYVS (SEQ ID NO:181
E8G12 QVQLVQSGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:182) SYAMS (SEQ ID NO:32) WVRQAPGKGLEWVS (SEQ ID NO:133)
E8F11 QVQLQQSGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:183) SYAMS (SEQ ID NO:32) WVRQAPVKGLEWVS (SEQ ID NO:184)
Е8С9 QVNLRESGGGLVKPGGSLRLSCAASGFTFS (SEQ ID NO:185) SYAMS (SEQ ID NO:32) WVRQAPGKGLEWVS (SEQ ID NO:133)
D6G9 QVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:74) SYAMG (SEQ ID NO:186) WVRQAPGKGLEWVS (SEQ ID NO:133)
D6D3 QVQLQESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:5) SYAM(SEQ ID NO:32) WVRQAPGKGLEWVS (SEQ ID NO:133)
Клон VH CDR2 VH FR3
F2-1A6 IIYPGDSDTRYSPSFQG (SEQ ID NO:8) QVTISADKSISTAYLQWSSLKASDTAMYYCAR (SEQ ID NO:9)
Клон VH CDR2 VH FR3
F2-1H9 AVKQDGSEKYYLDSVKG (SEQ ID NO:10) RFTISRDNAKSSLYLQMDSLSVEDTAVYYCAR (SEQ ID NO:11)
D1C5 VISYDGSNKYYADSVKG (SEQ ID NO:45) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK (SEQ ID NO:50)
D1D1 AISADGAGTYYGDSVKG (SEQ ID NO:82) RFTVSRDNFKSTLYLQMNRLRAEDTAVYYCAK (SEQ ID NO:139)
НВ8 AITGGGGSTYYADSVKG (SEQ ID NO:140) RFTISRDNSKNTLYLQMNSLRAEDTALYYCAK (SEQ ID NO:141)
НС2 AISGSGGSTYYADSVKG (SEQ ID NO:142) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK (SEQ ID NO:50)
НС4 AISGSGGSTYYADSVKG (SEQ ID NO:142) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:46)
НЕ3 AISGSGGSTYYADSVKG (SEQ ID NO:142) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK (SEQ ID NO:50)
HF1 AISGSGSGTYYADSVKG (SEQ ID NO:143) RFTISRDNSKNTLYLQMNTLRAEDTALYYCAK (SEQ ID NO:144)
HH3 AITS SGGRTYYADSVRG (SEQ ID NO:145) RLTISRDNSKNTLYLQMNTLRAEDTAVYYCAK (SEQ ID NO:146)
Е8Н11 VISYDGSNKYYADSVKG (SEQ ID NO:45) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK (SEQ ID NO:50)
Е8Н7 AISSNGGSTYYADSVKG (SEQ ID NO:187) RFTISRDNSKNTLYLQMSSLRAEDTAVYYCVA (SEQ ID NO:188)
H8G12 AISGSGGSTYYADSVKG (SEQ ID NO:142) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK (SEQ ID NO:50)
E8F11 AISGSGGSTYYADSVKG (SEQ ID NO:142) RFTISRDNSKNTLYLQMNSLRIEDTAVYYCGR (SEQ ID NO:189)
Е8С9 VIS-DGSTTYYADSVKG (SEQ ID NO:190) RFTISRDNSKNMLYLQTNSLRAEDTAVYYCAK (SEQ ID NO:191)
D6G9 AISASGGSTYYADSVKG (SEQ ID NO:192) RFTISRDNSKNTLYLQLNSLRAEDTAVYYCAK (SEQ ID NO:193)
D6D3 AITSSGGRTYYADSVRG (SEQ ID NO:145) RLTISRDNSKNTLYLQMNTLRAEDTAVYYCAK (SEQ ID NO:146)
Клон VH CDR3 VH FR4
F2-1A6 RLHGPFYFDY (SEQ ID NO:12) WGQGTLVTVSS (SEQ ID NO:13)
F2-1H9 GLRT (SEQ ID NO:14) MGQGTLVTVSS (SEQ ID NO:15)
D1C5 GYGSGSYWSGAFDI (SEQ ID NO:147) WGQGTMVTVSS (SEQ ID NO:43)
D1D1 LGGESYSAD WGQGTLVTVSS
Клон VH CDR3 VH FR4
(SEQ ID NO:148) (SEQ ID NO:13)
НВ8 TLGRSTVATDY (SEQ ID NO:149) WGQGTLVTVSS (SEQ ID NO:13)
НС2 GPGAAQDY (SEQ ID NO:150) WGQGTLVTVSS (SEQ ID NO:13)
НС4 GAVGATTAFDY (SEQ ID NO:151) WGQGTLVTVSS (SEQ ID NO:13)
НЕ3 VASSSSLGMDV (SEQ ID NO:152) WGQGTTVTVSS (SEQ ID NO:153)
HF1 SWGATSLDY (SEQ ID NO:154) WGQGTLVTVSS (SEQ ID NO:13)
HH3 GIVGATAFDY (SEQ ID NO:155) WGQGTLVTVSS (SEQ ID NO:13)
Е8Н11 DYGYCSGGSCYSPFDY (SEQ ID NO:194) WGQGTLVTVSS (SEQ ID NO:13)
Е8Н7 RLEWL-----PLAWDY (SEQ ID NO:195) WGQGTLVTVSS (SEQ ID NO:13)
E8G12 AARIAAR---PGPLDY (SEQ ID NO:196) WGQGTLVTVSS (SEQ ID NO:13)
E8F11 H--LSSG----SSVDY (SEQ ID NO:197) WGQGTLVTVSS (SEQ ID NO:13)
Е8С9 AGPRTTV----TTVDS (SEQ ID NO:198) WGQGTLVTVSS (SEQ ID NO:13)
D6G9 GLKDSSG------FDY (SEQ ID NO:199) WGQGTLVTVSS (SEQ ID NO:13)
D6D3 GIVGATA------FDY (SEQ ID NO:155) WGQGTLVTVSS (SEQ ID NO:13)
Таблица 2. Rs и CDRs легкой цепи антител, которые специфически связываются с CD44
Клон VL FR1 VL CDR1 VL FR2
F2-1А6 SELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPLLVIY (SEQ ID NO:18)
F2-1Н9 SELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLRSYYAS (SEQ ID NO:17) WYQRKPGQAPLLVIY (SEQ ID NO:19)
D1C5 EIVLTQSPLSLPVTPGEPASISC (SEQ ID NO:156) RSSQSLLHTNGYNYLD (SEQ ID NO:157) WYLQKPGQSPQLLIY (SEQ ID NO:158)
D1D1 HVILTQDPAVSVALGQTVKITC (SEQ ID NO:159) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPLLVLY (SEQ ID NO:160)
НВ8 SELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
НС2 QSVLTQDPAVSVALGQTVTITC (SEQ ID NO:161) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
НС4 SELTQDPAVSVALGQTVKITC (SEQ ID NO:51) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
НЕ3 SELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
HF1 QSVLTQDPAVSVALGQTVRITC (SEQ ID NO:162) QGDSLRDYYAS (SEQ ID NO:163) WYKQKPGQAPLLVFF (SEQ ID NO:164)
HH3 SELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
Е8Н11 NFMLTQDPAVSVALGQTVRITC (SEQ ID NO:200) QGDSLRS---YYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
Клон VL FR1 VL CDR1 VL FR2
Е8H7 S-ELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLRS---YYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
E8G12 S-ELTQDPAVSVALGQTVRITC (SEQ ID NO:201) QGDSLRN---YYAS (SEQ ID NO:202) WYQQKPRQAPVLVIY (SEQ ID NO:203
E8F11 -SELTQPPSASGSPGQSVTISC (SEQ ID NO: 204) TGTSSDVGGYNYVS (SEQ ID NO:205) WYQQRPGYAPKLMIY (SEQ ID NO:206)
Е8С9 QSVLTQPPSVSGAPGQRVTISC (SEQ ID NO:207) TGSSSNIGAGYDVH (SEQ ID NO:213) WYQQLPGTAPKLLTY (SEQ ID NO:209)
D6G9 NFMLTQDPAVSVALGQTVRITC (SEQ ID NO:200) QGDSLRS---YYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
D6D3 S-ELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLRS---YYAS (SEQ ID NO:17) WYQQKPGQAPVLVIY (SEQ ID NO:70)
Клон VL cdr2 VL FR3
F2-1A6 GKNIRPS (SEQ ID NO:20) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
F2-1H9 GKNIRPS (SEQ ID NO:20) GIPDRFSGSSSGNTASLIITGAQAEDEADYYC (SEQ ID NO:21)
D1C5 LGSNRAS (SEQ ID NO:165) GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC (SEQ ID NO:166)
D1D1 GENNRPS (SEQ ID NO:71) GIPDRFSGSGSGNTASLTITGAQAEDEADYYC (SEQ ID NO:167)
HB8 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
HC2 GKNNRPS (SEQ ID NO:168) GIPDRFSGS S SGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
HC4 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
НЕ3 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGARAEDEADYYC (SEQ ID NO:169)
HF1 GKSNRPS (SEQ ID NO:170) GIPNRFSGSTSGSTATLTVTGAQAEDEADYFC (SEQ ID NO:171)
HH3 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
E8H11 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
E8H7 GKNNRPS (SEQ ID NO:168) GIPDRFSGS S SGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
E8G12 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
E8F11 DVSNRPS (SEQ ID NO:210) GVSNRFSGSKSGNSASLDISGLQSEDEADYYC (SEQ ID NO:211)
Е8С9 GNSNRPS (SEQ ID NO:212) GVPDRFSGSKSGTSASLAITGLQAEDEADYYR (SEQ ID NO:213)
D6C9 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
D6D3 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
Клон VL CDR3 VL FR4
F2-1A6 NSRDSSGNHW (SEQ ID NO:22) FGGGTKLTVLG (SEQ ID NO:27)
F2-1H9 NSRDSSANQM (SEQ ID NO:23) FGGGTKLTVLG (SEQ ID NO:27)
D1C5 MQGRQSPLT FGGGTKVEIKR
Клон VL CDR3 VL FR4
(SEQ ID NO:172) (SEQ ID NO:84)
D1D1 HSRDSSGKYV (SEQ ID NO:173) FGVGTKVTVLG (SEQ ID NO:174)
HB8 NSRDSSGNPHW (SEQ ID NO:175) FGGGTKLTVLG (SEQ ID NO:27)
НС2 NSRDSSGNHW (SEQ ID NO:23) FGGGTKVTVLG (SEQ ID NO:80)
НС4 NSRDSSGNHLV (SEQ ID NO:176) FGGGTKLTVLG (SEQ ID NO:27)
НЕ3 TSRDSSGKQLV (SEQ ID NO:177) FGGGTKLTVLG (SEQ ID NO:27)
HF1 SSRDSSGRLIL (SEQ ID NO:178) FGGGTKLTVLG (SEQ ID NO:27)
HH3 NSRDSSGNSW (SEQ ID NO:179) FGGGTKVTVLG (SEQ ID NO:80)
Е8Н11 HSRDSSGN-YL (SEQ ID NO:214) FGGGTKLTVLG (SEQ ID NO:27)
Е8Н7 NSRDSSGNHKV (SEQ ID NO:215) FGGGTKLTVLG (SEQ ID NO:27)
E8G12 NSRDRSNNHLL (SEQ ID NO:216) FGGGTKLTVLG (SEQ ID NO:27)
E8F11 AAWDDSLREFL (SEQ ID NO:217) FGTGTKVTVLG (SEQ ID NO:218)
Е8С9 SAWDSSLFNWV (SEQ ID NO:219) FGGGTKLTVLG (SEQ ID NO:27)
D6G9 NSRDSSAKRW (SEQ ID NO:220) FGGGTKVTVLG (SEQ ID NO:80)
D6D3 NSRDSSGNSW (SEQ ID NO:179) FGGGTKVTVLG (SEQ ID NO:80)

Анти-EphA2

Антитела настоящего изобретения включают те, которые специфически связываются с EphA2. Анти-EphA2 антитела охватывают те, которые конкурентно связываются с эпитопом (например, на внеклеточном домене) EphA2 с 2D6, D2-1A7, D2-1А9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Эпитоп, с которым связывается анти-EphA2 антитела, находится в протяженной аминокислотной последовательности EphA2 от остатка в позиции 25 до 534, как изложено ниже.

Положения остатков EphA2 определены на основе последовательности, представленной в под номером доступа GenBank No. NP_004422.2 или под номером доступа UniProt No. P29317.

Анти-EphA2 антитела также охватывают те, которые конкуретно связываются с лиганд связывающим сайтом EphA2. Например, антитела 2D6, D2-1A7 и D2-1A9 конкурируют с Эфрин А1, природным лигандом EphA2, за связывание с EphA2. Таким образом, антитела по изобретению также могут конкурировать с Эфрин А1 за связывание с эпитопом EphA2.

Антигены, которые содержат эпитопы, которые подобны эпитопам EphA2, также могут быть связывающимися мишенями антител по изобретению. При связывании с антигеном на клеточной поверхности (например, EphA2), некоторые из антител по изобретению будут интернализироваться клеткой.

Эпитопы, к которым анти-EphA2 антитела имеют аффинность, экспонируются на клеточной поверхности, особенно на плазматической мембране клеток, у многих раковых клетках и доступны растворителю. Эпитопы могут быть доступны антителам по изобретению, пока клетки живы. Раковые клетки могут включать те, которые происходят из тканей эпителия. Например, эпитопы могут находиться на раковых клетках, полученных из раков молочной железы, раков кожи (например, меланомы), раков легких, раков простаты, раков кишечника, и/или раков яичника. Другие раки, к которым анти-EphA2 антитела имеют аффинность, могут быть, например, раком печени, плоскоклеточной карциномой пищевода, эпидермоидным раком, раком поджелудочной железы, глиобластомами, нейробластомами и/или другими раками нервной системы.

Дополнительные примеры антител по изобретению охватывают те, которые имеют такую же специфичность связывания и содержат по меньшей мере два CDR, каждый из которых независимо разделяет по меньшей мере приблизительно 80%, по меньшей мере приблизительно 87%, по меньшей мере приблизительно 93%, по меньшей мере приблизительно 94% или до 100% идентичности аминокислотной последовательности с аминокислотной последовательностью VH CDR антител, показанных на фигурах 8, 46 и 47, и в таблицах ниже (например, VH CDR1 из 2D6; или VH из CDR1 из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11). Антитело по изобретению может также включать все три CDR из любого VH любого антитела, показанного на фигурах 8, 46 и 47, так что каждый VH CDR в антителе по изобретению выбирается из одного антитела, показанного на фигурах 8, 46 или 47 или в таблицах ниже (например, Таблица 3) и каждый VH CDR независимо разделяет по меньшей мере приблизительно 80%, по меньшей мере приблизительно 87%, по меньшей мере приблизительно 93%, по меньшей мере приблизительно 94% или до 100% идентичности аминокислотной последовательности с аминокислотной последовательности соответствующего VH CDR антитела, показанного на фигурах 8, 46 и 47 или в таблицах ниже. Например, тяжелая цепь антитела по изобретению может содержать по меньшей мере два VH CDR или все три VH CDR из 2D6. Альтернативно, тяжелая цепь может содержать по меньшей мере два VH CDR или все три VH CDR of D2-1A7. Другие примеры включают тяжелую цепь, которая содержит по меньшей мере два VH CDR или все три VH CDR из D2-1A9 и тяжелую цепь, которая содержит по меньшей мере два VH CDR или все три VH CDR из D2-1B1. В других примерах, тяжелая цепь антитела по изобретению может содержать по меньшей мере два VH CDR или все три VH CDR из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11.

Сходным образом для легкой цепи, антитело по изобретению может содержать по меньшей мере два CDR, каждый из которых независимо разделяет по меньшей мере примерно 80%, по меньшей мере приблизительно 87%, по меньшей мере приблизительно 93%, по меньшей мере приблизительно 94% или до 100% идентичности аминокислотной последовательности с аминокислотной последовательностью VL CDR антитела, показанного на фигурах 8, 46 или 47 или в таблицах ниже (например, VL CDR1 of 2D6; или VL из CDR1 из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11). Антитело по изобретению может также или альтернативно включать все три VL CDR из любого из антител, показанных на фигурах 8, 46 и 47 или в таблицах ниже (например, таблица 4) и каждый VL CDR независимо разделяет по меньшей мере приблизительно 80%, по меньшей мере приблизительно 87%, по меньшей мере приблизительно 93%, по меньшей мере приблизительно 94% или до 100% идентичности аминокислотной последовательности с аминокислотной последовательностью VL CDR антитела, показанного на фигурах 8, 46 или 47 или в таблицах ниже. Например, легкая цепь антитела по изобретению может содержать два VL CDR или все три VL CDR из 2D6. Альтернативно, легкая цепь может содержать два VL CDR или все три VL CDR of D2-1A7. Другие примеры включают легкую цепь, которая содержит два VL CDR или все три VL CDR из D2-1A9 и легкую цепь, которая содержит два VL CDR или все три VL CDR из D2-1B1. Как дополнительные примеры, легкая цепь антитела по изобретению может содержать два VL CDR или все три VL CDR из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11.

Необязательно, антитела могут содержать точно такие же (т.е. на 100% идентичные), подобные или отличные каркасные последовательности (FR) любой из соответствующих каркасных последовательностей в тяжелой или легкой цепи, приведенных на фигурах 8, 46 и 47 или в таблицах ниже (например, таблицы 3 и 4). Если каркасные последовательности являются подобными, каркас может быть по меньшей мере приблизительно на 85%, по меньшей мере приблизительно на 86%, по меньшей мере приблизительно на 90%, по меньшей мере приблизительно на 93%, по меньшей мере приблизительно на 96%, по меньшей мере приблизительно на 98% или до 100% идентичен соответствующей каркасной последовательности в любом из антител, показанных на фигурах 8, 46 и 47 или в таблицах ниже.

Антитело настоящего изобретения может, следовательно, содержать полноразмерную VH и/или полноразмерную VL последовательность, которая по меньшей мере на 80% идентична, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, до 100% идентична по аминокислотной последовательности полноразмерной VH или VL последовательности, показанной на фигурах 8, 46 или 47 или в таблицах ниже. Например, антитело по изобретению может содержать полноразмерный VH и/или полноразмерный VL из 2D6. Альтернативно, антитело по изобретению может содержать полноразмерный VH и/или полноразмерный VL из D2-1A7. Другие примеры включают антитело, содержащее полноразмерный VH и/или полноразмерный VL из D2-1А9 и антитело, содержащее полноразмерный VH и/или полноразмерный VL из D2-1B1. Другие примеры включают антитело, содержащее полноразмерный VH и/или полноразмерный VL из А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Примеры антител настоящего изобретения, которые связываются с EphA2, перечислены в таблицах ниже.

Таблица 3. FRs и CDRs тяжелой цепи антител, которые специфически связываются с EphA2
клон VH FR1 VH CDR1 VH FR2
2D6 QVQLQESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:5) SYAMS (SEQ ID NO:32) WVRQAPGKGLDWVS (SEQ ID NO:53)
D2-1A7 QVQLQQSGGGVVQPGRSLRLSCAASGFTFS (SEQ ID NO:25) SYAMH (SEQ ID NO:26) WVRQAPGKGLEWVA (SEQ ID NO:7)
D2-1А9 QVQLVESGGGLIQPGGSLKLSCAASGFTVS (SEQ ID NO:27) NSYMS (SEQ ID NO:28) WVRQAPGKGLEWVA (SEQ ID NO:7)
D2-1B1 QVQLQESGGGVVQPGRSLRLSCAASGFTFS (SEQ ID NO:54) SYGMH (SEQ ID NO:41) WVRQAPGKGLEWVA (SEQ ID NO:7)
А3Н9 QVLLVESGGGVVQAGASLRVSCAASGFSLT (SEQ ID NO:126) SYGMH (SEQ ID NO:41) WVRQAPGKGLEWVA (SEQ ID NO:7)
клон VH FR1 VH CDR1 VH FR2
A3G3 QVQLVESGGGVVQPGRSLRLSCAASGFTFS (SEQ ID NO:131) SYAMG (SEQ ID NO:186) WVRQAPGKGLEWVA (SEQ ID NO:7)
A3D10 LVQLVQSGGGLVKPGGSLRLSCAASGFTFS (SEQ ID NO:434) TYSMN (SEQ ID NO:222) WVRQAPGKGLEWVS (SEQ ID NO:133)
A3D1 QVQLVQSGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:182) SYGMH (SEQ ID NO:41) WVRQAPGKGLEWVA (SEQ ID NO:7)
A3C8 QLQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:223) SYAMN (SEQ ID NO:224) WVRQAPGKGLEWVS (SEQ ID NO:133)
1А3 QVQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO:225) SNSAA (SEQ ID NO:226) WNWIRQSPSRGLEWLG (SEQ ID NO:227)
1А5 QVQLQESGGGVVQPGGSLRLSCAASGFTFS (SEQ ID NO:228) NYAMH (SEQ ID NO:229) WVRQAPGKGLEYVS (SEQ ID NO:181)
1А8 QVQLQQSGGGLVQPGGSLRLSCSASGFTFS (SEQ ID NO:230) NYAIH (SEQ ID NO:231) WVRQAPGKGLEYVS (SEQ ID NO:181)
1А12 QVQLQESGGGLVQPGGFLRLSCAASGFTFS (SEQ ID NO:232) SYGMH (SEQ ID NO:41) WVRQTPGKGLEWVS (SEQ ID NO:233)
1В2 QVQLVESGGGVVQPGRSLRLSCAASGFTFS (SEQ ID NO:131) SYGMH (SEQ ID NO:41) WVRQAPGKGLEWVA (SEQ ID NO:7)
1С2 QVQLQESGGGLVKPGGSLRLSCAGSGFIFN (SEQ ID NO:234) TYSMN (SEQ ID NO:222) WVRQSPGKGLEWVS (SEQ ID NO:235)
1С7 QVQLVESGGGWQPGRSLRLSCAASGFTFS (SEQ ID NO:131) SYGMH (SEQ ID NO:41) WVRQAPGKGLEWVS (SEQ ID NO:133)
1D8 QVQLVESGGGLIQPGGSLRLSCAASGFTVS (SEQ ID NO:236) SNYMS (SEQ ID NO:237) WVRQAPGKGLEWVS (SEQ ID NO:133)
клон VH CDR2 VH FR3
2D6 IIYNGDNTYYADSVKG (SEQ ID NO:29) RFTISRDNSKNSLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:30)
D2-1A7 VISYDGSNKYYADSVKG (SEQ ID NO:45) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:46)
D2-1A9 VIYSAGNTYYADSVKG (SEQ ID NO:31) RFTISRDTSNNTVHLQMNSLRPEDTAVYYCAR (SEQ ID NO:32)
D2-1B1 VISYDGSNKYYADSVKG (SEQ ID NO:45) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK (SEQ ID NO:50)
A3H9 FISSDGSDKYYVDSVKG (SEQ ID NO:238) RFTISRDTSKNMMYLQMNSLTTEDTAVYYCAK (SEQ ID NO:239)
A3G3 VIYRDGHGYYADSVKG (SEQ ID NO:240) RFTVSRDSSENTVYLQMNSLRAEDTAIYYCAS (SEQ ID NO:241)
A3D10 SISSSSSYIYYADSVKG (SEQ ID NO:242) RFTISRDNANNSLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:243)
клон VH CDR2 VH FR3
A3D1 VIWYDGSNKYYADSVKG (SEQ ID NO:244) RFTISRDNSRNTLYLEMNSLRAEDTAVYYCVK (SEQ ID NO:245)
A3C8 AISGSGGNTYYADSVKG (SEQ ID NO:246) RFTISRDNSNNALYLQMNSLRVEDTAVYYCAR (SEQ ID NO:247)
1А3 RTYYRSKWYNDYAVSVKS (SEQ ID NO:248) RITINPDTSKNLFSLQLNSVTPEDTALYYCAR (SEQ ID NO:249)
1А5 SISSNGGGTYYADSVKG (SEQ ID NO:250) RFTISRDDAKNTLYLQLNSLRDEDTAVYYCAK (SEQ ID NO:251)
1А8 AINSNGGSTYYADSVKG (SEQ ID NO:252) RSIISRDNSMNTVYLQMSSLRAEDTAVYYCVK (SEQ ID NO:253)
1А12 YISSSSSYTNYADSVKG (SEQ ID NO:254) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:46)
1В2 VISYDGSNKYYADSVKG (SEO ID NO:45) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:46)
1С2 STGGSGKNTFYADSVRG (SEO ID NO:255) RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:256)
1С7 YISSSGSYTNYADSVKG (SEQ ID NO:257) RFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK (SEQ ID NO:258)
1D8 VIYSGGSTYYADSVKG (SEO ID NO:259) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:46)
клон VH CDR3 VH FR4
2D6 WSGTSYDY (SEQ ID NO:62) WGQGTLVTVSS (SEQ ID NO:13)
D2-1A7 ASVGATGPFDI (SEQ ID NO:33) WGQGTMVTVSS (SEQ ID NO:34)
D2-1A9 EGSFGYDY (SEQ ID NO:35) RGQGTLVTVSS (SEQ ID NO:75)
D2-1B1 VIAGGAYYGSADY (SEQ ID NO:76) WGQGTLVTVSS (SEQ ID NO:13)
A3H9 DWGSNWYLFDY (SEQ ID NO:260) WGQGTLVTVSS (SEQ ID NO:13)
A3G3 HDYAGNPAGSASGY (SEQ ID NO:261) WGQGTLVTVSS (SEQ ID NO:13)
A3D10 GNTVAQRLDVFDY (SEQ ID NO:262) WGQGTLVTVSS (SEQ ID NO:13)
A3D1 DRQPDGRWPFDL (SEQ ID NO:263) WGQGTLVTVSS (SEQ ID NO:13)
A3C8 DASYYADDY (SEQ ID NO:264) WGQGTLVTVSS (SEQ ID NO:13)
1А3 EEDYSGFQH (SEQ ID NO:265) WGQGTLVTVSS (SEQ ID NO:13)
1А5 DYFGSIDY (SEQ ID NO:266) WGQGTLVTVSS (SEQ ID NO:13)
1А8 EENGSGFDS (SEQ ID NO:267) WGQGTLVTVSS (SEQ ID NO:13)
1А12 DNWYFDL (SEQ ID NO:268) WGRGTLVTVSS (SEQ ID NO:269)
1В2 ALYYDEALDY (SEQ ID NO:270) WGQGTLVTVSS (SEQ ID NO:13)
1С2 EDSSGSFDY (SEQ ID NO:271) WGQGTLVTVSS (SEQ ID NO:13)
1С7 VRGWDGDYLDY (SEQ ID NO:272) WGQGTLVTVSS (SEQ ID NO:13)
1D8 GGFSGYDYFDY WGQGTLVTVSS
(SEQ ID NO:273) (SEQ ID NO:13)
Таблица 4. FRs и CDRs легкой цепи антител, которые специфически связываются с EphA2
клон VL FR1 VL CDR1 VL FR2
2D6 SELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPLLVIY (SEQ ID NO:18)
D2-1А7 SELTQDPAVSVALGQTVSITC (SEQ ID NO:36) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPLLVIY (SEQ ID NO:18)
D2-1А9 DIVMTQSPGTLSLSPGERATLSC (SEQ ID NO:37) RASQSVSSSFLG (SEQ ID NO:38) WYQQKPGQAPRLLIY (SEQ ID NO:77)
D2-1В1 SELTQDPAVSVALGQTVKITC (SEQ ID NO:39) QGDSLRTYYAS (SEQ ID NO:40) WYQQKPGQAPVLVIY (SEQ ID NO:70)
А3Н9 SVLTQPPSASETPGQRVTISC (SEQ ID NO:291) SGSSSNIGANTVH (SEQ ID NO:292) WYQQFPGTAPKLLIY (SEQ ID NO:293)
A3G3 SALTQPASVSASPGQSITISC (SEQ ID NO:294) TGTSSDVGGYDYVS (SEQ ID NO:295) WYQQHPGKAPKLVMY (SEQ ID NO:296)
A3D10 SVLTQPPSVSGAPGQRVTISC (SEQ ID NO:297) TGGSSNVGAGFDVH (SEQ ID NO:298) WYQQLPGTAPKLLIY (SEQ ID NO:299)
A3D1 SALTQPASVSGSPGQSVTISC (SEQ ID NO:300) TGANSDLGGYNYVS (SEQ ID NO:301) WYQHHPAKAPKLIIY (SEQ ID NO:302)
A3C8 SELTQDPAVSVALGQTVRITC (SEQ ID NO:16) QGDSLKSYYAS (SEQ ID NO:303) WYQQKPGQAPVLVIY (SEQ ID NO:70)
1А3 QSALTQPASVSGSPGQSITISC (SEQ ID NO:304) TGTSSDVGGYNYVS (SEQ ID NO:205) WYQQHPGKAPKLMIY (SEQ ID NO:435)
1А5 PELTQDPAVSVALGQTVTITC (SEQ ID NO:436) QGDSLRSYYAS (SEQ ID NO:17) WYQQKPGQAPLLVIY (SEQ ID NO:18)
1А8 EIVLTQSPSSVSASVGDRVTITC (SEQ ID NO:437) RASQDISKWLA (SEQ ID NO:438) WYQQRPGKVPRLLIY (SEQ ID NO:439)
1А12 DVVMTQSPSTLSASVGDRVSITC (SEQ ID NO:440) RASESISRWLA (SEQ ID NO:441) WYQQKPGKAPKALIY (SEQ ID NO:442)
1В2 EIVLTQSPSSLSASVGDRVTITC (SEQ ID NO:443) RASQDMSRWLA (SEQ ID NO:444) WYQQKPGKAPKLLIH (SEQ ID NO:445)
1С2 DIQMTQSPSTLSASIGDRVTITC (SEQ ID NO:446) RASEGIYHWLA (SEQ ID NO:447) WYQQKPGKAPKLLIY (SEQ ID NO:448)
1С7 DIQMTQSPSLLSASVGDRVTITC (SEQ ID NO:449) RASQGINNYLA (SEQ ID NO:221) WYQQKPGKAPKLLIY (SEQ ID NO:448)
1D8 QSVLTQPPSVSGAPGQRVTISC (SEQ ID NO:207) TGSSSNIGAGYDVH (SEQ ID NO:208) WYQQLPGTAPKLLIY (SEQ ID NO:299)
клон VL CDR2 VL FR3
2D6 GENNRPS (SEQ ID NO:71) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
D2-1A7 GENNRPS (SEQ ID NO:71) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
D2-1A9 GASSRAT (SEQ ID NO:41) GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYC (SEQ ID NO:42)
D2-1B1 GENSRPS (SEQ ID NO:43) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
А3Н9 SYSQRPS (SEQ ID NO:395) GVPDRFSDSKSGTSASLAISGLQSEDEADYYC (SEQ ID NO:396)
A3G3 SHNQRSS GVPDRFSGSKSGNSASLDISGLQSEDEADYYR
клон VL CDR2 VL FR3
(SEQ ID NO:397) (SEQ ID NO:398)
A3D10 GDKNRPS (SEQ ID NO:399) GVPDRFSGSRSGTSASLAITGLQAEDEADYYC (SEQ ID NO:400)
A3D1 EVNNRPS (SEQ ID NO:401) GVSHRFSGSKSANTASLTISGLQAEDEADYYC (SEQ ID NO:402)
A3C8 GKNNRPS (SEQ ID NO:168) GIPDRFSGSSSGNTASLTITGAQAEDEADYYC (SEQ ID NO:23)
1А3 EGSKRPS (SEQ ID NO:403) GVPERFSGSNSGNTATLTIGRVEAGDEADYYC (SEQ ID NO:404)
1А5 GKNIRPS (SEQ ID NO:20) GIPDRFSGSSSGNSASLTITGAQAEDEADYYC (SEQ ID NO:405)
1А8 SASSLQS (SEQ ID NO:406) GVPSRFSGSGSGTDFTLTISSLQPEDFASYFC (SEQ ID NO:407)
1А12 KASSLES (SEQ ID NO:408) GVPSRFSGSGSATEFTLTINSLQPDDFATYYC (SEQ ID NO:409)
1В2 SASTLQS (SEQ ID NO:410) GVPSRFSGSGSGTEFTLTISSLQPEDFATYYC (SEQ ID NO:411)
1С2 KASSLAS (SEQ ID NO:412) GAPSRFSGSGSGTDFTLTISSLQPDDFATYYC (SEQ ID NO:413)
1С7 AASTLQS (SEQ ID NO:414) GVPSRFSGSGSGTEFTLTISGLQPEDFATYYC (SEQ ID NO:415)
1D8 VNSNRPS (SEQ ID NO:94) GVPDRFSGSKSGTSASLAITGLQAEDEADYYC (SEQ ID NO:95)
клон VL CDR3 VL FR4
2D6 HSRDSSGTHLRV (SEQ ID NO:79) FGGGTKVTVLG (SEQ ID NO:80)
D2-1A7 NSRDSSGTHLTV (SEQ ID NO:44) FGGGTKLTVLG (SEQ ID NO:27)
D2-1A9 QQYGISPLT (SEQ ID NO:45) FGGGTKVEIKR (SEQ ID NO:84)
D2-1B1 HSRDSSGTHLRV (SEQ ID NO:79) FGGGTKLTVLG (SEQ ID NO:27)
A3H9 AAWDDILNGWV (SEQ ID NO:274) FGGGTKVTVLG (SEQ ID NO:80)
A3G3 AAWDDSLSEFL (SEQ ID NO:275) FGTGTKLTVLG (SEQ ID NO:276)
A3D10 QAYDSSLRGSV (SEQ ID NO:277) FGGGTKLTVLG (SEQ ID NO:27)
A3D1 SSYRSGGTYV (SEQ ID NO:278) FGTGTKLTVLG (SEQ ID NO:276)
A3C8 HSRDSSGNHPVV (SEQ ID NO:279) FGGGTKVTVLG (SEQ ID NO:80)
1А3 QAWDSTSDHVV (SEQ ID NO:280) FGGGTKVTVLG (SEQ ID NO:80)
1А5 HSRDSSGTHLRV (SEQ ID NO:79) FGGGTKLTVLG (SEQ ID NO:27)
1А8 QQASVFPVT (SEQ ID NO:281) FGGGTKLEIKR (SEQ ID NO:282)
1А12 QQYSSYPLT (SEQ ID NO:283) FGQGTKVDIKR (SEQ ID NO:284)
1В2 QQLGVYPLT (SEQ ID NO:285) IGGGTKVEIKR (SEQ ID NO:286)
1С2 QQYHTISRT (SEQ ID NO:287) FGPXTKLEIKR (SEQ ID NO:288)
1С7 QNLNSYPLT (SEQ ID NO:289) FGGGTKVEIKR (SEQ ID NO:84)
1D8 QSYDSSLSGWV FGGGTKLTVLG
(SEQ ID NO:290) (SEQ ID NO:27)

Будет понятно, что аминокислотная последовательность CDR может также быть определена с использованием альтернативных систем, которые будут очевидны и использованы специалистами, имеющими стандартные навыки в данной области (см. "Sequences of Proteins of Immunological Interest," E. Kabat et al., U.S. Department of Health и Human Services, (1991 и Lefranc et al. IMGT, международная ImMunoGeneTics информационная система. Nucl. Acids Res., 2005, 33, D593-D597)). Детальное обсуждение IMGTS системы, включая то, по каким принципам разработана IMGTS система, и ее сравнение с другими системами, находится в World Wide Web на www(dot) imgt.cines.fr/ textes/ IMGTScientificChart/ Numbering/ IMGTnumberingsTable.html. Все аминокислотные последовательности CDR в настоящем изобретении определяются в соответствии с Kabat et al., supra, если не указано иное.

Вариабельные цепи, раскрытые здесь, могут быть связаны непосредственно или через линкер (например, (Gly4Ser)3, SEQ ID NO:81) для формирования одноцепочечного антитела. Детали, касающиеся линкеров, обсуждаются ниже.

Способ получения антител

С использованием информации, предоставленной в настоящей заявке, анти-CD44 и анти-EphA2 антитела настоящего изобретения получают с использованием стандартных техник, хорошо известных специалистам.

Например, последовательности нуклеиновых кислот, представленные на фигуре 9, могут быть использованы для экспрессии антител по изобретению. Альтернативно, полипептидные последовательности, предоставленные в настоящей заявке (см., например, таблицы выше и/или фигуры 7, 8, 9 и 44-47) могут быть использованы для определения подходящих последовательностей нуклеиновых кислот, кодирующих антитела, и последовательности нуклеиновых кислот затем используются для экспрессии одного или более антител, специфичных к EphA2 или CD44. Последовательность(и) нуклеиновой кислоты может быть оптимизирована с учетом «предпочтения» определенного кодона для различных экспрессионных систем в соответствии со стандартными методами, хорошо известными специалистам в данной области.

С использованием предоставляемой информации касательно последовательности, нуклеиновые кислоты могут быть синтезированы в соответствии с множеством стандартных способов, известных специалистам в данной области. Олигонуклеотидный синтез предпочтительно осуществляется на коммерчески доступных твердофазных механизмах олигонуклеотидного синтеза (Needham-VanDevanter et al. (1984) Nucleic Acids Res. 12:6159-6168) или вручную синтезируется с использованием, например, твердофазного фосфорамид триэфирного метода, описанного Beaucage et. al. (1981) Tetrahedron Letts. 22(20): 1859-1862.

Если нуклеиновая кислота, кодирующая антитело по изобретению, синтезируется, ее можно амплифицировать и/или клонировать в соответствии со стандартными способами. Техники молекулярного клонирования для достижения этих результатов известны специалистам в данной области. Широкое множество способов клонирования и амплификации in vitro, подходящих для создания рекомбинантных нуклеиновых кислот, известны специалистам в данной области и являются предметом множества справочников и лабораторных руководств.

Экспрессия природных или синтетических нуклеиновых кислот, кодирующих антитела настоящего изобретения, может быть достигнута путем функционального связывания нуклеиновой кислоты, кодирующей антитело, с промотором (который является или конститутивным, или индуцируемым), и включения конструкта в экспрессионный вектор для производства рекомбинантного вектора экспрессии. Векторы могут подходить для репликации и интеграции в прокариот, эукариот, или и в тех, и в других. Типичные клонирующие векторы содержат функциональные подходяще ориентированные терминаторы транскрипции и трансляции, инициирующие последовательности, и промоторы, пригодные для регуляции экспрессии нуклеиновой кислоты, кодирующей антитело. Векторы необязательно содержат общие экспрессионные кассеты, содержащие по меньшей мере одну независимую терминаторную последовательность, последовательности, разрешающие репликацию кассеты как у эукариот, так и у прокариот, например, как в шаттл-векторах, и селекционные маркеры как для прокариотических, так и для эукариотических систем.

Для получения высоких уровней экспрессии клонированной нуклеиновой кислоты обычно конструируют экспрессионные плазмиды, которые, как правило, содержат сильный промотор для направления транскрипции, сайт связывания рибосомы для инициации трансляции, и терминатор транскрипции/трансляции, каждый в функциональной ориентации друг к другу и к кодирующей белок последовательности. Примерами регуляторных участков, подходящих для этой цели в Е.coli, являются участок промотора и оператора пути биосинтеза триптофана Е.coli, левосторонний промотор фага лямбда (PL) и оперон L-арабинозы (araBAD). Также полезно включение маркеров селекции в ДНК векторы, трансформированные в Е.coli. Примеры таких маркеров включают гены специфической устойчивости к ампициллину, тетрациклину или хлорамфениколу. Экспрессионные системы для экспрессирующихся антител доступны с использованием, например, Е.coli, Bacillus sp. и Salmonella. Могут быть также использованы системы Е.coli.

Ген(ы) антитела могут также быть субклонированы в экспрессионный вектор, который обеспечивает добавление метки (например, FLAG, гексагистидина и тому подобного) к C-концевой области или N-концевой области антитела (например, scFv) для облегчения очистки. Методы трансфекции и экспрессии генов в клетках млекопитающих известны специалистам в данной области. Клетки, трансдуцированные нуклеиновыми кислотами, могут включать, например, инкубацию липидных микрочастиц, содержащих нуклеиновые кислоты, с клетками, или инкубацию вирусных векторов, содержащих нуклеиновые кислоты, с клетками, выбранными из круга хозяев вектора. Культура клеток, используемых в настоящем изобретении, включающая клеточные линии и культивируемые клетки из ткани (например, опухоли) или образцов крови, хорошо известна специалистам в данной области.

Если нуклеиновая кислота, кодирующая антитело по изобретению, изолирована и клонирована, то можно экспрессировать нуклеиновую кислоту в различных рекомбинантно созданных клетках, известных специалистам в данной области. Примеры таких клеток включают бактерии, дрожжи, мицеальные грибы, клетки насекомых (например, использующие бакуловирусные векторы) и клетки млекопитающих.

Изоляция и очистка антитела по изобретению может быть проведена в соответствии со способами, известными специалистам в данной области. Например, белок может быть изолирован из лизата клеток, генетически модифицированных для экспрессии белка конститутивно и/или после индукции, или из синтетической реакционной смеси, с помощью иммуноаффинной очистки (или преципитации с использованием Белка L или А), промывания для удаления неспецифично связавшегося материала, и элюирования специфично связавшихся антител. Изолированное антитело может в дальнейшем очищаться при помощи диализа и других способов, обычно используемых в способах очистки белка. В одном воплощении изобретения, антитело может быть изолировано с использованием способов металл-хелатной хроматографии. Антитела настоящего изобретения могут содержать модификации, способствующие изоляции, как обсуждалось выше.

Антитела по изобретению могут быть приготовлены в по существу чистой или изолированной форме (например, свободной от других полипептидов). Белок может присутствовать в композиции, которая обогащена полипептидами, относительно других компонентов, которые могут присутствовать (например, других полипептидов или других компонентов клеток-хозяев). Очищенные антитела могут предоставляться таким образом, что антитело присутствует в композиции, которая по существу свободна от других экспрессируемых белков, например, менее чем 90%, обычно менее чем 60% и более обычно менее чем 50% композиции составлено из других экспрессируемых белков.

Антитела, вырабатываемые клетками прокариот, могут требовать обработки средствами, вызывающими диссоциацию комплексов, для правильной укладки. Во время очистки из Е.coli, например, экспрессируемый белок может быть необязательно денатурирован и затем ренатурирован. Это можно сделать, например, посредством диссоциации произведенных бактериями антител средством, вызывающим диссоциацию комплексов, таким как гуанидин HCl. Антитело затем ренатурируется или путем медленного диализа, или путем гель-фильтрации. Альтернативно, нуклеиновая кислота, кодирующая антитела, может быть функционально связана с сигнальной последовательностью секреции, такой как pelB, так что антитела секретируются в периплазму в правильно уложенной форме.

Настоящее изобретение также предоставляет клетки, которые производят антитела по изобретению, где подходящие клетки включают эукариотические клетки, например, клетки млекопитающих. Клетки могут быть гибридными клетками или "гибридомой", которая способна репродуцировать антитела in vitro (например, моноклональные антитела, такие как IgG). Например, настоящее изобретение предоставляет рекомбинантную клетку-хозяина (также обозначаемую в настоящей заявке как "генетически модифицированная клетка-хозяин") которая генетически модифицирована одной или несколькими нуклеиновыми кислотами, содержащими нуклеотидную последовательность, кодирующую антитело по изобретению.

В настоящей заявке также рассматриваются технологии для создания рекомбинантных ДНК версий антиген-связывающих участков молекул антитела, которые минуют получение гибридом. ДНК клонируется, например, в экспрессионной системе бактерий (например, бактериофаг), дрожжей (например, Saccharomyces или Pichia) насекомых или млекопитающих. Один пример подходящей технологии использует векторную систему бактериофага лямбда, имеющую лидерную последовательность, которая приводит к тому, что экспрессируемое антитело (например, Fab или scFv) мигрирует в переплазматическое пространство (между мембраной бактериальной клетки и клеточной стенкой) или секретируется. Можно быстро произвести большое количество функциональных фрагментов, которые связывают ассоциированный с опухолью антиген.

Модификация

Настоящее изобретение охватывает антитела и нуклеиновые кислоты, которые модифицированы для получения желаемых свойств, например, для облегчения доставки в специфический тип ткани и/или клеток у пациента, для увеличения периода полувыведения из сыворотки, для дополнительной антираковой активности и так далее. Антитела настоящего изобретения могут быть предоставлены с модификацией или без нее, и включать человеческие антитела, гуманизированные антитела и химерные антитела. Один путь для модификации антитела по изобретению состоит в конъюгации (например, присоединении) одного или более дополнительных элементов с N- и/или С-конца или к любой аминокислоте (включая внутренние аминокислоты) антитела, где такие дополнительные элементы включают, например, другой белок и/или лекарство или молекулу-носитель.

Антитело по изобретению, модифицированное одним или более дополнительными элементами, сохраняет желаемую специфичность связывания, при этом потребительские свойства одного или более дополнительных элементов наделяются дополнительными желаемыми характеристиками. Например, антитело по изобретению может быть конъюгировано со второй молекулой, что способствует растворимости, хранению или другим потребительским свойствам, клеточной проницаемости, периоду полувыведения, уменьшению иммуногенности, контролируемому высвобождению и/или распределению, такому как нацеленность на определенные клетки (например, нейроны, лейкоциты, клетки опухоли и так далее) или локализации в клетке (например, лизосома, эндосома, митохондрия и так далее), ткани или другой локализации в теле (например, кровь, нервная ткань, определенные органы и так далее). Другие примеры включают конъюгацию с красителем, флюорофором или другими детектируемыми метками или репортерными молекулами для анализов, отслеживания, воспроизведения и тому подобного. Более конкретно, антитело по изобретению может быть конъюгировано со второй молекулой, такой как пептид, полипептид, краситель, флюорофор, нуклеиновая кислота, карбогидрат, средство против рака, липид, радионуклеотид и тому подобными (например, на восстанавливающем или невосстанавливающем конце), такими как присоединение липидного компонента, включая N-жирные ацильные группы, такие как N-лауроил, N-олеоил, жирные амины, такие как додецил амин, олеоил амин и тому подобные.

Например, для антител, которые могут быть интернализированы клетками, антитело или нуклеиновые кислоты настоящего изобретения могут быть в дальнейшем модифицированы для повышения или уменьшения эффективности доставки в клетки. В настоящей заявке также рассматриваются методы генной доставки нуклеиновых кислот для непосредственной экспрессии белков (например, антитела по изобретению или другого белка) в клетках. Эффективность клеточного поглощения (например, эндоцитоза) антител может возрастать или уменьшаться благодаря линкерной связи с пептидами или белками. Например, предоставляемое антитело может быть связано с лигандом к рецептору-мишени или с большой молекулой, которая легче захватывается механизмами эндоцитоза, такой как другое антитело, при этом такое антитело представляет собой "конъюгат антитела." Создающий конъюгат элемент (например, лиганд) может также высвобождаться путем кислотного гидролиза или ферментной активности, когда эндоцитирующая везикула сливается с лизосомами. Для модификации клеточного поглощения, конъюгат может включать лиганд, который оставляет антитело на поверхности клетки, что может быть полезным для контроля (например, уменьшения) клеточного поглощения, или в некоторых случаях уменьшает поглощение одним типом клеток, в то же время увеличивая его в других.

Если антитело связано с другим антителом, антитело может быть биспецифичным. Как отмечено выше, биспецифичными антителами называются антитела, которые являются специфичными для двух различных эпитопов, которые могут представлять собой один антиген, или же не представлять.

Другие свойства конъюгированного антитела могут включать одно, когда конъюгат уменьшает токсичность по сравнению с неконъюгированным антителом. Другое свойство состоит в том, что конъюгат может быть более эффективно нацелен на тип клеток или орган (например, раковые клетки или раковую ткань), чем неконъюгированное антитело.

Дополнительные примеры включают антитело, конъюгированное с одной или более молекулами, которые дополняют, усиливают или могут иным образом действовать синергетически в связи с антителом. К антителу может быть присоединено лекарство против рака, например, для доставки к раковой области для дальнейшего способствования уничтожению клеток или устранению, например, антипролиферационного компонента (например, VEGF антагониста, например, анти-VEGF антитела), токсина (например, рицина, Pseudomonas экзотоксина А и тому подобного), радионуклида (например, 90Y, 131I, 177L, 10B для бор нейтрон захвата и тому подобного), средства против рака (см. таблицу 5, ниже) и/или олигонуклеотида (например, siPHK).

Например, антитело может быть помещено в липидную наночастицу (например, липосому) путем ковалентных или нековалентных модификаций. Антитело может быть присоединено непосредственно к поверхности липидной наночастицы через Fc участок, например. Антитело может также быть ковалентно присоединено к концу полимера, имплантированного или вставленного в поверхность липидной наночастицы посредством линкера. Такие конъюгированные липидные наночастицы могут обозначаться в настоящей заявке как "иммунолипосомы". Антитела по изобретению в иммунолипосоме могут действовать как нацеленный на мишень компонент, дающий возможность иммунолипосомам специфично связываться с CD44 и/или EphA2 на поверхности раковых клеток. Иммунолипосомы могут нести один или более средств против рака, таких как малая молекула, пептид и/или нуклеиновая кислота (например, siPHK) или те, которые перечислены ниже в таблице 5. Способы производства и нагрузки липидных наночастиц, таких как липосомы и иммунолипосомы, известны, например, US 20100068255, US 20100008978, US 20090171077, US 20090155272, US 20070116753, US 20070110798, US 20070031484, US 20060147513, US 20050112065, US 20040037874, US 20040209366, US 20030003143, US 7,135,177, US 7,022,336, US 6,803,053, US 6,528,087, US 6,214,388, US 6,210,707, US 6,110,491, US 5,980,935, US 5,380,531, US 7,507,407, US 7,479,276, и US 7,462,603.

В таблице ниже перечислены некоторые примеры антираковых средств, которые могут быть использованы для модификации антител по изобретению, например, путем ковалентного или нековалентного связывания средства с антителом. Как будет позже обсуждаться ниже, любые средства, перечисленные ниже, могут также находиься в составе одной композиции с антителами по изобретению или могут быть введены в комбинационной терапии способами по изобретению.

Таблица 5. Средства против рака
Средство против рака Комментарии Примеры
Антитела (а) антитела, отличные от анти-EphA2 антител или анти-CD44 антител; и
(б) анти-EphA2 антитела или анти-CD44 антитела антитела, которые связывают другие эпитопы EphA2 или CD44, чем антитела, раскрытые здесь
Антитела, которые связывают IGF-1R (рецептор 1 типа инсулин-подобного фактора роста), который экспрессируется на клеточной поверхности большинства человеческих раков А12 (полностью гуманизированное mAb) 19D12 (полностью гуманизированное mAb) СР751-871 (полностью гуманизированное mAb) Н7С10 (гуманизированное mAb) alphaIR3 (мышиное) scFV/FC (химера мышь/человек) ЕМ/164 (мышиное) AMG 479 (полностью гуманизированное mAb; Amgen) IMCA 12 (полностью гуманизированное mAb; Imclone) NSC-742460 (Dyax) MR-0646, F50035 (Pierre Fabre Medicament, Merck)
Антитела, которые связывают EGFR; Мутации, действующие на экспрессию или активность EGFR, могут приводить к раку матузумаб (EMD72000) Erbitux® / цетуксимаб (Imclone) Vectibix® / панитумумаб (Amgen) mAb 806 нимотузумаб (TheraCIM)
Средство против рака Комментарии Примеры
INCB7839 (Incyte) панитумумаб (Vectibix®; Amgen)
Антитела, которые связывают сМЕТ (мезенхимально эпителиальный фактор переноса); член MET семейства рецепторных тирозин киназ) AVEO (AV299) (AVEO) AMG 102 (Amgen) 5D5 (OA-5D5) (Genentech)
Анти-ErbB3 антитела 1В4С3; 2D1D12 (U3 Pharma AG)
U3-1287/AMG888 (U3 Pharma/Amgen) MM-121 (Merrimack Pharmaceuticals)
Анти-ErbB2 (HER2) антитела Herceptin® (трастузумаб; Genentech/Roche) связывает эктодомен Домен II из ErbB2; Omnitarg® (пертузумаб; 2C4,R1273; Genentech/Roche) связывает Домен IV из ErbB2
Анти-ErbB2/анти-ErbB3 биспецифичные антитела ММ-111 (Merrimack Pharmaceuticals)
Малые молекулы, мишенью которых является IGF1R IGF-1R (рецептор типа 1 инсулин-подобного фактора роста), который экспрессируется на клеточной поверхности большинства человеческих раков NVP-AEW541-A BMS-536,924 (1H-бензоимидазол-2-yl)-1H-пиридин-2-один) BMS-554,417 Циклолиган TAE226 PQ401
Малые молекулы, мишенью которых является EGFR EGFR; мутации, влияющие на экспрессию или активность EGFR, могут приводить к раку Iressa® / гефитиниб (AstraZeneca) CI-1033 (PD 183805) (Pfizer) TYVERB / лапатиниб (GlaxoSmithKline) Tykerb® / лапатиниб дитосилат (SmithKline Beecham) Tarceva®/ Eriotinib HCL (OSI Pharma) PKI-166 (Novartis) PD-158780 EKB-569 Тирфостин AG 1478(4-(3-хлораниллино)-6,7-диметоксихиназолин)
Малые молекулы, мишенью которых является ErbВ2 ЕrbВ2, также известный как HER2, член ErbB семейства рецепторов, который экспрессируется на определенных раковых клетках HKI-272 (нератиниб; Wyeth) KOS-953 (танеспимицин; Kosan Biosciences)
Малые молекулы, мишенью сМЕТ (мезенхимально PHA665752
Средство против рака Комментарии Примеры
которых является сМЕТ эпителиальный фактор переноса); член MET семейства рецепторных тирозин киназ) ARQ 197(ArQule) ARQ-650RP (ArQule)
Антиметаболиты Антиметаболит является химическим веществом, которое имеет структуру, сходную со структурой вещества (метаболита), требующегося для нормальной биохимической реакции, но достаточно отличающуюся, чтобы помешать нормальному функционированию клетки, включая клеточное деление. флорурацил (5-FU) капецитабин / XELODA® (HLR Roche) 5-трифторметил-2'-деоксимочевина нитрат метотрексата (Trexall) (Barr) ралтитрексед / Tomudex® (AstraZaneca) пеметрексед / Alimta® (Lilly) тегафур цитозин арабинозид (Cytarabine, Ara-C) / тиогуанин / Lanvis® (GlaxoSmithKline) 5-азатиоприн 6-меркаптопурин (Меркаптопурин, 6-МР) азатиоприн / Azasan® (AAIPHARMA LLC) 6-тиогуанин (6-TG) / Purinethol® (TEVA) пентостатин / Nipent® (Hospira Inc.) флударабина фосфат / Fludara® (Bayer Health Care) кладрибин / Leustatin® (2-CdA, 2-хлордеоксиаденозин) (Ortho Biotech) фтоксуридин (5-фтор-2'-деоксимочевина) / FUDR® (Hospira, Inc.)
Алкилирующие средства Алкилирующее протиопухолевое средство является алкилирующим средством, которое присоединяет алкильную группу к ДНК. Поскольку раковые клетки обычно пролиферируют неограниченно больше, чем здоровые клетки, они более чувствительны к повреждению ДНК, и алкилирующие средства используются клинически для лечения множества опухолей. Ингибитор рибонуклеотид редуктазы (RNR) циклофосфамид / Cytoxan® (BMS) / Neosar® (TEVA) ифосфамид /Mitoxana® (ASTA Medica) ThioTEPA (Bedford, Abraxis, Teva) BCNU→ 1,3-бис(2-хлорэтил)-1-нитрозомочевина CCNU→ 1,-(2-хлорэтил)-3-циклогексил-1-нитрозомочевина (метил CCNU) гексаметилмеламин (алтретамин, НММ) / Hexalen® (MGI Pharma Inc.) бусульфан / Myleran® (GlaxoSmithKline)
Средство против рака Комментарии Примеры
прокарбазин HCL / Matulane® (Sigma Tau) Дакарбазин (DTIC®) хлорамбуцил / Леукаран® (SmithKline Beecham) Мелплатан / Alkeran® (GlaxoSmithKline) цисплатин (Cisplatinum, CDDP) / Платинол (Bristol Myers) карбоплатин / Параплатин (BMS) оксалиплатин / Eloxitan® (Sanofi-Aventis US) Бендамустин карбоквон карму стин хлорометин дакарбазин (DTIC) фотемустин лому стин манносульфан недаплатин нимустин преднимустин ранимустин сатраплатин семустин стрептозоцин темозоломид треосульфан триазиквон триэтилен меламин триплатин тетранитрат трофосфамид урамустин
Ингибиторы топоизомеразы Ингибиторы топоизомеразы представляют собой химиотерапевтические средства, разработанные для подавления действия ферментов топоизомераз (топоизомераза I и II), которые представляют собой ферменты, контролирующие изменения в структуре ДНК путем катализа разрыва и восстановления фосфодиэфирной связи нитей ДНК во время нормального клеточного цикла. доксорубицин / Doxil® (Alza) цитрат даунорубицина / Daunoxome® (Gilead) митоксантрон /Novantrone (EMD Serono) актиномицин D этопозид / Vepesid® (BMS)/ Etopophos® (Hospira, Bedford, Teva Parenteral, Etc.) топотекан / Hycamtin® (GlaxoSmithKline) тенипозид (VM-26) / Vumon® (BMS) иринотекан (СРТ-11) /camptosar® (Pharmaeia & Upjohn) SN38 камптотецин (СРТ) белотекан
Средство против рака Комментарии Примеры
рубитекан
Средства, мишенью которых являются микротрубочки Микротрубочки являются одним из компонентов цитоскелета. Они имеют диаметр ~24 нм и длину, варьирующуюся от нескольких микрометров до, возможно, миллиметров в аксонах нервных клеток. Микротрубочки служат структурными компонентами внутри клеток и вовлечены в многие клеточные процессы, включая митоз, цитокинез и везикулярный транспорт. винкристин / Oncovin® (Lilly) винбластин сульфат/Velban®(снят с производства) (Lilly) винорелбин тартрат / Navelbine® (PierreFabre) виндезин сульфат / Eldisine® (Lilly) паклитаксел / Taxol® (BMS) доцетаксел / Taxotere® (Sanofi Aventis US) Наночастицы паклитаксела (ABI-007) / Abraxane® (Abraxis BioScience, Inc.) иксабепилон / IXEMPRA™ (BMS) ларотаксел ортатаксел тезетаксел винфлунин колхицин
Ингибиторы киназ Тирозинкиназы являются внутриклеточными ферментами, функция которых присоединять фосфатные группы к аминокислоте тирозину. Блокируя способность белка тирозинкиназ к функционированию, эти соединения предоставляют инструмент контроля роста раковых клеток. иматируб мезилат / Gleevec (Novartis) сунитируб малат / Sutent® (Pfizer) сорафениб тозилат / Nexavar® (Bayer) нилотиниб гидрохлорид моногидрат / Tasigna® (Novartis) AMG 386 (Amgen) акситиниб (AG-013736; Pfizer, Inc.) босутиниб (SKI-606; Wyeth) бриваланиб алалинат (BMS-582664; BMS) цедираниб (AZD2171; Recentin, AstraZeneca) дазатиниб (BMS-3 54825: Sprycel®; BMS) лестауртиниб (СЕР-701; Cephalon) мотесаниб дифосфаг (AMG-706; Amgen/Takeda) пазораниб HCL (GW786034; Armala, GSK) семаксаниб (SU5416; Pharmacia) вандетаниб (AZD647; Zactima; AstraZeneca) ваталаниб (РТК-787; Novartis, Bayer Schering Pharma)
Средство против рака Комментарии Примеры
XL184 (NSC718781; Exelixis, GSK)
Ингибиторы синтеза белка Индуцируют клеточный апоптоз L-аспарагиназа / Elspar® (Merck & Co.)
Иммунотерапевтические средства Стимулирует раковых пациентов проявлять иммунные реакции Альфа интерферон Ингибитор ангиогенеза / Avastin® (Genentech) IL-2→ Интейлейкин 2 (Aldesleukin) / Proleukin® (Chiron) IL-12→ Интерлейкин 12
Гормональные терапии Гормональные терапии, связанные с менопаузой и старением, направлены на повышение количества определенных гормонов в теле для компенсации связанных с возрастом или болезнью гормональных спадов. Гормональная терапия при лечении рака обычно или уменьшает уровень одного или более специфических гормонов, блокирует взаимодействие гормона с его клеточным рецептором, или же, другим образом, меняет способность рака быть стимулированным гормонами к росту и распространению. Поэтому такие гормональные терапии включают антагонистов гормонов и ингибиторов синтеза гормонов. В некоторых случаях в качестве антираковой гормональной терапии также могут использоваться агонисты гормонов. Цитрат торемифена / Fareston® (GTX, Inc.) фулвестрант / Faslodex® (AstraZeneca) ралоксифен HCL / Evista® (Lilly) анастразол / Arimidex® (AstraZeneca) летрозол / Femara® (Novartis) фадрозол (CGS 16949A) эксеместан / Aromasin® (Pharmacia & Upjohn) ацетат леупролида / Eligard® (QTL USA) Lupron® (TAP Pharm.) Ацетат гозерелина / Zoladex® (AstraZeneca) трипторелин памоат / Trelstar® (Watson Labs) бузерелин / Suprefact® (Sanofi Aventis) нафарелин цетрореликс / Cetrotide® (EMD Serono) бикалутамид / Casodex® (AstraZeneca) нилутамид / Nilandron® (Aventis Pharm.) ацетат мегестрола / Megace® (BMS) аналоги соматостатина (напр., Октреотид ацетат / Sandostatin® (Novartis)) абареликс (Plenaxis™; Amgen) абиратерона ацетат (СВ7630; BTG plc) афимоксифен (TamoGel; Ascend Therapeutics, Inc.) ингибитор ароматазы (Атаместан плюс торемифен; Intarcia Therapeutics, Inc.) арзоксифен (Eli Lilly & Co)
Средство против рака Комментарии Примеры
Глюкокортикоиды Противовоспалительные лекарства, используемые для уменьшения опухоли, которая причиняет боль при раке. Asentar™; DN-101 (Novacea; Oregon Health Sciences U) флутамид (Eulexin®, Schering; Prostacur, Laboratories Almirall, S.A)летрозол (CGS20267) (Femara®, Chugai; Estrochek®, (Jagsonpal Pharmaceuticals Ltd;) Delestrogen®, эстрадиол валерат (Jagsonpal) мегестрол ацетат / Megace® медроксипрогестерон ацетат (Veraplex®; Combiphar) MT206 (Medisyn Technologies, Inc.) нандролон деканоат (Zestabolin®; Mankind Pharma Ltd) тамоксифен (Taxifen®, Yung Shin Pharmaceutical; Tomifen®, Alkem Laboratories Ltd.) тамоксифен цитрат (Nolvadex, AstraZeneca; солтамокс, EUSA Pharma Inc; тамоксифен цитрат SOPHARMA, Sopharma JSCo.) преднизолон дексаметазон / Decadron® (Wyeth) преднизон (Deltasone, Orasone, Liquid Pred, Sterapred®)
Ингибиторы ароматазы Включает имидазолы Кетоконазол Эксеместан (Aromasin®)
mTOR ингибиторы mTOR сигнальный путь был впервые открыт во время исследований иммуносупрессорного средства рапамицина. Этот высококонсервативный путь регулирует клеточную пролиферацию и метаболизм в ответ на факторы внешней среды, связывающийся с рецептором фактора клеточного роста, передавая сигналы посредством фосфоинозитид-3-киназы (PI-3K) для клеточного роста, пролиферации и ангиогенеза. сиролимус (Rapamycin) /Rapamune® (Wyeth) Темсиролимус (CCI-779) / Torisel® (Wyeth) Дефоролимус (АР23573) (Ariad Pharm.) Эверолимус (RAD001) /Certican® (Novartis)
Химиотерапевтические средства адриамицин, 5-фторурацил, цитоксин, блеомицин, митомицин С, дауномицин,
Средство против рака Комментарии Примеры
карминомицин, аминоптерин, дактиномицин, митомицины, эсперамицины, клофарабин, меркаптопурин, пентостатин, тиогуанин, цитарабин, децитабин, флоксуридин, гемцитабин (Gemzar), эноцитабин, сапацитабин
Ингибиторы протеинкиназы В(РКВ) AKT Ингибитор Astex® (Astex Therapeutics) АКТ Ингибиторы NERVIANO (Nerviano Medical Sciences) АКТ ингибитор киназы TELIK (Telik Inc) АКТ DECIPHERA (Deciphera Pharmaceuticals, LLC) перифозин (KRX0401, D-21266; Keryx Biophannaceuticals Inc, AEterna Zentaris Inc) перифозин с Доцетакселем (Keryx Biophannaceuticals Inc, AEterna Zentaris Inc) перифозин с Гемцитабином (AEterna Zentaris Inc) перифозин с паклитакселем (AEterna Zentaris Inc) протеин киназы - ингибитор В DEVELOGEN (DeveloGen AG) PX316 (Oncothyreon, Inc.) RX0183 (Rexahn Pharmaceuticals Inc) RX0201 (Rexahn Pharmaceuticals Inc) VQD002 (VioQuest Pharmaceuticals Inc) XL418(ExelixisInc) ZEN027 (AEterna Zentaris Inc)
Ингибиторы фосфатидилинозитол 3-киназы (PI3K) BEZ235 (Novartis AG) BGT226 (Novartis AG) CAL101 (Calistoga Pharmaceuticals, Inc.) CHR4432 (Chroma Therapeutics Ltd) Erk/PI3K Ингибиторы ETERNA (AEterna Zentaris Inc) GDC0941 (Genentech Inc/Piramed Limited/Roche
Средство против рака Комментарии Примеры
Holdings Ltd) энзастаурин HCL (LY317615; Enzastaurin; Eli Lilly) LY294002/Wortmannin PI3K Ингибиторы SEMAFORE (Semafore Pharmaceuticals) РХ866 (Oncothyreon, Inc.) SF1126 (Semafore Pharmaceuticals) VMD-8000 (VM Discovery, Inc.) XL 147 (Exelixis Inc) XL 147 с XL647 (Exelixis Inc) XL765 (Exelixis Inc) PI-103 (Roche/Piramed)
Ингибиторы циклин-зависимой киназы CYC200, R-росковитин (Seliciclib; Cyclacel Pharma) NSC-649890, L86-8275, HMR-1275 (алвоцидиб; NCI)
TLr9, CD289 IMOxine (Merck KGaA) HYB2055 (Idera) IMO-2055 (Isis Pharma) 1018 ISS (Dynavax Technologies/UCSF) PF-3512676(Pfizer)
Ингибитор фермента лонафарниб (SCH66336; Sarasar; SuperGen, U Arizona)
Анти-TRAIL AMG-655 (AEterna Zentaris, Keryx Biopharma) Apo2L/TRAIL, AMG951 (Genentech, Amgen) APOMAB (полностью гуманизированное mAb; Genentech)
Ингибиторы MEK Митоген-активируемая белковая киназа киназы 1 (МАР2К1); митоген-активируемая белковая киназа киназы 2 (МАР2К2) ARRY162 (Array BioPharma Inc) ARRY704 (Array BioPharma Inc) ARRY886 (Array BioPharma Inc) AS703026 (Merck Serono S.A) AZD6244 (AstraZeneca Pic) AZD8330 (AstraZeneca Pic) RDEA119 (Ardea Biosciences, Inc.) RDEA436 (Ardea Biosciences, Inc.) XL518 (Exelixis Inc; Genentech Inc)
Прочие ингибиторы Имприм PGG (Biothera) CHR-2797 (Аминопептидазы Ml ингибитор; Chroma Therapeutics)
Средство против рака Комментарии Примеры
E7820, NSC 719239 (Интегрин-альфа2 ингибитор, Eisai) INCB007839 (ADAM 17, TACE Ингибитор; Incyte)CNF2024,BIIB021 (Hsp90 Ингибитор; Biogen Idec) МР470, HPK-56 (Kit/Mel/Ret Ингибитор; Schering-Plough) SNDX-275/MS-275 (HDAC Ингибитор; Syndax) Zarnestra™, Типифарниб, R115777 (Ras Ингибитор; Janssen Pharma) волоциксимаб; Eos 200-4, M200 (альфа581 интегрин ингибитор; Biogen Idec; Eli Lilly/UCSF/PDL BioPharma) априкоксиб (TP2001; COX-2 Ингибитор, Daiichi Sankyo; Tragara Pharma)

Антитела настоящего изобретения могут быть необязательно модифицированы для достижения улучшенного фармакокинетического профиля (например, путем ПЭГилирования, гипергликозилирования и тому подобного). Интерес представляют модификации, которые могут усиливать период полувыведения из сыворотки крови. Антитело по изобретению может быть "ПЭГилировано", то есть содержать один или более поли(этиленгликоль) (ПЭГ) компонентов. Способы и реагенты, подходящие для ПЭГилирования белка, хорошо известны в данной области, и их можно найти в патенте США №5849860. ПЭГ, подходящий для конъюгации с белком, обычно растворим в воде при комнатной температуре и имеет общую формулу R(O-CH2-CH2)nO-R, где R является гидрогеном или защитной группой, такой как алкильная или алканольная группа, и где n представляет собой целое число от 1 до 1000. Если R является защитной группой, она обычно имеет от 1 до 8 углеводов.

ПЭГ, конъюгированный с белком по изобретению, может быть линейным. ПЭГ, конъюгированный с белком по изобретению, также может быть разветвленным. Разветвленные ПЭГ-производные, такие как те, которые описаны в патенте США №5643575, "star-ПЭГ" и ПЭГ с множеством ответвлений, такие как те, которые описаны в Shearwater Polymers, Inc. каталог "Polyethylene Glycol Derivatives 1997-1998." Star-ПЭГ описаны в данной области техники, включая, например, в патенте США №6046305.

Если антитело по изобретению выделено из источника, белок по изобретению может быть конъюгирован с компонентами, способствующими очистке, такими как члены специфических связывающихся пар, например, биотин (член специфично связывающейся пары биотин-авидин), лектин и тому подобные. Белок по изобретению также может быть связан (например, иммобилизирован) с твердой подложкой, включая, но не ограничиваясь тем самым, полистироловые пластинки или шарики, магнитные шарики, тестовые полоски, мембраны и тому подобное.

Если в анализе детектируются антитела, то белки по изобретению могут также содержать детектируемую метку, например, радиоизотоп (например, 125I; 35S и тому подобный), фермент, который производит детектируемый продукт (например, люциферазу, β-галактозидазу, пероксидазу хрена, алкалин фосфотазу и тому подобное), флюоресцентный белок, хромогенный белок, краситель (например, флюоресцин изотиоцианат, родамин, фикоэритрин и тому подобное); флюоресцирующие металлы, например, 152Eu или другие из лантаноидов, присоединенные к белку через металл хелатирующие группы, такие как EDTA; хемилюминесцентные соединения, например, люминол, изолюминол, соли акридиниума и тому подобное; биолюминесцентные соединения, например, люциферин; флюоресцентные белки; и тому подобное. Непрямые метки включают антитела, специфичные к белку по изобретению, где антитела могут детектироваться с помощью вторичных антител; и члены определенной связывающейся пары, например, биотин-авидин и тому подобные.

Любой из перечисленных выше элементов, которые используются для модификации антитела по изобретению, может быть присоединен к антителу посредством линкера, например, гибкого линкера. При наличии линкерные молекулы обычно имеют достаточную длину для того чтобы придать антителу и связанному с ним компоненту, определенную гибкую подвижность между антителом и носителем. Линкерные молекулы обычно составляют примерно 6-50 атомов в длину. Линкерные молекулы также могут представлять, например, арил ацетилен, этиленгликоль олигомеры, содержащие 2-10 мономерных единиц, диамины, дикислоты, аминокислоты или их комбинации.

Если линкеры являются пептидами, линкеры могут быть любой из подходящих различных длин, такой как от 1 аминокислоты (например, Gly) до 20 или более аминокислот, от 2 аминокислот до 15 аминокислот, от 3 аминокислот до 12 аминокислот, включая от 4 аминокислот до 10 аминокислот, от 5 аминокислот до 9 аминокислот, от 6 аминокислот до 8 аминокислот или от 7 аминокислот до 8 аминокислот, и могут быть 1, 2, 3, 4, 5, 6 или 7 аминокислот.

Гибкие линкеры включают полимеры глицина (G)n, полимеры глицин-серин (включая, например, (GS)n, GSGGSn (SEQ ID NO:83) и GGGSn (SEQ ID NO:87), где n является целым числом не меньше единицы), полимеры глицин-аланин, полимеры аланин-серин и другие гибкие линкеры, известные в данной области. Глицин и глицин-сериновые полимеры могут быть использованы, если интерес представляют сравнительно бесструктурные аминокислоты, и могут служить нейтральной связью между компонентами. Примеры гибких линкеров включают, не ограничиваясь, GGSG (SEQ ID NO:46), GGSGG (SEQ ID NO:47), GSGSG (SEQ ID NO:48), GSGGG (SEQ ID NO:49), GGGSG (SEQ ID NO:88), GSSSG (SEQ ID NO:89) и тому подобные. Специалист в данной области техники поймет, что дизайн пептида, конъюгированного с любыми элементами, описанными выше, может включать линкеры, которые являются полностью или частично гибкими, таким образом, что линкер может включать гибкий линкер, а также одну или более частей, которые придают менее гибкую структуру.

Конструирование гуманизированных антител

Если антитела настоящего изобретения, которые связывают CD44 или EphA2, не являются человеческими, антитела могут быть гуманизированы. При использовании в настоящей заявке, гуманизированное антитело представляет собой рекомбинантный полипептид, который происходит из не являющегося человеческим антитела (например, антитела грызунов) и модифицирован так, что содержит по меньшей мере часть каркасного и/или константного участков человеческого антитела.

Гуманизированные антитела также охватывают химерные антитела и антитела с привитыми CDR, в которых различные участки могут происходить из различных видов. Химерные антитела могут быть антителами, которые включают вариабельный участок из любого источника, связанного с человеческим константным участком. Таким образом, в химерных антителах вариабельный участок может не являться человеческим, а константный участок является человеческим. Антитела с привитыми CDR являются антителами, которые включают CDR из не являющегося человеческим "донорного" антитела, связанного с каркасным участком из человеческого "реципиентного" антитела. Например, антитело настоящего изобретения в форме scFV может быть связано с человеческим константным участком (например, Fc участком), для создания человеческого иммуноглобулина.

Fc участок

Антитело настоящего изобретения, которое связывает CD44 или EphA2, может содержать Fc участок. Fc участок может быть любой из природных изоформ, находящихся в человеке или других животных (например, происходящей из любого класса или подкласса иммуноглобулинов) и может необязательно быть в дальнейшем модифицирован, чтобы иметь измененную функцию. Например, Fc участок может быть модифицирован по положению одного или более аминокислотного остатка, чтобы иметь повышенные эффекторные функции, такие как инициация клеточно опосредованной цитотоксичности или инициация активности комплемента (например, Clq связывание или комплемент-зависимая цитотоксичность), снижение количества рецепторов клеточной поверхности и т.п. Детали Fc вариантов, которые могут быть использованы как антитела настоящего изобретения, можно найти, например, в US7,416,727, US7,371,826, US7,335,742, US7,355,008, US7,521,542 и US7,632,497.

Композиции

Композиции по изобретению предоставляют антитела и/или кодирующие их нуклеиновые кислоты, при этом антитела связываются с раковыми клетками и интернализируются ими. Композиции настоящего изобретения находят использование в лечении пациента (например, человека), имеющего рак, и могут подходить для лечения во время любой стадии болезни. Композиции, содержащие одно, два или более различных антител, могут быть предоставлены как фармацетическая композиция и введены млекопитающему (например, человеку), нуждающемуся в них.

Композиции, рассмотренные в настоящей заявке, могут содержать один, два, три или более различных антител настоящего изобретения (и/или кодирующих их нуклеиновых кислот). Например, композиция может содержать одно или более из следующего: F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1, HH3, 2D6, D2-1A7, D2-1A9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11. Композиция может необязательно также включать один или несколько CDR из этих антител, и/или одно или несколько антител, содержащих мутанты или производные этих антител.

Пример композиции настоящего изобретения может включать любую из комбинаций, описанных выше, или одно или несколько антител, раскрытых на фигурах 7, 8 или 9, или Фигурах 44-47. Если композиция содержит два или более антител, каждое антитело может быть специфично к одинаковым или различным эпитопами или эпитопами различных антигенов. Например, композиция может содержать по меньшей мере одно антитело, специфичное для эпитопа CD44 или EphA2, и другое антитело, специфичное для другого антигена на поверхности клетки, такого как EGFR. Композиция может также содержать дуально специфичные, полиспецифичные антитела или кодирующие их нуклеиновые кислоты.

Антитела настоящего изобретения могут использоваться отдельно и/или в комбинации друг с другом (например, для формирования биспецифичных или полиспецифичных антител), и/или в комбинации с другими известными средствами против рака (например, антителами для лечения рака). Например, композиция, такая как липосома, может содержать одно или несколько антител, в котором по меньшей мере одно из антител является антителом настоящего изобретения. Как описано выше, липосома может содержать одно или несколько антител, которые отличны от антител по изобретению. Такая липосома может быть дуально специфичной, полиспецифичной и так далее, так что липосома является специфичной для дополнительного эпитопа (например, эпитопа в EGFR или HER2) в дополнение к эпитопу антитела по изобретению.

Соединения могут предоставляться в одной лекарственной форме или же могут предоставляться как различные лекарственные формы в наборе, где различные лекарственные формы могут содержать одно антитело или два антитела. Такие различные лекарственные формы в наборе могут быть скомбинированы перед введением или введены путем различных инъекций.

Фармацевтическая композиция по изобретению может предоставляться в фармацевтически приемлемом вспомогательном веществе, которое может быть раствором, например, солевым раствором, или может быть в форме порошка. Композиция поизобретению может содержать другие компоненты, такие как фармацевтической степени чистоты маннитол, лактозу, крахмал, стеарат магния, сахарин натрия, тальк, целлюлозу, глюкозу, сахарозу, магний, углекислую соль и тому подобное. Композиции могут содержать фармацевтически приемлемые вспомогательные вещества, если необходимо приближение к физиологическим условиям, такие как средства регулировки рН и буферные средства, средства регулирования токсичности и тому подобные, например, ацетат натрия, хлорид натрия, хлорид калия, хлорид кальция, лактат натрия и тому подобные.

Антитело по изобретению, например, в форме фармацевтически приемлемой соли, может быть в лекарственной форме для орального, местного или парентерального введения для использования в методах, описанных ниже. В определенных воплощениях изобретения, например, если антитело вводится как инъецируемая жидкость, (например, подходящая для внутривенного введения), лекарственная форма антитела может быть стерильным, непирогенным водным раствором, содержащим соли (например, для регуляции тоничности), буферы, консерванты, аминокислоты и другие фармацевтически приемлемые носители и вспомогательные вещества, и может быть предоставлена как готовая к использованию форма дозировки или восстановимый стабильный при хранении порошок или жидкость, составленная из фармацевтически приемлемых носителей и вспомогательных веществ. Лекарственная форма для конвекционной доставки может быть такой, как описанная в, например, US 20090208422.

Композиции настоящего изобретения могут включать терапевтически эффективное количество антитела по изобретению, а также, при необходимости, любых других совместимые компоненты. Под "терапевтически эффективным количеством" подразумевается, что введение такого количества субъекту, или в однократной дозе, или как часть серий такого же или отличного антитела или композиций, эффективно для уменьшения пролиферации и/или метастазов раковых клеток у пациента или для предоставления любого иного обнаруживаемого терапевтического преимущества. Такое терапевтически эффективное количество антитела и его влияние на клеточный рост включает кооперативное и/или синергичное ингибирование клеточного роста в сочетании с одной или более терапиями (например, иммунотерапией, химиотерапией, радиационной терапией и так далее). Как замечено ниже, терапевтически эффективное количество может быть подобрано в соответствии с режимом дозирования и диагностическим анализом состояния пациента (например, мониторингом наличия или отсутствия эпитопов клеточной поверхности с использованием антитела, специфичного к CD44 и/или EphA2) и тому подобным.

Количество и дозировка

Точную дозу сможет уточнить специалист в данной области. Дозировка может зависеть от множества факторов, включая силу определенного задействованного компонента, состояние пациента и вес тела пациента, а также серьезность заболевания и стадию болезни. Размер дозы также будет определяться наличием, природой и величиной любых побочных эффектов, которые могут сопровождать введение определенной композиции. Как известно специалистам в данной области, корректировки, основанные на возрасте, весе тела, поле, диете, времени введения, взаимодействии с лекарствами и серьезности состояния могут быть необходимы и будут уточнены специалистами в данной области в ходе обычных экспериментов. Терапевтически эффективное количество также является одним из терапевтически полезных эффектов, перевешивающим любые токсические или вредные эффекты антитела или фрагмента антитела.

Количество композиции, введенной пациенту, например, человеку, в контексте настоящего изобретения должно быть достаточным для эффекта профилактического или терапевтического ответа у животного в течение подходящего временного промежутка и варьировать в зависимости от цели введения, здоровья и физического состояния субъекта, подвергаемого лечению, возраста, степени желаемой регрессии, лекарственной формы композиции с антителом, оценки лечащим врачом медицинской ситуации и других значимых факторов. Таким образом, ожидается, что количество будет уменьшаться в сравнительно широком диапазоне, но тем не менее может быть стандартно определено вследствие различных характеристик пациента, как отмечено выше.

Как пример, не являющийся ограничивающим, диапазон для терапевтически или профилактически эффективного количества антитела по изобретению составляет от приблизительно 0,1 мг/кг до приблизительно 20 мг/кг, например, от приблизительно 1 мг/кг до приблизительно 10 мг/кг.

Концентрация антитела в фармацевтических лекарственных формах может варьировать от менее чем приблизительно 0,1%, обычно или по меньшей мере приблизительно 2% до 20-50% или более по весу, и будет выбираться в первую очередь принимая во внимание объемы жидкости, вязкости и т.д., в соответствии с определенным выбранным способом введения и потребностями пациента. Получившиеся в результате композиции могут быть в форме раствора, суспензии, таблетки, пилюли, капсулы, порошка, геля, крема, лосьона, мази, аэрозоля или тому подобного.

Также подходящие дозы и режимы дозирования могут определяться в сопоставлении со средствами против рака или иммуносупрессорными средствами, которые известны тем, что влияют на желаемое подавление роста или иммуносупрессивную реакцию. Такие дозировки включают дозировки, которые в низкой дозе приводят к ингибированию клеточного роста, без значительных побочных эффектов. В надлежащих дозах и с подходящим введением определенных соединений, соединения настоящего изобретения могут давать широкий спектр внутриклеточных эффектов, например, от частичного подавления до практически полного подавления клеточного роста. Дозовое лечение может быть однодозовой схемой или многодозовой схемой (например, включая понижающиеся и поддерживающие дозы). Как указано ниже, композиция по изобретению может вводиться совместно с другими средствами, и таким образом дозы и режимы могут варьировать в этом контексте, а также для соответствия потребностям пациента.

Комбинационная терапия

Любая из широкого множества раковых терапий может быть скомбинирована в композиции с антителом по изобретению. Например, средства, используемые в химиотерапевтическом лечении или лечении модификаторами биологического отклика могут присутствовать в фармацевтической композиции, содержащем антитело, таком как иммунолипосома. Определенные средства, которые могут быть использованы в комбинации с антителами по тизобретению, приведены в таблице 5 выше и/или вкратце обсуждаются ниже.

Химиотерапевтические средства являются небелковыми соединениями, которые уменьшают пролиферацию раковых клеток и охватывают цитотоксические средства и цитостатические средства. Неограничивающие примеры химиотерапевтических средств включают алкилирующие средства, нитрозомочевины, антиметаболиты, противоопухолевые антибиотики, растительные (например, барвинка) алкалоиды, нуклеиновые кислоты, такие как ингибирующие нуклеиновые кислоты (например миРНК) и стероидные гормоны.

Антиметаболические средства включают аналоги фолиевой кислоты, аналоги пиримидина, аналоги пурина и ингибиторы аденозин деаминазы, например.

Подходящие природные продукты и их произодные (например, алкалоиды барвинка, противоопухолевые антибиотики, ферменты, лимфокины и эпиподофиллотоксины) могут быть использованы как средства против рака. Например, подходят таксаны, такие как паклитаксел, так же как любое активное производное таксана, такое как доцетаксел, или пропрепараты таксана, такие как 2'-(2-(N,N'-диэтаноламино)пропионил)-паклитаксел, 7-(2-(N,N'-диэтиламино)пропионил)-паклитаксел, 2'-(2-(N,N'-диэтиламино)пропионил)-доцетаксел или 7-(2-(N,N'-диэтиламино)пропионил)-доцетаксел.

Другими антипролиферативными цитотоксическими средствами являются навелбин, СРТ-11 (иринотекан), анастразол, летразол, капецитабин, релоксафин, циклофосфамид, ифозамид и дролоксафин. Действующие на микротрубочки средства, обладающие антипролиферационной активностью, также подходят для использования. Модуляторы гормонов и стероиды (включая синтетические аналоги) подходят для использования.

Диагностические методы

Настоящее изобретение предоставляет способ определения ассоциированного с опухолью антигена (например, CD44 или EphA2) в биологическом образце у пациента или в образце, выделенном из пациента. Способы пригодны как для диагностических, так и для прогностических целей. Способ по изобретению обычно включает контакт образца, содержащей клетки с антителом настоящего изобретения, и определения связывания антитела с клеткой в образце. Клетка может быть in vitro, если клетка находится в биологическом образце, полученном от пациента с подозрением на наличие раковых клеток, от пациента, подвергающегося лечению рака, или от пациента, исследуемого на чувствительность к лечению. Клетка может быть in vivo, например, клетка находится у пациента с подозрением на наличие раковых клеток, у пациента, подвергающегося лечению рака, или у пациента, исследуемого на чувствительность к лечению.

Антитела могут использоваться для определения клеток, экспрессирующих CD44 и/или EphA2, в биологическом образце пациента, имеющего раковые клетки или с подозрением на наличие раковых клеток, посредством иммунодиагностических техник.

Такие диагностики могут быть пригодны для идентификации пациентов, подлежащих терапиям, раскрытых в дальнейшем ниже, и/или для мониторинга реакции на терапию.

Подходящие иммунодиагностические техники включают, но не обязательно ограничиваются, как in vitro, так и in vivo (визуализирующие) способы. Например, анти-CD44 или анти-EphA2 антитела могут метиться для детекции, вводится пациенту с подозрением на наличие рака, характеризуемого экспрессией на клеточной поверхности CD44 или EphA2, и связавшееся детектируемое меченое антитело детектируется с использованием методов визуализации, доступных в данной области техники.

Фраза "in vivo визуализация" при использовании в настоящей заявке относится к методам детекции присутствия антитела (например, детектируемого меченого 2D6) в целом, живом млекопитающем. Оптически детектируемые белки, такие как флюоресцентные антитела и конъюгированнеые с люциферазой антитела, могут быть детектированы путем in vivo визуализации. Способы использования люцифераз для визуализации в режиме реального времени экспрессии люциферазы в живых животных могут быть легко адаптированы для использования в способах по изобретению, раскрытых здесь (например, Greer LF et al., Luminescence 2002, 17:43-74). In vivo визуализация флюоресцентных белков в живых животных описывается у, например, Hoffman, Cell Death and Differentiation 2002, 9:786-789. In vivo визуализация может быть использована для получения 2-D, а также 3-D изображений млекопитающих. Например, антитела с радиоактивной меткой могут быть введены пациенту, и изображение пациента получается с помощью гамма камеры. Камеры со светочувствительной матрицей, CMOS, или 3D томографы могут использоваться для проведения in vivo визуализации. Например, Burdette JE Journal of Mol. Endocrin., 40:253-261, 2008, рассматривается использование компьютерной томографии, магнитно-резонансной визуализации, ультрасонографии, позитрон-эмиссионной компьютерной томографии (SPECT), и так далее. Информация, полученная многими способами in vivo визуализации, как те, что описаны выше, может давать информацию о раковых клетках у пациента.

Если способы являются способами in vitro, биологический образец может быть любым образцом, в котором может присутствовать раковая клетка, включая, но не ограничиваясь тем самым, образцы крови (включая цельную кровь, сыворотку и так далее), ткани, целые клетки (например, интактные клетки) и экстракты из тканей или клеток. Например, метод может включать детекцию CD44 и/или EphA2 на живых клетках или клетках в гистологическом образце ткани. В частности, детекцию можно определить на наружной поверхности живых клеток. Например, образец ткани может фиксироваться (например, при обработке формалином) и может предоставляться заключенным в подложку (например, в парафин) или замороженную нефиксированную ткань.

Анализы могут принимать широкое множество форм, таких как конкуренция, прямая реакция или анализы по типу «сэндвич». Примеры анализов включают вестерн-блот; тесты на агглютинацию; с ферментной меткой и опосредованные иммуноанализы, такие как твердофазные иммуноферментные анализы (ELISA); анализы типа биотин/авидин; радиоиммунные анализы; иммуноэлектрофорезы; иммунопреципитацию и тому подобные. Реакции обычно включают детектируемые метки, конъюгированные с антителом. Метки включают флюоресцирующие, хемилюминесцентные, радиоактивные, ферментные и/или красящие молекулы, или другие способы для детекции образования комплекса между антигеном в образце и антителом или антителами, реагирующими с ним.

Если используется твердая подложка, твердая подложка обычно вначале реагирует с твердофазным компонентом при подходящих условиях связывания, так что антитело в достаточной степени иммобилизуется на подложке. Иногда иммобилизация на подложке может быть достигнута тем, что антитело вначале соединяется с белком с лучшими связывающими свойствами, или который обеспечивает иммобилизацию антитела на подложке без значительной потери антителом активности связывания или специфичности. Подходящие для соединения белки включают, но не ограничиваются тем самым, макромолекулы, такие как сывороточные альбумины, включающие бычий сывороточный альбумин (BSA), гемоцианин фиссуреллы, молекулы иммуноглобулина, тиреоглобулин, овальбумин и другие белки, хорошо известные специалистам в данной области. Другие молекулы, которые могут быть использованы для связывания антител с твердой подложкой, включают полисахариды, полимеры молочной кислоты, полигликолевые кислоты, полимерные аминокислоты, сополимеры аминокислот и тому подобное, с условием, что молекула, используемая для иммобилизации антитела, не оказывает неблагоприятного влияния на способность антитела специфически связывать антиген. Такие молекулы и способы соединения этих молекул с антителами хорошо известны специалистам в данной области техники.

Может быть использован метод ELISA, при этом лунки планшета для микротитрования покрыты антителом по изобретению. Биологический образец, который содержит CD44 и/или EphA2 или в котором предполагается их наличие, затем добавляется к покрытым лункам. После периода инкубации, достаточного для того, чтобы дать антителам возможность связаться, планшет(ы) можно промыть для удаления несвязавшихся компонентов и добавить детектируемые меченые вторичные связывающиеся молекулы. Вторичная связавшаяся молекула имеет возможность реагировать с любым захваченным антигеном, планшет промывается и с использованием методов, хорошо известных в данной области техники детектируется присутствие или отсутствие вторичной связавшейся молекулы.

При желании присутствие или отсутствие связанного CD44 и/или EphA2 из биологического образца может быть легко определено с использованием вторичного связующего соединения, содержащего антитело, нацеленное на лиганды антитела. Например, специалистам известно множество анти-бычьих молекул иммуноглобулинов (Ig), которые могут быть легко конъюгрованы с детектируемой ферментной меткой, такой как пероксидаза хрена, алкалин фосфотаза или уреаза, с использованием способов, известных специалистам в данной области. Подходящий ферментный субстрат затем используется для образования детектируемого сигнала. В других соответствующих вариантах воплощения изобретения конкурентные техники типа ELISA могут осуществляться с использованием способов, известных специалистам в данной области.

Анализы также могут быть проведены в растворе, поскольку антитела и антигены формируют комплексы при условиях, способствующих преципитации. Покрытая антителом частица может контактировать при подходящих условиях связывания с биологическим образцом, в котором, как предполагается, содержится антиген-мишень, для того чтобы обеспечить формирование аггрегатов комплекса частица-антитело-антиген, который может быть преципитирован и отделен от образца с использованием промывания и/или центрифугирования. Реакционная смесь может анализироваться на определение присутствия или отсутствия комплексов антитело-антиген, с использованием любого количества стандартных методов, таких как иммунодиагностические методы, описанные выше.

Альтернативно, анализы для клеточного поглощения в живых клетках могут быть другой диагностической техникой для положительно идентифицированных раковых клеток. Поскольку антитела по изобретению специфично интернализируются клетками, экспрессирующими CD44 и/или EphA2, клетки могут иметь возможность для интернализации антител, и любые антитела, которые не интернализировались, удаляются при промывке (например, промывке кислотой). Интернализируемые антитела могут детектироваться при помощи своей метки, содержащейся в клетках (например, FACS, спектрометр, счетчик радиоизотопов и т.д.). Интернализируемые антитела также могут быть отобраны, как описано в US7,045,283.

Диагностические анализы, описанные здесь, могут использоваться для определения того, имеет ли пациент рак, который более или менее подлежит терапии с использованием основанной на антителах терапии, а также для мониторинга прогресса лечения у пациента. Они также могут быть использованы для оценки курса других комбинационных терапий.

Таким образом, диагностические анализы могут давать информацию для выбора терапии и режима лечения лечащим врачом.

Вышеописанные реагенты, включая антитела настоящего изобретения, могут быть предоставлены в наборах, с соответствующими инструкциями и другими необходимыми реагентами, для того чтобы провести иммуноанализы, как описано выше. Набор также может содержать, в зависимости от использования определенного иммуноанализа, соответствующие метки и другие упакованные реагенты и материалы (т.е. промывочные буферы и тому подобное). Стандартные иммуноанализы, такие как те, что описаны выше, могут быть проведены с использованием этих наборов.

Терапевтические способы

Антитело по изобретению может найти терапевтическое применение при множестве видов рака. Пациенты, у которых есть рак, подозрение на рак или риск развития рака, подходят для терапии и диагностирования, описанных здесь.

Под "лечением" подразумевается, что достигается по меньшей мере облегчение симптомов, связанных с состоянием, причиняющим страдания носителю, где облегчение используется в широком смысле для обозначения по меньшей мере уменьшения размера параметра, например, симптома, связанного с состоянием, подвергаемым лечению. Таким образом, лечение также включает ситуации, когда паталогическое состояние или по меньшей мере симптомы, связанные с ним, полностью подавляются, например, предотвращается их возникновение, или они останавливаются, например, заканчиваются, так что хозяин больше не испытывает этого состояния, или по меньшей мере симптомов, которые характеризуют это состояние. Таким образом, лечение включает: (i) профилактику, то есть уменьшение риска развития клинических симптомов, включая то, что вследствие него не развиваются клинические симптомы, например, предотвращается прогресс болезни к опасному состоянию; (ii) подавление, то есть задержку развития или дальнейшего развития клинических симптомов, например, смягчение или полное подавление активной болезни, например, уменьшение опухолевой нагрузки, при этом уменьшение может включать элиминацию детектируемых раковых клеток (например, метастазирующих раковых клеток); и/или (iii) облегчение, то есть уменьшение вследствие этого клинических симптомов.

Множество пациентов подходят для лечения в соответствии со способами. Обычно такие пациенты являются "млекопитающими", где эти термины широко используются для описания организмов, которые входят в класс млекопитающих, включая отряды хищников (например, собак и кошек), грызунов (например, мышей, морских свинок и крыс) и приматов (например, людей, шимпанзе и обезьян). Во многих вариантах воплощения изобретения пациенты будут людьми.

В соответствующих вариантах воплощения пациент, подвергаемый лечению, имеет клетки, которые экспрессируют (например, сверхэкспрессируют) ассоциированный с опухолью антиген, CD44 и/или EphA2. Антиген экспрессируется на поверхности раковой клетки и часто присутствует в более высоком уровне, чем у соответствующих нераковых клеток. Этот аспект может быть полезен в контексте способов настоящего изобретения, в котором клетки, экспрессирующие или презентирующие CD44 и/или EphA2, могут подлежать лечению антителами настоящего изобретения. Антитело может вводиться пациенту, например, если терапия инициируется в момент, в который присутствие антигена не определяется, и таким образом ее не планируется ограничивать. Также возможно начать терапию антителами перед первым признаком симптомов болезни, при первом признаке возможной болезни или до или после диагноза болезни.

Пролекарственные препараты композиции антител настоящего изобретения также обозреваются в способах, описанных здесь. Такие Пролекарственные препараты представляют собой в целом функциональные производные соединений, которые легко превращаются in vivo в требуемые соединения. Таким образом, в способах настоящего изобретения термин "введение" охватывает введение соединения, специфично раскрытого или с соединением, которое может не быть специфично раскрыто, но которое превращается в специфичное соединение in vivo после введения нуждающемуся в этом пациенту. Стандартные процедуры для отбора и приготовления подходящих пролекарственных производных описаны, например, у Wermuth, "Designing Prodrugs and Bioprecursors" in Wermuth, ed. The Practice of Medicinal Chemistry, 2d Ed., pp.561-586 (Academic Press 2003).

Рак

Композиции антител могут преимущественно использоваться в антираковой терапии, особенно если раковые клетки презентируют EphA2 и/или CD44 на наружной доступной клеточной поверхности. Одним примером является рак, который презентирует эпитоп, связывающийся посредством F2-1A6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1, HH3, 2D6, D2-1A7, D2-1A9, D2-1В1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11.

Композиции антител, описанные здесь, могут вводиться пациенту (например, пациенту, являющемуся человеком) для уменьшения пролиферации раковых клеток, например, для уменьшения размера опухоли, уменьшения раковой нагрузки, уменьшения метастаз и/или улучшения клинического результата у пациентов. Например, композиции антител могут использоваться для нарушения клеточного цикла раковых клеток, и способствовать переходу клетки в апоптоз. Способы, относящиеся к раку, рассматриваемому здесь, включают, например, использование терапии антителами по отдельности или в комбинации с антираковой вакциной или терапией.

Раки, особенно подлежащие терапии антителами, могут быть идентифицированы по способам, подобным диагностическим способам, описанным выше, и другими, известными в данной области техники.

Типы рака

Если антираковая терапия включает введение композиции антител, описанной выше, антираковая терапия может быть частично направлена на раковые клетки, экспрессирующие доступные на поверхности клетки и/или доступные растворителю эпитопы, связывающиеся антителами по изобретению, включая метастазирующий рак.

Примеры раков, презентирующх эпитопы CD44, которые можно лечитьспособами по изобретению, включают раки молочной железы (например, рак базальных клеток молочной железы), кишечника, предстательной железы, поджелудочной железы и т.д., а также аденому и плоскоклеточную карциному головы и шеи (HNSCC). Другие раки, подлежащие лечению, могут также быть любым раком, который является метастатическим или имеет метастатический потенциал.

Примеры раков, презентирующих эпитопы EphA2, включают, но не ограничиваются, раковые клетки эпителиального происхождения. Например, раковые клетки могут происходить из молочной железы (например, рака базальных клеток молочной железы), кожи (например, меланомы), легких, предстательной железы, ободочной кишки и/или яичников. Другие раковые клетки, к которым анти-EphA2 антитела имеют аффинность, могут быть раком печени, плоскоклеточной карциномой пищевода, эпидермоидным раком, раком поджелудочной железы, глиобластомой, нейробластомами, и/или другими раками нервной системы, например.

Следует заметить, что хотя EphA2 или CD44 могут экспрессироваться в более высоких уровнях на раковых клетках по сравнению с нераковыми клетками, это не ограничивает терапий, раскрытых здесь.

Карциномы, которые могут подлежать терапии по способу, раскрытому в настоящей заявке, включают, но не ограничиваются, эзофагеальную карциному, гепатоцеллюлярную карциному, базально-клеточную карциному (форму рака кожи), плоско-клеточную карциному (различные ткани), карциному мочевого пузыря, включая переходно-клеточную карциному (злокачественную неоплазму мочевого пузыря), бронхогенную карциному, карциному ободочной кишки, колоректальную карциному, карциному желудка, карциному легких, включая мелкоклеточную карциному и немелкоклеточную карциному легких, адренокортикальную карциному, тиреоидную карциному, карциному поджелудочной железы, карциному молочной железы, карциному яичников, карциному предстательной железы, аденокарциному, карциному потовых желез, карциному сальных желез, папиллярную карциному, папиллярную аденокарциному, цистаденокарциному, медуллярную карциному, почечно-клеточную карциному, дуктальную карциному in situ или карциному желчного протока, хориокарциному, семиному, эмбриональную карциному, опухоль Вильмса, карциному шейки матки, карциному матки, карциному семенников, остеогенную карциному, эпителиальную карциному и носоглоточную карциному.

Саркомы, которые могут подлежать терапии по способу, раскрытому в настоящей заявке, включают, но не ограничиваются тем самым, фибросаркому, миксосаркому, липосаркому, хондросаркому, хондрому, остеобластическую саркому, остеосаркому, ангиосаркому, эндотелиосаркому, лимфангиосаркому, лимфангиоэндотелиосаркому, синовиому, мезотелиому, саркому Юинга, лейомиосаркому, рабдомиосаркому и другие саркомы мягкой ткани.

Другие солидные опухоли, которые могут подлежать терапии по способу, раскрытому в настоящей заявке, включают, но не ограничиваются тем самым, глиому, астроцитому, медуллобластому, краниофарингиому, эпендимому, пинеалому, гемагиобластому, нейрому слухового нерва, олигодендроглиому, менангиому, меланому, нейробластому и ретинобластому.

Лейкемии, которые могут подлежать терапии по способу, раскрытому в настоящей заявке, включают, но не ограничиваются тем самым, а) хронические миелопролиферативные синдромы (опухолевые заболевания мультипотентных кроветворных стволовых клеток); б) острые миелогенные лейкемии (опухолевые трансформации мультипотентных кроветворных стволовых клеток или кроветворных клеток с ограниченной способностью к дифференцировке в определенном направлении; в) хронические лимфоцитарные лейкемии (CLL; клональная пролиферация иммунологически незрелых и функционально некомпетентных малых лимфоцитов), включая В-клеточную CLL, Т-клеточную CLL пролимфоцитарную лейкемию и лейкоз ворсистых клеток; и d) острые лимфобластические лейкемии (характеризующуюся аккумуляцией лимфобластов). Лимфомы, которые можно лечить, используя способ, включают, но не ограничиваются тем самым, В-клеточные лимфомы (например, лимфому Беркитта); лимфому Ходжкина; неходжкинскую лимфому и тому подобные.

Другие раки, которые могут подлежать лечению в соответствии со способами, раскрытыми в настоящей заявке, включают атипичную менингиому (мозга), карциному островковых клеток (поджелудочной железы), медуллярную карциному (щитовидной железы), мезенхимому (кишечника), гепатоцеллюлярную карциному (печени), гепатобластому (печени), светлоклеточную карциному (почек) и нейрофиброму средостения.

Другие примеры раков, которые могут подлежать лечению с использованием способов, раскрытых в настоящей заявке, включают, но не ограничиваются, раки эпителиального и нейроэктодермального происхождения. Примеры эпителиального происхождения включают, но не ограничиваются, мелкоклеточный рак легких, раки молочной железы, хрусталика глаза, ободочной кишки, поджелудочной железы, почек, печени, яичников и бронхиального эпителия. Способы настоящего изобретения могут быть использованы для лечения раковых клеток, известных сверхэкспрессией CD44 и/или EphA2.

Примеры раков нейроэктодермального происхождения включают, но не ограничиваются тем самым, саркому Юинга, спинальные опухоли, опухоли мозга, первичные нейроэктодермальные опухоли младенцев, тубулокистозную карциному, муцинозную тубулярную и веретеноклеточную карциному, почечные опухоли, опухоли средостения, нейроглиомы, нейробластомы и саркомы у подростков и молодых взрослых.

Комбинации с другими терапиями рака

Как отмечено выше, другой особенностью способов является то, что антитело может вводиться пациенту в комбинации с одной или несколькими другими терапиями. Такая терапия может быть в комбинации с композицией или в конъюгации с антителами по изобретению. В дополнение к физической комбинации с антителами, ракрытыми в настоящей заявке (например, как конъюгат или в липосоме, или в других липидных наночастицах), одно или несколько антираковых средств, таких как перечисленные в таблице 5 выше, могут вводиться в соединении с или одновременно с, до или после введения антитела, раскрытого в настоящей заявке.

Терапия или лечение, отличное от введения антител, может вводиться в любое место, начиная от одновременно до 5 часов или более, например, 10 часов, 15 часов, 20 часов или более, до или после введения антитела по изобретению. Антитело по изобретению и другое терапевтическое вмешательство вводятся или применяются последовательно, например, если антитело по изобретению вводится до или после другого терапевтического лечения. Антитело по изобретению и другая терапия вводятся одновременно, например, если антитело по изобретению и вторая терапия вводятся в одно и то же время, например, если вторая терапия представляет собой лекарство, оно может вводиться вместе с антителом по изобретению как две различные лекарственные формы или комбинироваться в одной композиции, которая вводится пациенту. Безотносительно того, является ли введение последовательным или одновременным, как иллюстрировалось выше, для целей настоящего изобретения лечения считаются вводимыми вместе или в комбинации.

Дополнительный стандарт антираковых терапий, которые могут или же нет вводиться в соединении с антителом по изобретению, включают, но не ограничиваются тем самым, иммунотерапию, химиотерапевтические средства и хирургию (например, как описанные в дальнейшем ниже). Кроме того, терапевтическое введение антитела по изобретению также может быть пост-терапевтическим лечением пациента, проходящего антираковую терапию, где антираковая терапия может быть, например, хирургией, радиационной терапией, введением химиотерапевтических средств и тому подобным. Могут также использоваться антитела, отличные от раскрытых в настоящей заявке, частично моноклональные антитела, которые могут предоставляться для комплемент-опосредованного уничтожения, и/или уничтожения клетки-мишени опосредованного антитело-зависимой клеточной цитотоксичностью,.

Например, антитело по изобретению может вводиться в комбинации с одним или более химиотерапевтическими средствами (например, циклофосфамидом, доксорубицином, винкристином и преднизоном (CHOP)), и/или в комбинации с лечением радиацией и/или в комбинации с хирургическим вмешательством (например, перед или после хирургического вмешательства по удалению опухоли), радиационной терапией, трансплантацией костного мозга, лечением модификатором биологического отклика и определенными комбинациями вышеперечисленного. Радиоционная терапия включает, но не ограничивается, рентгеновское излучение или гамма-излучение, которое доставляется или из внешнего источника, такого как пучок лучей, или путем имплантации маленьких радиоактивных источников.

Пути введения

При осуществлении способов, пути введения (путь, по которому антитело по изобретению доставляется в пациента) могут варьировать, при этом типичные пути введения антитела по изобретению более детально описаны ниже. Антитело по изобретению, одно или в комбинации, описанной выше, может вводиться системно (например, путем парентерального, внутривенного, внутримышечного, интратекального, внутрижелудочкового или подкожного введения) или местно (например, локально в область опухоли, например, при внутриопухолевом введении (например, в солидную опухоль, в пораженный лимфоузел при лимфоме или лейкемии, или путем конвекционной доставки, например, в мозг, например, как раскрыто в US 20090209937), введением в кровеносный сосуд, снабжающий солидную опухоль и т.д.), в полость тела или просвет, или в орган. Эти различные пути введения могут осуществляться при помощи инъекции или вливания.

Лекарственные формы, подходящие для парентерального введения, включают водные и неводные, изотонические стерильные инъекционные растворы, которые могут содержать антиоксиданты, буферы, бактериостатики и растворы, которые делают лекарственную форму изотонической с кровью предполагаемого реципиента, и водные и неводные стерильные суспензии, которые могут включать суспендирующие средства, растворители, загустители, стабилизаторы и консерванты. Лекарственные формы могут быть представлены в однодозовых или мультидозовых запечатанных контейнерах, таких как ампулы и пробирки, и могут храниться в высушенном сублимацией (лиофилизированном) виде, требующем только добавления стерильного жидкого вспомогательного вещества, например, воды для инъекций, непосредственно перед использованием. Приготовленные для немедленного приема растворы и суспензии могут быть приготовлены из стерильных порошков, гранул и таблеток ранее описанного типа. Способы приготовления парентерально вводимых композиций будут известны или очевидны специалистам в данной области и описаны более детально в таких публикациях, как Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pennsylvania (1980).

Лекарственные формы, подходящие для орального введения, могут состоять из (а) жидких растворов, таких как эффективное количество соединения, растворенного в растворителях, таких как вода, солевой раставор или апельсиновый сок; (б) капсул, саше или таблеток, каждая из которых содержит заранее заданное количество активного ингредиента, как твердые частицы или гранулы; (в) суспензии в подходящей жидкости; и (d) подходящие эмульсии. Таблетированные формы могут включать один или более из следующих компонентов: лактоза, маннитол, кукурузный крахмал, картофельный крахмал, микрокристаллическая целлюлоза, гуммиарабик, желатин, коллоидный диоксид кремния, кроскармелоза натрия, тальк, стеарат магния, стеариновая кислота и другие вспомогательные вещества, красители, растворители, буферные средства, увлажняющие средства, консерванты, вкусовые добавки и фармакологически совместимые вспомогательные вещества. Таблетированные формы для рассасывания могут содержать активный ингридиент с вкусовой добавкой, обычно сахарозой и гуммиарабиком, или трагакант, а также пастилы, содержащие активный ингридиент в инертной основе, такие как желатин и глицерин, или сахарозу и гуммиарабик, эмульсии, гели и тому подобное, содержащие, в дополнение к активному ингредиенту, такие вспомогательные вещества, которые известны в данной области техники.

Лекарственные формы настоящего изобретения могут быть сделаны в формах аэрозоля для введения посредством ингаляции. Эти аэрозольные лекарственные формы могут быть помещены в приемлемые сжиженные газы, такие как дихлордифторметан, пропан, азот и тому подобные. Они также могут быть приготовлены как лекарственная форма для неспрессованных препаратов, таких как использующиеся в распылителе или пульверизаторе.

Лекарственные формы, подходящие для местного введения, могут быть представлены как трансдермальные композиции или трансдермальные средства доставки ("пластыри"), кремы, гели, пасты или пены, содержащие, в дополнение к активному ингредиенту, такие носители, которые известны в данной области техники как подходящие.

Лекарственные формы в виде суппозиториев также предоставляются путем смеси различных основ, таких как эмульсионные основы или водно-растворимые основы. Лекарственные формы, подходящие для вагинального введения, могут быть представлены как пессарии, тампоны, кремы, гели, пасты, пены.

Могут быть предоставлены единичные формы дозировки для орального или ректального введения, такие как сиропы, эликсиры и суспензии, при этом каждая единица дозирования, например, чайная ложка, столовая ложка, таблетка или суппозиторий, содержит заранее заданное количество содержащей композиции антител. Подобным образом, единичные формы дозировки для инъекций или внутривенного введения могут содержать в композиции антитело как раствор в стерильной воде, обычный солевой раствор или другой фармацевтически приемлемый носитель.

Терапевтическое введение может повторяться через желаемый период, например, повторяться через период от примерно 1 дня до примерно 5 дней или через каждые несколько дней, например, примерно пять дней, через примерно 1 месяц, примерно 2 месяца и так далее. Введение также возможно перед, во время или после других терапевтических вмешательств, таких как хирургическое вмешательство для удаления раковых клеток. Антитело также может вводиться как часть комбинированной терапии, в которой по меньшей мере иммунотерапия, раковая химиотерапия или радиационная терапия вводится пациенту (как описано более детально выше).

Способы скрининга

Настоящее изобретение также предоставляет способы скрининга антител, специфичных к антигенам, экспрессируемым на клеточной поверхности (например, ассоциированные с опухолью антигены), а также интернализируемых клеткой млекопитающего после связывания с антигеном клеточной поверхности. Некоторые такие способы хорошо известны, см., например, US 6,794,128 и US 7,045,283. В одном варианте воплощения изобретения раскрыты способы для скрининга библиотек антител (например, библиотек фагового дисплея) для поиска антител, которые связываются с определенным антигеном(и) и интернализируются клетками после связывания антигена. Антитело может выбираться по своему связыванию с интересующей ТАА (например, CD44 и/или EphA2) и/или с раковой клеткой, например. Способы включают первоначальную селекцию интернализируемых антител при помощи нескольких независимых циклов скрининга библиотеки, включающего селекцию на интернализацию по меньшей мере на одной клеточной линии млекопитающего. Затем коллекция фагов, которая экспрессирует интеранализируемые антитела, селектировалась на один или более антиген(ов) (напримерпредставленный на дрожжах антиген, например, антиген, известный как ассоциированный с типом клетки млекопитающего) для изоляции фагов, представляющих антитела к желаемому антигену(ам). Способ может быть осуществлен в соответствии с методами фагового дисплея, дрожжевого дисплея и интернализации, описанными в примерах ниже.

Вкратце, неиммунная человеческая scFv фаговая библиотека необязательно истощается контрольными клетками, которые не экспрессируют (например, не экспрессируют в заметной степени) антиген(ы) чтобы провести селекцию на то, чтобы освободиться от антител, которые могут неспецифически взаимодействовать с раковыми клетками. Необязательно истощаемая библиотека инкубируется с живыми раковыми клетками, представляющими интерес. Раковые клетки могут происходить из известного источника или неизвестного источника. Раковые клетки также могут быть получены исключительно из одной клеточной линии или одной опухоли или из множества различных клеточных линий или множества различных опухолей. В процессе отбираются антитела, которые интернализируются клетками благодаря тому, что клеткам дается возможность эндоцитировать антитела и связавшиеся антитела снимаются с поверхности клеток перед процессом извлечения фагов из клеток. Во время пеннинга и селекции интернализированные фаги восстанавливаются из клеточного лизата и амплифицируются. Множественные последовательные циклы селекции (например, два или более) обеспечивают селекцию фагов, представляющих полипептид, который действует как специфичное интернализирующееся антитело для рака, представляющего интерес.

Необязательно перед инкубацией с дрожжевой библиотекой селектируемый фаг может быть истощен контрольными дрожжами (например, дрожжами, которые не экспрессируют представляющий интерес антиген и/или экспрессируют иррелевантный белок). Фаги, предварительно селектированные на интернализацию раковыми клетками, затем инкубируются с дрожжами, представляющими одну или несколько интересующих TAAs (например, внеклеточный домен EphA2). Дрожжи, инкубируемые с фагами для дальнейшей селекции, могут экспрессировать множество TAAs, каждый представляет собой различный пептидный фрагмент того же белка полноразмерный и/или каждый происходит из различной ТАА. Если дрожжи представляют множество ТАА, антитела, специфичные для различных ТАА, могут селектироваться параллельно. ТАА могут также охватывать известный ассоциированный с опухолью антиген и/или антиген, чья связь с раком еще не доказана (например, предполагается, что он связан с раком). После инкубации фаг, связанный с дрожжами, представляющими интересующие ТАА, элюируется. Множественные последовательные циклы селекции (например, два или более) могут быть проведены на дрожжевой библиотеке.

Строгость отбора на дрожжевой библиотеке может возрастать после каждого успешного цикла (например, двух или более). Многие технологии, известные специалистам, могут быть использованы для повышения специфичности восстановленного фага. Примеры включают повышенное количество промывок, повышенные концентрации детергента, повышенные концентрации солей и добавление известных макромолекулярных ингибиторов (например, BPTI, Ecotin и/или ранее идентифицированных антител). Характеризация антител может включать ELISA и анализы ингибирования. Детали анализов, проводимых в способе селекции и изоляции полипептида, который может действовать как анти-ТАА агент, известны в данной области техники.

По сравнению с использованием фага для представления антигенов, использование простого эукариота, такого как дрожжи, для представления антигена, может приводить к большей доле антигенов, которые представляются в своей правильной конформации.

Наборы и системы

Также предоставляются наборы и системы, которые находят применение при осуществлении способов, как описано выше. Например, наборы и системы могут включать одну или несколько композиций, описанных в настоящей заявке, таких как анти-СП44 и/или анти-EphA2 антитело (например, 2D6, D2-1A7, D2-1A9, D2-1B1, А3Н9, A3G3, A3D10, A3D1, A3C8, 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7, 1D8 или 15Н11; или F2-1А6, F2-1H9, Е8Н11, Е8Н7, E8G12, E8F11, Е8С9, D6G9, D6D3, D1C5, D1D1, НВ8, НС2, НС4, НЕ3, HF1 или HH3), нуклеиновую кислоту, кодирующую то же самое (особенно нуклеиновую кислоту, кодирующую CDR тяжелой и/или легкой цепи любого антитела по изобретению, описанного выше), или клетку, содержащую то же самое. Другие опциональные компоненты набора включают: буферы и т.п., для введения антитела по изобретению, и/или для проведения диагностического анализа. Рекомбинантные нуклеиновые кислоты набора могут также иметь сайты рестрикции, сайты множественного клонирования, сайты праймеров и т.д. для содействия их лигированию с константными участками нуклеиновых кислот. Различные компоненты набора могут присутствовать в различных контейнерах или определенные совместимые компоненты могут быть заранее скомбинированы в одном контейнере, по желанию.

Наборы и системы для осуществления способов могут включать одну или более фармацевтических лекарственных форм, которые включают композиции антител, описанные здесь. Таким образом, наборы могут включать одну фармацевтическую композицию, присутствующую в одной или нескольких дозировках. Наборы также могут включать два или более отдельных фармацевтических композиций.

В добавление к вышеперечисленным компонентам, наборы могут также включать инструкции по осуществлению способов. Эти инструкции могут присутствовать в наборах в различных формах, одна или более из которых может присутствовать внутри набора или на наборе. Одной формой, в которой эти инструкции могут присутствовать, является напечатанная информация на подходящей среде или субстрате, например, кусок или куски бумаги, на котором напечатана информация, в или на упаковке набора, как вкладыш в упаковке и т.д. Другим средством может быть читаемое на компьютере средство, например, дискета, CD и так далее, на котором записана информация. Другим средством, которое может присутствовать, является адрес вебсайта, который может быть использован при посредстве Интернета для доступа к информации на удаленном сайте. Любые подходящие средства могут присутствовать в наборах.

Набор может быть предоставлен для применения при лечении хозяина, подверженного клеточной пролиферативной болезни. Такой набор включает фармацевтическую композицию, содержащую антитело, специфичное к EphA2 или CD44, и инструкции для эффективного использования фармацевтической композиции в способе лечения хозяина, подверженного раковому состоянию, путем ингибирования роста раковых клеток у пациента. Такие инструкции могут включать не только подходящие технологические свойства, режим дозировки и способ введения, и тому подобное, но могут также включать инструкции по необязательному скринингу пациента на болезнь, связанную с CD44- и/или EphA2. Этот аспект может помочь тому, кто работает с набором, в оценке потенциальной реактивности пациента к лечению антителом настоящего изобретения, включая время и продолжительность лечения в соответствии с типом и стадией роста рака. Таким образом, в другом варианте воплощения изобретения набор может включать антитело или другой реагент для детекции эпитопа EphA2 или CD44 на наружной доступной поверхности раковой клетки. В другом варианте воплощения изобретения, набор включает антитело, которое содержит конъюгат с детектируемой меткой, такой как флюорофор.

Термин "система" при употреблении в настоящей заявке означает коллекцию антител, описанных здесь, и одно или более вторичных терапевтических средств, представленных в одном или раздельных композициях, которые поставляются совместно для цели осуществления способов. Например, раздельно полученные антитела, специфичные к ТАА и химиотерапевтическим формам дозировки, поставляющиеся вместе и совместно вводимые пациенту, представляют собой систему согласно настоящему изобретению.

Примеры

Следующие примеры предлагаются для иллюстрации, но не для ограничения ни одного из вариантов воплощений изобретения, предоставленных в настоящем описании.

Следующие способы и материалы были использованы в настоящем примере.

Материалы и методы

Клеточные линии, среды, антитела и полноразмерные кДНК клоны. Клеточные линии рака молочной железы MCF7, T47D, MDAMB453, MDAMB231, эпителиальные клетки молочной железы человека (НМЕС) и SUM52PE были получены из АТСС и Clontech (НМЕС), или из коллекции, разработанной в лабораториях Dr. Steve Ethier (SUM52PE). Клеточные линии культивировались с использованием условий, описанных ранее (Neve RM et al. (2006) Cancer Cell 10:515-27). Штамм дрожжей EBY100 рос на YPD среде (Current Protocols in Molecular Biology, John Wiley and Sons, Chapter 13.1.2). EBY100, трансфицированный экспрессионным вектором pYD2 (Razai A et al. (2005) J Mol Biol 351:158-69), селектировался на SD-CAA среде (Current Protocols, Chapter 13). Aga2p гибридный антиген экспрессировался на дрожжевой поверхности посредством индукции в SG-CAA среде (идентичной SD-CAA среде за исключением глюкозы, замененной на галактозу) при 20°С в течение 24-48 ч как описано ранее (Feldhaus MJ et al. (2003) Nat Biotechnol 21:163-70). Бактериальные штаммы Е.coli DH5α и TG1 использовались для приготовления плазмидной ДНК и экспрессии растворимых scFv антител соответственно. SV5 антитело было очищено из супернатанта гибридомы с использованием Белка G и напрямую помечено Alexa-488 или Alexa-647 с использованием набора, предоставленного производителем (Invitrogen; Carlsbad, СА). Биотин, конъюгированный с кроличьим анти-fd бактериофагом, был приобретен у Sigma и использован для детекции фаговых антител. Моноклональное антитело D7 к EphA2 ECD было приобретено у Upstate Biotech, поликлональное козье анти-EphA2 и рекомбинантное мышиное Эфрин Ale человеческим Fc гибридным белком у R&D Systems, анти-CD44 антитело для вестерн-блоттинга у NeoMarkers и моноклональное анти-CD44, распознающее линкерный домен, у Abcam. Полноразмерный сДНК EphA2 и CD44 была получена у АТСС.

Фаговая библиотека, использованная в примерах ниже, содержит неиммунные человеческие одноцепочечные Fv антитела (scFv). Вкратце, библиотека была создана путем конструирования вначале сДНК библиотеки из РНК клеток селезенки человека и лимфоцитов периферической крови. Репертуар тяжелых цепей и легких цепей были соединены для формирования генного репертуара scFV. Генный репертуар одноцепочечных Fv (scFv) из нативной фагмидной библиотеки антител был субклонирован в правильный фаговый вектор для создания мультивалентной библиотеки scFv, представленной на фагах. Детали см. в Sheets MD et al. (1998) Proc Natl Acad Sci USA 95:6157-62 и O'Connell D et al. (2002) J Mol Biol 321:49-56.

Антиген и домены антигена, представленные на поверхности дрожжей. Были разработаны праймеры, отжигающиеся с кДНК антигена и имеющие 25-членную перекрывающуюся последовательность с pYD2/NcoI-NotI-расщепляемым вектором, для амплификации антиген доменов посредством ПЦР с использованием Pfu полимеразы. После гелевой очистки амплифицированный фрагмент антигена и NcoI-NotI-расщепленный pYD2 вектор были использованы для трансформации обработанных LiAc клеток EBY100 посредством восстановления «разрыва » (Gietz RD et al. (1991) Yeast 7:253-63; Orr-Weaver TL et al. (1983) Proc Natl Acad Sci USA 80:4417-21). Трансформирующие смеси культивировались и субкультивировались в SD-CAA, и индуцировались посредством культивирования в SG-CAA среде в течение 24-48 часов при 18°С. Чтобы подтвердить дисплей антигена, анти-EphA2 (R&D) и рекомбинантный мышиный Эфрин A1 (R&D) анализировались на связывание с дрожжами, представляющими EphA2 ECD, и анти-СВ44 антитело (Abcam) анализировалось на связывание с CD44 доменом 1 посредством проточной цитометрии. Вкратце, индуцированные дрожжевые клетки (106 клеток), на которых представлены специфичные домены антигена инкубировались с моноклональными или поликлональными антителами (1 мкг/мл) в течение 1 ч при 4°С, детектировались с использованием анти-козьего РЕ конъюгата к анти-EphA2, античеловеческого (Fc специфичного) к рекЭфринA1-человеческому гибридному белку Fc и анти-кроличьему РЕ к анти-CD44 соответственно, и совместно окрашивались с SV5-Alexa-647.

Оптимизация элюирующего буфера для селекции фаговых антител. Различные элюцирующие буферы, включающие фосфатно-солевой буфер, рН 7.4 (PBS), 40 мМ 2-меркаптоэтиламина (2-МЕА), 1 мМ дитиолтриэтол (DTT), 100 мМ триэтиламина (TEA) и 100 мМ Глицина/150 мМ NaCl/0.1% BSA/0.5% Tween 20 оценивались по их способности элюировать связавшиеся фаги, с дрожжевой поверхности. Время элюирования составляло 1 час при 37°С для PBS, 2-МЕА и DTT, и 2 минуты при комнатной температуре для TEA и глицина. После нейтрализаии с 10 мМ цистеином для элюирования 2-МЕА и DTT, и ½ объемом 1М Tris-HCl (pH 7.4) для элюирования TEA и глицином, элюционная смесь была использована для заражения экспоненциально растущих клеток Е.coli TG1, и титр фага определялся серийным разведением на устойчивой к тетрациклину среде.

Селекция фаговых антител, специфичных к представленным на дрожжах доменам антигенов. Человеческие эпителиальные клетки млекопитающих (НМЕС), люминальная клеточная линия рака молочной железы SUM52PE, T47D и MDAMB453 были использованы для истощения фаговой библиотеки неспецифичных связующих веществ посредством инкубации 1012 фаговых частиц (Sheets MD et al. (1998) Proc Natl Acad Sci USA 95:6157-62; Huie MA et al. (2001) Proc Natl Acad Sci USA 98:2682-7) с 108 клеток в течение 4 ч при 4°С. Истощенная фаговая библиотека затем инкубировалась с 5×106 клеток из клеточной линии базального рака молочной железы MDAMB231B течение 1 ч при 4°С, после этого промывались холодным PBS и инкубировались с предварительно нагретой до 37°С средой /10% FBS в течение 30 мин при 37°С, чтобы сделать возможным опосредованный рецептором эндоцитоз фаговых частиц. Клеточная поверхность была оголена посредством трех инкубации в течение пяти минут с 4 мл глициновым буфером (150 мМ NaCl, 0,1 М глицина, pH 2.5). Клетки затем были обработаны трипсином, промыты PBS, лизированы 1 мл 100 мМ TEA в течение четырех минут при 4°С и нейтрализованы 0,5 мл 1М Tris (pH 7,4). Поглощенный фаг (TEA лизат) был амплифицирован для дальнейших селекции.

После двух циклов селекции на клетках MDAMB231, поликлональные фаговые антитела были использованы для селекции фаговых антител, специфичных к представленным на дрожжах антигенам EphA2 (Y-EphA2) и линкерному домену CD44 (Y-CD44 D1). Индуцированные дрожжевые клетки, представляющие нерелевантный белок, использовались для истощения неспецефических связывателей посредством инкубации 2,5×1011 фаговых частиц с 10 дрожжевых клеток в течение 2 ч при 4°С. Отфильтрованный супернатант, содержащий истощенную фаговую библиотеку, затем инкубировался с 2×107 представленным на дрожжах специфичным доменом антигена в течение 1 ч при 4°С. Дрожжевые клетки были промыты десять раз холодным PBS и осаждены центрифугированием. Связавшиеся фаговые антитела были элюированы посредством инкубации дрожжевых клеток с 1 мл 100 мМ Глицина/150 мМ NaCl/0,l% BSA/0,5% Tween 20, нейтрализованы 0,5 мл 1М Tris-HCl (pH 7.4) и амплифицированы для дальнейшего цикла селекции. Во втором цикле селекции 2×107 дрожжевых клеток были использованы для обоих антигенов, тогда как 2,1×1012 фаговых частиц из первого цикла селекции были использованы для CD44 домена 1 по сравнению с 3,4×1011, использованными для EphA2. Были проведены два цикла селекции.

Характеризация фаговых антител. После двух циклов селекции отдельные фаговые антитела были приготовлены путем роста отдельных колоний в 96-луночных планшетах для микротитрования, как описано (O'Connell D et al. (2002) J Mol Biol 321:49-56). Связывание каждого фагового антитела с дрожжами, представляющими антиген, определялось путем инкубации 105 дрожжевых клеток с 100 мкл фагового супернатанта, разведенного в FACS буфере (PBS с 1 мМ MgCl2, 0,1 мМ CaCl2 и 0,3% BSA) в течение 2 ч при 4°С в конических 96-луночных планшетах для микротитрования, после чего антитела инкубировались с биотинилированным анти-fd антителом и конъюгатом стрептавидин-фикоэритрин (РЕ) (Jackson) и анализировались с использоанием FACS LSRII (Becton Dickinson). Число уникальных фаговых антител определялось путем паттернинга BstNI расщепления 18 scFv генов, амплифицированных ПЦР из инфицированных фагом бактерий (Marks, JD et al. (1991) J Mol Biol 222:581-97) и подтверждалось ДНК-секвенированием.

Для связывания с клетками рака молочной железы и экспериментов по конкурированию с Эфрином A1, 5×104 клетки MDAMB231 инкубировались с 108 фаговыми антителами в присутствии рекомбинантного мышиного Эфрина A1 (R&D) в концентрации от 0 до 1000 нг/мл в течение 2 ч при 4°С. Связавшиеся фаговые антитела были детектированы при инкубации клеток с анти-fd антителом, конъюгированным с биотином (1 мкг/мл) (Sigma) в течение 30 минут при 4°С и стрептавидином-РЕ (Jackson), после чего следовал анализ проточной цитометрии.

Иммунопреципитация и вестерн-блот с использованием scFv антител. Клеточные экстракты MDAMB231 были приготовлены с использованием 1 мл лизирующего буфера на культуральную колбу Т75, содержащем 0,5% NP40, 50 мМ Tris (pH 7.4), 150 мМ NaCl, 2 мМ DTT и смесь ингибиторов протеаз (Sigma). Растворимые scFv антитела с (His)6 меткой на С-конце были произведены путем субклонирования scFv генов из фагового вектора в экспрессионный вектор pUC119mycHis (Schier R et al. (1995) Immunotechnology 1:73-81), после чего следовала очистка из периплазматической фракции Е.coli TG1 при помощи IMAC 51 с использованием Ni-NTA колонки (Qiagen) и гель-фильтрации (Schier R et al. (1996) J Mol Biol 255:28-43). Клеточные экстракты инкубировались с scFv 26 мкг/мл в течение 2 ч при 4°С до того как иммунные комплексы захватывались на Ni-NTA агарозе. Захваченные агарозой иммунные комплексы затем промывались 5 раз в лизирующем буфере и нагревались до 94°С в течение 4 минут в невосстановительном белковом загрузочном буфере. Иммунопреципитаты разделялись SDS-PAGE и анализировались при помощи вестерн-блоттинга с использованием анти-EphA2 (Upstate) и анти-CD44 (NeoMarkers) антител.

Иммунофлюоресценция. Клетки MDAMB231 ростили на покровных стеклах до 70% конфлюэнтности в 12-луночных планшетах и инкубировались с 1011 фаговыми антителами в течение трех часов 37°С. Покровные стекла промывались один раз PBS, три раза по пять минут глицин буфером (50 мМ глицина (рН 2,5), 150 мМ NaCl), нейтрализовались РЕМ (80 мМ Potassium PIPES (рН 6,8), 5 мМ EGTA (рН 7), 2 мМ MgCl2) и фиксировались РЕМ, содержащим 4% (вес/объем) параформальдегид в течение 30 минут на льду. Клетки были погашены 0,1 М NH4Cl, пермеабилизованы 0,5% Triton X-100 и блокированы 5% обезжиренным сухим молоком в TBS-T буфере в течение ночи при 4°С. После блокирования эндогенным биотином с Авидин-Биотин Набором (Lab Vision), внутриклеточные фаги детектировались биотинилированным анти-fd поликлональным антителом (Sigma) и стрептавидином Texas Red (Amersham). Покровные стекла переворачивались на сторону среды для заливки и микроскопические изображения были получены с помощью Zeiss LSM 510 лазерного сканирующего микроскопа (Zeiss, Germany).

Пример 1. Дисплей ассоциированных с опухолью антигенов на поверхности дрожжей.

Два ТАА (CD44 и EphA2) сверхэкспрессируются в базальных раках молочной железы (Hamilton SR et al. (2007) J Biol Chem 282:16667-80) и были отобраны для представления на поверхности Sachromyces cerevisiae. Для представления на дрожжевой поверхности полноразмерный внеклеточный домен (ECD) of EphA2 (аа 1-510) и линкерный домен CD44 (аа 1-149) (домен 1) были клонированы в дрожжевой вектор для дисплея pYD2 для (C-терминального) слияния с Aga2 (Razai А et al. (2005) J Mol Biol 351:158-69). Векторная ДНК была использована для трансформации EBY100, и был индуцирован дисплей на клеточной поверхности. Оба внеклеточных домена CD44 и EphA2 были хорошо представлены на дрожжевой поверхности, что количественно определялось с помощью моноклонального антитела к C-концевому маркеру эпитопа (фигура 1). Специфическое связывание с представленными на дрожжах EphA2 и CD44 внеклеточными доменами EphA2 природного лиганда Эфрин A1, и антителами к EphA2 и CD44 подтверждает, что домены не просто представляются в форме, которая может связываться с лигандом и может специфически распознаваться антителами (фигура 1).

Пример 2. Эффективное восстановление антиген специфичных фаговых антител из дрожжевой клеточной поверхности, представляющей антиген

Фаговое антитело scFv, которое специфически связывается с EphA2, использовалось для изучения способности селектировать фаговые антитела на представленном на дрожжах антигене. Приблизительно 1011 фаговых частиц, представляющих анти-EphA2 человеческий scFv 2D6, инкубировались с 108 дрожжевыми клетками, представляющими антиген EphA2 ECD (Y-EphA2), который является мишенью. В качестве контроля идентичное число анти-EphA2 фаговых антител инкубировались с 108 дрожжевыми клетками, представляющими нерелевантный scFv (Y-CON). Восстановление анти-EphA2 фагового антитела из дрожжей, представляющих EphA2 ECD, было более чем в 104 раза больше, чем восстановление анти-EphA2 фагового антитела из дрожжей, представляющих scFv (фигура 2, панель А). Для определения оптимального буфера для элюирования фаговых антител с дрожжевой поверхности, оценивались различные буферы (PBS, 2-MEA, DTT, триэтиламин (TEA) и глицин). Хотя дисплей на дрожжевой поверхности ТАА происходит вследствие дисульфидной связи между Aga2 и Aga1 белками на дрожжевой поверхности, восстанавливающие средства, включая 2-MEA и DTT, приводили к худшему восстановлению жизнеспособных фаговых антител, чем спонтанная диссоциация фага путем инкубации в PBS (фигура 2, панель В). Напротив, элюирование с высоким рН TEA буфером или низким рН глициновым буфером повышало число восстановленных жизнеспособных фагов приблизительно в два раза, при этом глицин с низким рН был оптимальным элюирующим буфером из изученных. Этот элюирующий буфер использовался для последующих исследований.

Для определения минимальной частоты специфичного антитела внутри библиотеки, которая может быть обогащена и селектирована, фаги, представлявшие анти-EphA2 антитела, серийно разводились от 109 до 100 кое и затем смешивались с 109 хелперным фагом VCSM13. Фаговые смеси инкубировались с 107 дрожжевыми клетками, представляющими EphA2 ECD или с дрожжами, представляющими CD44 домен 1, после чего следовали промывка, элюирование и титрование восстановленных фагов. При введении 102 специфических фаговых частиц около 12 фагов были восстановлены из дрожжевых клеток, представляющих EphA2, тогда как введение по меньшей мере 105 фагов требовалось чтобы фаги были представлены в выходе, когда селектировались на CD44 (фигура 2, панель С). Среднее восстановление фаговых частиц составляло 6,5×10-2 для специфической пары антиген-антитело и 6,5×10-5 для несоответствующей пары (таблица 6), соответственно. Эта высокая степень восстановления для специфических фагов по сравнению с неспецифическими подтверждала, что было бы возможно обогащать и селектировать фаговые антитела на представляемом на дрожжах антигене.

Таблица 6. Восстановление специфичных фаговых антител из представленных на дрожжах антигенов.

Указанный представляемый дрожжами антиген инкубировался с 109 фагов и определялся титр связавшихся фагов. Результаты выражены как соотношение вышедший /введенный фаг. Y = дрожжи, представляющие антиген; PhAb = представляемое фагом антитело.

Ag: Ab PhAb Вышедний / Введенный
Y-EphA2 ECD: PhAb-EphA2 6×10-2
Y-CD44 D1: PhAb-CD44 7×10-2
Y-EphA2 ECD: PhAb-CD44 3×10-5
Y-CD44 D1: PhAb-EphA2 1×10-6

Пример 3. Селекция антиген-специфичных фаговых антител на представленных на дрожжевых клетках опухолевых антигенах

Стратегия, использованная для отбора интернализирующихся фаговых антител к определенным опухолевым антигенам, показана на фигуре 3. Чтобы убедиться, что фаговые антитела связались с опухолевыми антигенами, как представлено на поверхности человеческих опухолевых клеток, и могут быть интернализированы после связывания, использовалась стартовая фаговая библиотека. Поликлональные фаги, полученные после второго цикла селекции неиммунной человеческой scFv фаговой библиотеки (O'Connell D et al. (2002) J Mol Biol 321:49-56), селектировались для эндоцитоза в MDAMB231 опухолевые клетки. На основе факта, что клетки рака молочной железы базального подтипа сверхэкспрессируют EphA2 (Neve RM et al. (2006) Cancer Cell 10:515-27) и CD44 (Hamilton SR et al. (2007) J Biol Chem 282:16667-80), фаги, полученные при селекции на клетках рака молочной железы базального подтипа MDAMB231 селектировались независимо на дрожжах, представляющих EphA2 ECD (аа 25-534) и CD44 домен 1 (аа 21-169). Чтобы удалить фаговые антитела, которые связались с нерелевантными белками на дрожжевой поверхности, 2,5×1011 фагов, полученных во втором цикле MDAMB231 селекции, инкубировались вначале с 1×109 дрожжевых клеток, представляющих scFv 4Е17 (Y-CON). Затем истощенная фаговая библиотека инкубировалась с 2×107 дрожжевыми клетками, представляющими релевантный антиген (Y-Ag) (фигура 3, панель А).

Для селекции как EphA2 ECD, так и CD44 домена 1, число фагов, восстановленных из каждой дрожжевой клетки во втором цикле селекции возрастало более чем в 40 раз по сравнению с первым циклом (таблица 7), что подтверждает обогащение для фагов, связывающихся с дрожжами, представляющими опухолевые антигены. Это было подтверждено путем использования поликлонального фага для окрашивания дрожжей, представляющих антигены. Как из первого, так и из второго циклов селекции поликлональные фаговые антитела показывали специфическое связывание с антигенным доменом, который использовался для селекции, с более сильным окрашиванием после второго цикла селекции (фигура 3, панель В). Напротив, перед селекцией введенной фаговой библиотеки антител не давал сигнала выше фона дрожжевых клеток, представляющих или EphA2, или CD44. Связывание было специфичным для дрожжей, представляющих антиген, поскольку поликлональный фаг не связывался с дрожжевыми клетками, представляющими иррелевантный белок (scFv 4E17) (фигура 3, панель В). Для определения частоты связывания фаговых антител, было отобрано 96 отдельных клонов, произведены фаги, и фаги анализировались на связывание с дрожжами, представляющими опухолевый антиген. После одного цикла и двух циклов селекции 31/96 (32,2%) и 39/96 (40,6%) клонов из EphA2 селекции связывали дрожжевые клетки, представляющие EphA2 ECD, и 11/96 (11,7%) и 21/96 (21.9%) клонов из CD44 селекции связывались с дрожжами, представляющими CD44, соответственно (фигура 3, панель С)

Таблица 7. Селекция фага, представляющего scFv антитело, на представленных на дрожжах антигенах.

Соотношения количества введенного и вышедшего фага в течение первого и второго циклов селекции на дрожжах, представляющих антиген.

Антиген Цикл 1 селекции
Введено (кое) Вышло (кое) Вышло Фаг
Введено Дрожжи
EphA2-ECD 2,5×1011 3,6×106 1,3×10-5 0,18
CD44-ECD D1 2,5×1011 9,8×106 3,9×10-5 0,49
Антиген Цикл 2 селекции
Введено (кое) Вышло (кое) Введено Фаг
Вышло Дрожжи
EphA2-ECD 3,4×1011 2,4×108 7×10-4 12
CD44-ECD D1 2,1×1012 4,3×108 2×10-4 20

Пример 4. Идентификация и характеризация фаговых антител

Отдельные фаговые антитела из второго цикла селекции, которые связывались с представленным дрожжами опухолевым антигеном, анализировались при помощи ПЦР фингерпринтинга ДНК-секвенирования scFv генов. Результаты показаны на фигуре 9, где показаны нуклеиновая кислота и аминокислотные последовательности для каждого из изолированных клонов. Смысловая нить показана как верхняя нить последовательности нуклеиновой кислоты на фигуре 9. CDR и каркасные участки идентифицировались на основе Kabat базы данных для каждого антитела, как показано на фигурах 7 и 8.

Три уникальных человеческих scFv антитела (D2-1A7, D2-1A9 и D2-1B1) были идентифицированы, как связывающиеся с EphA2, и два уникальных scFv (F2-1A6 и F2-1Н9) были идентифицированы как связывающиеся с CD44 ECD доменом 1. Характеристика каждого из этих scFv на дрожжах, представляющих EphA2-ECD (Y-EphA2 ECD), CD44 ECD домен 1 (Y-CD44 ECD D1) и полноразмерный ECD (Y-CD44 ECD), и scFv 4E17 (Y-CON) показала, что каждый scFv был специфичен для своего антигена-мишени (фигура 4, панель А). Каждое уникальное фаговое антитело также анализировалось по своей способности связываться с первоначальной селектирующейся линией опухолевых клеток MDAMB231 при помощи проточной цитометрии. Каждое фаговое антитело интенсивно окрашивало MDAMB231 клетки (фигура 4, панель В). Поскольку первоначальная селекция библиотеки фаговых антител имела цель сделать мишенью рецепторы клеточной поверхности, специфичные к базальному подтипу клеток рака молочной железы, определялось связывание селектированных mAbs с клеточными линиями базального и люминального рака молочной железы. Каждое mAb было сравнительно специфично к клеточным линиям базального рака молочной железы по сравнению с клеточными линиями люминарного рака молочной железы (фигура 4, панель С).

Пример 5. Специфичность связывания фаговых антител

Связывание идентифицированных EphA2 и CD44 антител с нативными антигенами также было подтверждено путем иммунопреципитации рецепторов из клеточных экстрактов MDAMB231 клеток, после чего следовал вестерн-блоттинг с мышиными моноклональными антителами, специфичными к EphA2 и CD44 (фигура 5, панель А). Затем изучалась специфичность EphA2 mAbs. Способность каждого из EphA2 mAbs оценивалась по их способности конкурировать с природным лигандом, эфрином А1, за связывание с EphA2 на поверхности MDAMB231 клеток. Хотя IC50 эфрина А1 для фаговых антител D2-1A7 и D2-1A9 в заданной концентрации отличалась в 9 раз, 1 мкг/мл эфрина А1 может полностью блокировать клеточное связывание как D2-1A7, так и D2-1A9 фаговых антител (фигура 5, панель В), показывая, что эти два антитела связывают эпитопы, которые перекрываются с Эфрином А1.

Пример 6. Фаговые антитела интернализирующиеся клетками MDAMB231

Поскольку фаговые антитела, идентифицированные по биопанингу представленного на дрожжах антигена, первоначально селектировались по способности эндоцитироваться в клетки MDAMB231 (фигура 3, панель А), ожидалось, что они будут эффективно поглощаться. Для определения того, эндоцитировались ли фаговые антитела D2-1A7, D2-1A9 и F2-1A6, фаговые антитела инкубировались с клетками MDAMB231 при 37°С, чтобы дать возможность рецептору опосредовать эндоцитоз, связавшиеся с поверхностью фаги удалялись путем промывания в буфере с низким рН, и поглощенные фаги окрашивались анти-fd антителом и наблюдались с использованием конфокальной микроскопии (фигура 6). Как D2-1A7, так и D2-1A9 анти-EphA2 антитела давали сильное внутриклеточное окрашивание, контрольные фаги не давали окрашивания, и F2-1A6 анти-CD44 антитела давали паттерн окрашивания, отличавшийся от паттерна окрашивания анти-EphA2 фага.

Пример 7. Fd фаги и фагмидные антитела, специфичные к CD44 или EphA2

Для селекции специфичных к антигену антител без использования клеток млекопитающих, неиммунная человеческая v фаговая библиотека scF (Sheets, 1998; Huie, 2001) инкубировалась с дрожжами, представляющими ассоциированные с опухолью антигены (TAAs) без предварительной селекции раковых клеток. В частности, 1012 fd-фаговые частицы (Huie et al. (2001) supra) или 1013 фагмидно-фаговые частицы (Sheets et al (1998) supra) вначале инкубировались с 1010 дрожжевыми клетками, представляющими иррелевантный белок в течение 2 ч при 4°С для удаления фаговых антител, связывающих обычные дрожжевые белки. Истощенная фаговая библиотека затем инкубировалась с 108 дрожжевыми клетками, представляющими специфичный домен антигена для 2 ч при 4°С (например, EphA2 или CD44). Дрожжевые клетки промывались холодным PBS десять раз и осаждались центрифугированием. Связавшиеся фаговые антитела элюировались путем инкубации дрожжевых клеток с 1 мл 100 мМ Глицина/150 мМ NaCl/0,l% BSA/0,5% Tween 20, нейтрализованных 0,5 мл 1М Tris-HCl (рН 7.4) и амплифицировались для другого цикла селекции. Во втором цикле селекции 2×107 дрожжевых клеток использовались для обоих антигенов, тогда как в качестве введенной фаговой библиотеки использовались фаговые частицы из первого цикла селекции с 1011 фагов для fd библиотеки и 1012 для фагмидной библиотеки, соответственно. Два цикла селекции проводились для обогащения фаговых антител, специфичных к ТАА, используемых для селекции. Если два цикла селекции не обогащали ТАА специфичные антитела, проводился третий цикл селекции, по тому же протоколу, что и второй цикл селекции.

Способ для скрининга и характеризация моноклональных фаговых антител был таким же, как описано в примерах 4 и 5.

Пять fd фаговых антител, обозначенных Е8Н11, Е8Н7, E8G12, E8F11 и Е8С9, были созданы для CD44 линкерного домена и были специфичны к CD44 линкерному домену.

Два fd фаговых антитела, обозначенных D6G9 и D6D3, были созданы для CD44s (стандартная форма) и были специфичны к CD44s.

Два фагмидных антитела, обозначенных D1C5 и D1D1, были созданы для CD44 линкерного домена, и были специфичны к CD44 линкерному домену. Шесть фагмидных антител, обозначенных НВ8, НС2, НС4, НЕ3, HF1 и HH3, были созданы для CD44s и были специфичны к CD44s.

Пять fd фаговых антител, обозначенных А3Н9, A3G3, A3D10, A3D1 и А3С были созданы для EphA2 и были специфичны к EphA2. Восемь фагмидных антител, обозначенных 1А3, 1А5, 1А8, 1А12, 1В2, 1С2, 1С7 и 1D8, были созданы для EphA2 и были специфичны к EphA2.

Другое fd фаговое антитело, обозначенное 15Н11, было создано для EphA2 и было специфично к EphA2.

Следует понимать, что примеры и воплощения изобретения, описанные в настоящей заявке, служат только для иллюстративных целей, и что различные модификации или изменения в их свете будут очевидны специалистам в данной области техники и включены в сущность и сферу этой заявки и объем прилагаемой формулы изобретения. Все публикации, патенты и заявки на патенты, цитируемые здесь, тем самым включены в настоящую заявку во всей полноте для всех целей посредством ссылки. Если антитело по изобретению, способ и композиция в частности были показаны и описаны со ссылками на их предпочтительные воплощения, специалистам в данной области будет понятно, что различные изменения в форме и деталях могут быть сделаны в пределах объема изобретения, охваченного прилагаемой формулой изобретения.

1. Выделенная нуклеиновая кислота, содержащая последовательность нуклеотидов, кодирующую аминокислотную последовательность полипептида вариабельной области легкой цепи (VL), содержащего VL CDR1, содержащий аминокислотную последовательность QGDSLRSYYAS (SEQ ID NO: 17), VL CDR2, содержащий аминокислотную последовательность GENNRPS (SEQ ID NO: 71), и VL CDR3, содержащий аминокислотную последовательность NSRDSSGTHLTV (SEQ ID NO: 60).

2. Полипептид вариабельной области легкой цепи (VL), кодируемый нуклеиновой кислотой по п.1.

3. Экспрессирующий вектор, содержащий нуклеиновую кислоту по п.1.

4. Рекомбинантная клетка-хозяин для применения при получении полипептида вариабельной области легкой цепи (VL) анти-EphA2 антитела, где рекомбинантная клетка-хозяин содержит:
экспрессирующий вектор, содержащий последовательность нуклеотидов, кодирующую аминокислотную последовательность полипептида вариабельной области легкой цепи (VL), содержащую VL CDR1, содержащий аминокислотную последовательность QGDSLRSYYAS (SEQ ID NO: 17), VL CDR2, содержащий аминокислотную последовательность GENNRPS (SEQ ID NO: 71), и VL CDR3, содержащий аминокислотную последовательность NSRDSSGTHLTV (SEQ ID NO: 60).



 

Похожие патенты:

Изобретение относится к биохимии. Описано антитело, специфически связывающееся с CAPRIN-1, или его фрагмент, которые обладают иммунологической реактивностью в отношении белка CAPRIN-1, причем антитело или его фрагмент содержат вариабельную область тяжелой цепи, содержащую определяющие комплементарность области SEQ ID NO: 5, 6 и 7, и вариабельную область легкой цепи, содержащую определяющие комплементарность области SEQ ID NO: 9, 10 и 11.

Изобретение относится к области биохимии. Представлены антитела, связывающиеся с опухолеассоциированным антигенным полипептидом-мишенью (полипептидом «TAT»), который в более высокой степени экспрессируется на поверхности раковых клеток, чем на поверхности нормальных клеток.

Изобретение относится к биохимии. Представлено химерное, CDR-привитое, гуманизированное или рекомбинантное человеческое антитело или его фрагмент, который специфически связывается с человеческим EFNA4.

Изобретение относится к области биохимии, в частности к антителам к С4.4а и их антигенсвязывающим фрагментам. Антитела специфически связываются с доменом S1 С4.4а, являются кросс-реактивными по отношению к С4.4а грызунов и интернализуются после связывания с клетками, экспрессирующими С4.4а.

Изобретение относится к области иммунологии и биотехнологии. Описан иммуноконъюгат для лечения опухолевых расстройств, связанных с мезотелином.

Предложенное изобретение относится к применению антитела для получения медикамента для лечения или профилактики опухолей Крукенберга. Антитело, связываясь с эпитопом, расположенным на петле D1 или на петле D3 CLD18A2, опосредует уничтожение и/или ингибирование пролиферации клеток, экспрессирующих CLD18A2.

Изобретение относится к области биохимии, в частности к антигенсвязывающей молекуле (АСМ), которая специфически связывает связанный с мембраной человеческий карциноэмбриональный антиген (CEA).

Изобретение относится к области биохимии, в частности к выделенному антителу, которое специфически связывается с TAT211, или его функциональному фрагменту. Также раскрыты конъюгат, содержащий указанное антитело и который специфически связывает TAT211, нуклеиновая кислота, кодирующая заявленное антитело, и клетка, которая продуцирует заявленное антитело.

Изобретение относится к области биотехнологии и иммунологии. Предложено генетически созданное антитело, способное связывать CD138 человека.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложено применение гуманизированного моноклонального антитела или его фрагмента, включающего вариабельные области лёгкой и тяжелой цепи, полученные из моноклонального антитела мыши mBAT-1, в комбинации по меньшей мере с одним химиотерапевтическим агентом на основе платины, антиметаболитов или паклитаксела для лечения опухолевого заболевания.
Наверх