Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)



Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
Антитела к родственной раково-эмбриональному антигену молекуле клеточной адгезии (сеасам)
C07K2317/24 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2650869:

СиСиЭйЭм БАЙОТЕРАПЬЮТИКС ЛТД. (IL)
ТЕЛ ХАШОМЕР МЕДИКАЛ РИСЕРЧ ИНФРАСТРАКЧЕ ЭНД СЕРВИСИЗ ЛТД. (IL)
РАМОТ ЭТ ТЕЛЬ-АВИВ ЮНИВЕРСИТИ ЛТД. (IL)

Настоящее изобретение относится к биотехнологии и медицине, в частности к моноклональному антителу, которое специфично связывается с CEACAM1 человека. Настоящее изобретение также раскрывает полинуклеотид, кодирующий указанное антитело, плазмиду для его продукции, фармацевтическую и диагностическую композиции для лечения злокачественного новообразования, характеризующегося сверхэкспрессией CEACAM1, и для детекции CEACAM1 человека у индивидуума соответственно. Раскрыты способ профилактики или лечения заболевания или нарушения, связанного с экспрессией, активацией или функцией CEACAM1 человека, способ иммуностимуляции, способ ингибирования взаимодействия CEACAM1 человека с CEACAM1, а также способы диагностики злокачественной опухоли, экспрессирующей CEACAM1. Настоящее изобретение позволяет повысить специфичность антител против CEACAM1 человека. 10 н. и 6 з.п. ф-лы, 20 ил., 1 табл., 13 пр.

 

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к терапевтическим и диагностическим антителам, пригодным при заболеваниях с участием, экспрессией, активацией или функцией родственной раково-эмбриональному антигену молекулы клеточной адгезии (CEACAM). В частности, настоящее изобретение относится к антителам с конкретными определяющими комплементарность областями (CDR) и улучшенными свойствами относительно других антител, распознающих CEACAM1.

УРОВЕНЬ ТЕХНИКИ, ПРЕДШЕСТВУЮЩИЙ ИЗОБРЕТЕНИЮ

Трансмембранный белок родственная раково-эмбриональному антигену молекула клеточной адгезии 1 (CEACAM1, также известная как желчный гликопротеин (BGP), CD66a и C-CAM1) является представителем семейства раково-эмбрионального антигена (CEA), который также принадлежит иммуноглобулиновому суперсемейству. CEACAM1 взаимодействует с другими известными белками CEACAM, включая белки CD66a (CEACAM1), CD66e (CEACAM6) и CD66e (CEACAM5, CEA). Он экспрессирован в широком спектре клеток, в диапазоне от эпителиальных клеток до клеток гемопоэтического происхождения (например, клеток иммунной системы).

С белком CEACAM1 связано множество различных функций. Показано, что белок CEACAM1 сверхэкспрессирован в некоторых карциномах толстой кишки, предстательной железы, а также других типах злокачественных опухолей. Дополнительные данные свидетельствуют о важной роли CEACAM1 в ангиогенезе и метастазировании. CEACAM1 также играет роль в модуляции врожденного и приобретенного иммунитета. Например, показано, что CEACAM1 является ингибирующим рецептором у активированных T-клеток, находящихся в эпителии желудочно-кишечного тракта человека (WO 99/52552 и Morales et al. J. Immunol. 1999, 163, 1363-1370). Дополнительные публикации показали, что включение CEACAM1 посредством сшивания T-клеточных рецепторов с моноклональными антителами (mAb) или посредством белков Opa Neisseria gonorrhoeae ингибирует активацию и пролиферацию T-клеток.

Меланома представляет собой злокачественное новообразование пигментпродуцирующих клеток (меланоцитов), ответственное за 75% связанной с раком кожи смертности во всем мире, в основном вследствие сильного метастазирования. Метастатическая меланома (MM) слабо поддается воздействию большинства противораковых схем лечения и средняя общая выживаемость у пациентов с MM составляет 8,5 месяцев. Существуют данные, что сверхэкспрессия CEACAM1 может коррелировать с неблагоприятным прогнозом, и ее детектируют в большинстве случаев метастатической меланомы. Нормальные меланоциты редко экспрессируют CEACAM1, но в клетках меланомы ее находят часто. Экспрессия CEACAM1 в первичных кожных очагах меланомы обеспечивает большую вероятность развития метастатического заболевания с неблагоприятным прогнозом. Кроме того, повышенную по сравнению со здоровыми донорами экспрессию CEACAM1 наблюдали на NK клетках, получаемых у некоторых пациентов с метастатической меланомой.

Данные указывают на то, что CEACAM1 может иметь важную роль в вирусных инфекциях. Например, Markel at el. (J. Clinical Investigation 2002, 110, 943-953) продемонстрировали что лимфоциты, выделенные из децидуальной оболочки инфицированных CMV пациентов, экспрессируют увеличенные уровни белка CEACAM1. Повышенная экспрессия CEACAM1 на децидуальных лимфоцитах может снижать местный иммунный ответ и служить в качестве альтернативного механизма, развиваемого вирусом для избегания распознавания и выведения преимущественно активированными децидуальными лимфоцитами. Albarran-Somoza et al. (Journal of Histochemistry & Cytochemistry 2006, 54, 1393), исследовавшие профиль экспрессии белка CEACAM1 при раке шейки матки и очагах-предшественниках в отношении инфекции вируса папилломы человека (HPV), продемонстрировали, что иммуноокрашивание на CEACAM1 в высокозлокачественных плоскоклеточных внутриэпителиальных очагах поражения (SIL) по сравнению с низкозлокачественными SIL и нормальными тканями шейки матки значительно увеличено. Авторы предположили, что повышение экспрессии CEACAM1 может быть связано с интеграцией ДНК HPV в высокозлокачественных SIL, и что CEACAM1 может являться важным биологическим маркером в прогрессе SIL и рака шейки матки. Все вместе, эти данные указывают на то, что CEACAM1 играет важную роль в различных вирусных инфекциях. Кроме того, сверхэкспрессия CEACAM1 может служить в качестве маркера различных вирусных инфекций.

В WO 2007/063424 и патентной заявке США № 20070110668 описаны способы регуляции иммунной системы и, в частности, способы регуляции специфического иммунитета, включая регуляцию активности лимфоцитов. Эти способы включают отрицательную и положительную модуляцию функции белка CEACAM1.

В патентной заявке США № 20070071758 указаны способы и композиции для увеличения эффективности терапии инфильтрирующих опухоль лимфоцитов (TIL) при лечении злокачественной опухоли посредством отрицательной модуляции активности белка CEACAM1, например, такие как использование иммуноглобулина, специфичного для CEACAM1.

В патентной заявке США № 20080108140 описаны способы модуляции специфического иммунного ответа для создания защитного иммунитета при лечении аутоиммунных заболеваний и заболеваний, требующих трансплантации ткани. В частности, это относится к подавлению иммунного ответа направленным образом посредством увеличения функциональной концентрации белка CEACAM1 в ткани-мишени.

В патентной заявке США № 20040047858 описаны специфические антитела, способные к модуляции T-клеточной активности посредством CEACAM1, и их использование при лечении связанных с иммунитетом заболеваний (например, реакции "трансплантат против хозяина", аутоиммунных заболеваний, злокачественных опухолей и т.д.).

В патентных заявках США №№ 20020028203, 20050169922 и 20080102071 описаны композиции, связывающиеся с молекулами T-клеточных ингибирующих рецепторов и модулирующие (т.е. усиливающие или подавляющие) активность T-клеток (например, цитотоксичность и пролиферацию), такие как средства, связывающие желчный гликопротеин, и способы применения таких композиций, например, для лечения заболеваний (например, аутоиммунных заболеваний, иммунодефицита, злокачественных опухолей и т.д.).

В WO 2010/125571, выданной авторам настоящего изобретения, описано моноклональное антитело мыши, получаемое посредством специфичных гибридомных клеток. mAb является высокоселективным в отношении CEACAM1 и не вступает в перекрестные реакции с другими представителями семейства CEACAM.

Ни одно из известных антител, распознающих CEACAM1, не обладает спектром специфичности связывания моноклональных антител по настоящему изобретению. Таким образом, существует неудовлетворенная потребность в получении антител, распознающих конкретные подклассы белков CEACAM, которые можно использовать диагностически и терапевтически при заболеваниях, в которые вовлечены экспрессия или активация CEACAM.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к моноклональным антителам, распознающим конкретный класс подтипов CEACAM. Преимущественно, антитела по изобретению демонстрируют связывание с CEACAM1 и по меньшей мере с одним дополнительным подтипом, выбранным из CEACAM5 и CEACAM3. Антитела по изобретению характеризуются наличием уникальных комбинаций последовательностей CDR и каркаса и связыванием с вновь идентифицированными эпитопами в молекуле CEACAM1. Уникальная специфичность моноклональных антител по настоящему изобретению расширяет их терапевтическую применимость для лечения и диагностики дополнительных типов злокачественных новообразований и вирусных инфекций. Настоящее изобретение также относится к способам идентификации и выделения таких антител, способам их получения и их терапевтического и диагностического применения.

Моноклональные антитела по настоящему изобретению содержат специфические комбинации CDR и обладают уникальными свойствами и улучшенной специфичностью и активностью по сравнению с известными антителами к CEACAM1.

По одному из аспектов настоящее изобретение относится к моноклональному антителу, которое распознает CEACAM1, или к фрагменту этого антитела, содержащему по меньшей мере его антигенсвязывающую часть с CDR тяжелой цепи, содержащей последовательности, указанные в SEQ ID NO: 1, 2 и 3, и CDR легкой цепи, содержащей последовательности, указанные в SEQ ID NO: 4, 5 и 6, и их аналогам и производным.

По определенным вариантам осуществления предоставлены моноклональное антитело или фрагмент антитела, которые распознают CEACAM1 с CDR1 тяжелой цепи, содержащей последовательность, указанную в SEQ ID NO: 1, CDR2 тяжелой цепи, содержащей последовательность, указанную в SEQ ID NO: 2, CDR3 тяжелой цепи, содержащей последовательность, указанную в SEQ ID NO: 3, CDR1 легкой цепи, содержащей последовательность, указанную в SEQ ID NO: 4, CDR2 легкой цепи, содержащей последовательность, указанную в SEQ ID NO: 5 и CDR3 легкой цепи, содержащей последовательность, указанную в SEQ ID NO: 6, и их аналоги и производные.

По определенным вариантам осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, содержащие CDR тяжелой цепи с последовательностями, указанными в SEQ ID NO: 7, 8 и 9.

По определенным вариантам осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, содержащие CDR тяжелой цепи с последовательностями, указанными в SEQ ID NO: 13, 14 и 15.

По определенным вариантам осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, содержащие CDR легкой цепи с последовательностями, указанными в SEQ ID NO: 10, 11 и 12.

По определенным вариантам осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, где CDR легкой цепи с последовательностями, указанными в SEQ ID NO: 16, 17 и 18.

По другим вариантам осуществления предоставлено моноклональное антитело, содержащее последовательности CDR, указанные в SEQ ID NO: 13, 14, 15, 16, 17 и 18.

По другим вариантам осуществления предоставлено моноклональное антитело, содержащее последовательности CDR, указанные в SEQ ID NO: 7, 8, 9, 10, 11 и 12.

В объем настоящего изобретения также входят аналоги и производные моноклонального антитела или его фрагмента с идентичностью последовательности по меньшей мере 90% антигенсвязывающей частью эталонной последовательности.

По определенным вариантам осуществления предоставлены аналоги и производные моноклонального антитела или его фрагмента с идентичностью последовательности по меньшей мере 95% с антигенсвязывающей частью эталонной последовательности. По конкретному варианту осуществления антитело содержит последовательность вариабельного домена тяжелой цепи с последовательностью, указанной в SEQ ID NO: 26: QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSGDTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYWGQGTSVTVSS, или ее аналог или производное с идентичностью последовательности по меньшей мере 97% с последовательностью тяжелой цепи.

По другому варианту осуществления антитело содержит последовательность вариабельного домена легкой цепи с последовательностью, указанной в SEQ ID NO: 28: DIQMTQTTSSLSASLGDRVTISCRTSQDIGNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKSLPRTFGGGTKLEIK, или ее аналог или производное с идентичностью последовательности по меньшей мере 97% с последовательностью легкой цепи.

По конкретному варианту осуществления антитело или его фрагмент содержит вариабельный домен тяжелой цепи с последовательностью, указанной в SEQ ID NO: 26, и вариабельный домен легкой цепи с последовательностью, указанной в SEQ ID NO: 28, или его аналог или производное с идентичностью последовательности по меньшей мере 97% с последовательностью антитела или фрагмента.

Настоящее изобретение относится к моноклональным антителам, выделяемым из гибридомных клеток или других биологических систем, а также к моноклональным антителам, получаемым рекомбинантно или синтетически. Моноклональное антитело по настоящему изобретению может содержать константную область любого вида млекопитающих, включая в качестве неограничивающих примеров мышь, крысу и человека. Моноклональное антитело по настоящему изобретению включает химерное антитело, гуманизированное антитело, полностью принадлежащее человеку антитело, ксеногенное антитело и фрагмент антитела, содержащий по меньшей мере антигенсвязывающую часть антитела. По конкретному варианту осуществления фрагмент антитела выбран из группы, состоящей из: Fab, Fab', F(ab')2, Fd, Fd', Fv, dAb, выделенной области CDR, одноцепочечного антитела, "диател" и "линейных антител".

По определенным конкретным вариантам осуществления настоящее изобретение относится к моноклональному антителу или фрагменту антитела, содержащим:

i) каркасную последовательность, выбранную из группы, состоящей из: IgG2a мыши, IgG2b мыши, IgG3 мыши, IgG1 человека, IgG2 человека, IgG3 человека; и

ii) набор из шести CDR с последовательностями, указанными в SEQ ID NO: 13, 14, 15, 16, 17 и 18; или набор из шести CDR с последовательностями, указанными в SEQ ID NO: 7, 8, 9, 10, 11 и 12; и их аналоги и производные с идентичностью последовательности по меньшей мере 97% с указанными последовательностями CDR, где моноклональное антитело или его фрагмент связывается по меньшей мере с двумя подтипами CEACAM с аффинностью по меньшей мере приблизительно 5×10-7 M.

По определенным вариантам осуществления моноклональное антитело или его фрагмент связывается по меньшей мере с двумя подтипами CEACAM с аффинностью по меньшей мере приблизительно 5×10-7 M.

По другим вариантам осуществления моноклональное антитело или его фрагмент связывается с CEACAM1 с аффинностью по меньшей мере приблизительно 10-8 M.

По определенным конкретным вариантам осуществления моноклональное антитело представляет собой химерное моноклональное антитело.

По определенным вариантам осуществления химерное антитело содержит полученные у человека константные области.

По определенным вариантам осуществления константные области человека химерного антитела выбраны из группы, состоящей из: IgG1 человека, IgG2 человека и IgG3 человека.

По конкретному варианту осуществления предоставлено химерное или гуманизированное моноклональное антитело, которое распознает CEACAM1, содержащее шесть CDR с последовательностями, указанными в SEQ ID NO: 13, 14, 15, 16, 17 и 18; или шесть CDR с последовательностями, указанными в SEQ ID NO: 7, 8, 9, 10, 11 и 12; и их аналогами и производными с идентичностью последовательности по меньшей мере 95% с указанными последовательностями CDR, и с подклассом константной области, выбранным из IgG1 человека, IgG2 человека и IgG3 человека, где моноклональное антитело связывается по меньшей мере с двумя подтипами CEACAM с аффинностью по меньшей мере приблизительно 5×10-7 M.

По конкретному варианту осуществления химерное или гуманизированное моноклональное антитело или его фрагмент содержит подкласс константной области подтипа IgG1 человека.

По другому конкретному варианту осуществления предоставлены химерное моноклональное антитело или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, содержащие последовательность тяжелой цепи, указанную в SEQ ID NO: 30.

По другому конкретному варианту осуществления предоставлены химерное моноклональное антитело или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, содержащие последовательность легкой цепи, указанную в SEQ ID NO: 31.

По другому конкретному варианту осуществления предоставлены химерное моноклональное антитело или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть с последовательностью тяжелой цепи, указанной в SEQ ID NO: 30, и последовательностью легкой цепи, указанной в SEQ ID NO: 31.

По конкретному варианту осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, продуцируемое с последовательностей ДНК тяжелой и легкой цепей, содержащихся в плазмиде, депонированной 28 сентября 2011 года под номером доступа ATCC PTA-12130.

Моноклональные антитела по настоящему изобретению в соответствии с определенными вариантами осуществления демонстрируют специфическое связывание более чем с одним подтипом CEACAM. По определенным вариантам осуществления моноклональное антитело связывает по меньшей мере два различных подтипа CEACAM. По определенным конкретным вариантам осуществления моноклональное антитело связывается с CEACAM1 и по меньшей мере с одним из CEACAM3 и CEACAM5. По конкретному варианту осуществления моноклональное антитело связывается с CEACAM1 и CEACAM5. По другому конкретному варианту осуществления моноклональное антитело связывается с CEACAM1 и CEACAM3. По другим вариантам осуществления моноклональное антитело по настоящему изобретению связывается с подтипами CEACAM 1, 3 и 5.

По конкретным вариантам осуществления моноклональное антитело по настоящему изобретению не связывается с CEACAM4 и CEACAM6.

По другому аспекту настоящее изобретение относится к моноклональному антителу, которое распознает CEACAM1, или его фрагменту, содержащему по меньшей мере антигенсвязывающую часть, которая способна к связыванию того же эпитопа на молекуле CEACAM1, с которым связывается моноклональное антитело к CEACAM1 с последовательностью тяжелой цепи, указанной в SEQ ID NO: 26 или SEQ ID NO: 30 и последовательностью легкой цепи, указанной как SEQ ID NO: 28 или SEQ ID NO: 31.

По определенным вариантам осуществления моноклональное антитело реагирует с эпитопом в пределах остатков 17-29 и 68-79 CEACAM1 человека с последовательностями VLLLVHNLPQQLF (SEQ ID NO: 32) и YPNASLLIQNVT (SEQ ID NO: 33), соответственно.

По определенным вариантам осуществления эпитоп на молекуле CEACAM1 с которым связывается моноклональное антитело представляет собой эпитоп, содержащий аминокислотные остатки в пределах последовательностей VLLLVHNLPQQLF (SEQ ID NO: 32) и YPNASLLIQNVT (SEQ ID NO: 33).

По другим вариантам осуществления моноклональное антитело по изобретению связывает эпитоп, содержащий по меньшей мере четыре аминокислоты последовательности VLLLVHNLPQQLF (SEQ ID NO: 32).

По другим вариантам осуществления моноклональное антитело по изобретению связывает эпитоп в пределах последовательностей VLLLVHNLPQQLF (SEQ ID NO: 32) и PNASLLI (SEQ ID NO: 34).

По определенным вариантам осуществления моноклональное антитело или его фрагмент связывается с тем же эпитопом, с которым связывается антитело с шестью последовательностями CDR, указанными в SEQ ID NO: 7, 8, 9, 10, 11 и 12.

По другим вариантам осуществления моноклональное антитело или его фрагмент связывается с тем же эпитопом, с которым связывается антитело с последовательностями CDR, указанными в SEQ ID NO: 13, 14, 15, 16, 17 и 18.

По конкретному варианту осуществления моноклональное антитело или его фрагмент связывается с тем же эпитопом, который связывает антитело, продуцируемое с последовательностей ДНК, депонированных 28 сентября 2011 года под номером доступа ATCC PTA-12130.

По другому аспекту настоящее изобретение относится к выделенной пептидной последовательности из 6-20 аминокислот, содержащей по меньшей мере три аминокислоты из последовательности VLLLVHNLPQQLF (SEQ ID NO: 32) и по меньшей мере три аминокислоты из последовательности YPNASLLIQNVT (SEQ ID NO: 33). Также в объем настоящего изобретения входят аналоги и производные указанного пептида по меньшей мере на 85%, 90%, 95% или 98% гомологичные исходной последовательности.

По определенным вариантам осуществления выделенный пептид содержит по меньшей мере шесть аминокислот из последовательности VLLLVHNLPQQLF (SEQ ID NO: 32).

По другим вариантам осуществления выделенный пептид содержит аминокислоты последовательностей VLLLVHNLPQQLF (SEQ ID NO: 32) и PNASLLI (SEQ ID NO: 34).

Также в объем настоящего изобретения входит применение выделенных пептидов для получения моноклональных или поликлональных антител, а также их применение в диагностике или лечении.

В объем настоящего изобретения также входят молекулы нуклеиновой кислоты, кодирующие антитело или фрагмент антитела по изобретению c аффинностью и специфичностью к CEACAM1.

По этому аспекту описана выделенная полинуклеотидная последовательность, кодирующая антитело, которое распознает CEACAM1, или фрагмент этого антитела.

По определенным вариантам осуществления выделенная полинуклеотидная последовательность содержит последовательность ДНК, указанную в SEQ ID NO: 25 или ее аналог с идентичностью последовательности по меньшей мере 90% с указанной последовательностью ДНК. По другим вариантам осуществления выделенная полинуклеотидная последовательность содержит последовательность ДНК, указанную в SEQ ID NO: 27 или ее аналог с идентичностью последовательности по меньшей мере 90% с указанной последовательностью ДНК.

Также описаны плазмиды, содержащие по меньшей мере одну полинуклеотидную последовательность, кодирующую моноклональное антитело или его фрагмент по изобретению, а также клетки-хозяева, содержащие эти плазмиды.

По конкретному варианту осуществления описана плазмида, содержащая полинуклеотидные последовательности, указанные в SEQ ID NO: 25 и 27, депонированные 28 сентября 2011 года под номером доступа ATCC PTA-12130.

В другом аспекте настоящее изобретение относится к фармацевтической композиции, пригодной для профилактики, смягчения или лечения заболевания или нарушения, связанного с экспрессией, активацией или функцией CEACAM1, CEACAM3 или CEACAM5. Фармацевтическая композиция по изобретению содержит терапевтически эффективное количество моноклонального антитела, которое распознает CEACAM1, CEACAM3 или CEACAM5, или фрагмента этого антитела, содержащего по меньшей мере антигенсвязывающую часть; и фармацевтически приемлемый носитель.

По определенным вариантам осуществления фармацевтическая композиция содержит моноклональное антитело, способное к связыванию с CEACAM1 с аффинностью связывания по меньшей мере 10-8 кДа.

По дополнительным вариантам осуществления фармацевтическая композиция содержит моноклональное антитело, способное к связыванию с CEACAM1 с аффинностью по меньшей мере приблизительно 10-8 кДа и по меньшей мере с одним из CEACAM3 и CEACAM5 с аффинностью по меньшей мере приблизительно 5×10-7 M.

По конкретному варианту осуществления фармацевтическая композиция содержит моноклональное антитело, способное к связыванию с CEACAM1, CEACAM3 и CEACAM5 с аффинностью по меньшей мере приблизительно 5×10-7 кДа.

По определенным вариантам осуществления заболевание или нарушение, связанное с экспрессией, активацией или функцией CEACAM1, CEACAM3 и/или CEACAM5 представляет собой пролиферативно-клеточное заболевание или нарушение. По определенным вариантам осуществления пролиферативно-клеточное заболевание или нарушение представляет собой злокачественную опухоль.

По определенным вариантам осуществления злокачественная опухоль, ассоциированная со сверхэкспрессией CEACAM5, выбрана из группы, состоящей из: рака желудочно-кишечного тракта, колоректального рака (CRC), рака поджелудочной железы, немелкоклеточного рака легких (NSCL), рака молочной железы, рака щитовидной железы, рака желудка, рака яичника и рака матки.

По конкретному варианту осуществления злокачественные опухоли, ассоциированные со сверхэкспрессией CEACAM1, представляют собой меланому, рак поджелудочной железы, все типы рака легкого и миелому.

Фармацевтическую композицию по настоящему изобретению можно вводить в виде отдельного лечения или в дополнение к лечению любым другим терапевтическим средством. По конкретному варианту осуществления антитела по настоящему изобретению вводят нуждающемуся в этом индивидууму в качестве части схемы лечения в сочетании по меньшей мере с одним противораковым средством. Фармацевтическую композицию по настоящему изобретению можно вводить совместно с другим средством или раздельно.

В другом аспекте настоящее изобретение относится к диагностическим композициям, пригодным для детекции у индивидуума по меньшей мере одного подтипа CEACAM, выбранного из группы, состоящей из: CEACAM1, CEACAM3 и CEACAM5. Диагностическая композиция по изобретению содержит терапевтически эффективное количество моноклонального антитела с аффинностью к CEACAM1, CEACAM3 или CEACAM5 по меньшей мере приблизительно 5×10-7 M или фрагмент этого антитела, содержащий по меньшей мере антигенсвязывающую часть; и необязательный носитель или эксципиент.

В еще одном аспекте настоящее изобретение относится к способу профилактики, смягчения или лечения заболевания или нарушения, связанного с экспрессией, активацией или функцией CEACAM, включающему введение нуждающемуся в этом индивидууму фармацевтической композиции, содержащей терапевтически эффективное количество антитела к CEACAM; и фармацевтически приемлемый носитель.

По определенным вариантам осуществления заболевание или нарушение представляет собой пролиферативно-клеточное заболевание или нарушение. По определенным вариантам осуществления пролиферативно-клеточное заболевание или нарушение представляет собой злокачественную опухоль. По конкретному варианту осуществления аффинность моноклонального антитела или его фрагмента к CEACAM1 составляет по меньшей мере приблизительно 10-8 M, а злокачественная опухоль представляет собой меланому.

По другим вариантам осуществления аффинность моноклонального антитела или его фрагмента к CEACAM5 составляет меньшей мере приблизительно 5×10-7 M, и злокачественная опухоль выбрана из группы, состоящей из: рака желудочно-кишечного тракта, колоректального рака (CRC), рака поджелудочной железы немелкоклеточного рака легких (NSCL), рака молочной железы, рака щитовидной железы, рака желудка, рака яичника, миеломы и рака матки.

По дополнительному варианту осуществления заболевание или нарушение, связанное со сверхэкспрессией CEACAM1, представляет собой вирусную инфекцию.

По определенным вариантам осуществления вирусная инфекция вызвана вирусом, выбранным из группы, состоящей из: ДНК-содержащих вирусов, таких как, но не ограничиваясь ими, цитомегаловирус (CMV), аденовирус, вирус гепатита и вирус папилломы человека (HPV); и РНК-содержащих вирусов, таких как, но не ограничиваясь ими, вирус гриппа и вирус иммунодефицита человека (ВИЧ).

По одному из аспектов настоящего изобретения предоставлен способ иммуномодуляции, где способ включает приведение экспрессирующих CEACAM лимфоцитов в контакт с антителом или фрагментом антитела.

По одному из аспектов настоящего изобретения предоставлен способ ингибирования миграции экспрессирующих CEACAM опухолевых клеток, где способ включает приведение экспрессирующих CEACAM опухолевых клеток в контакт с антителом или фрагментом антитела, таким образом, ингибируя миграцию экспрессирующих CEACAM опухолевых клеток.

По определенным вариантам осуществления опухолевая клетка включает меланомную опухолевую клетку.

По одному из аспектов настоящего изобретения предоставлен способ лечения злокачественной опухоли, где способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества антитела или фрагмента антитела, таким образом проводя лечение злокачественной опухоли у индивидуума.

По одному из аспектов настоящего изобретения предоставлен способ ингибирования гомотипического или гетеротипического белок-белкового взаимодействия CEACAM, где способ включает приведение экспрессирующих CEACAM1 лимфоцитов в контакт с антителом или фрагментом антитела, таким образом, ингибируя гомотипическое или гетеротипическое белок-белковое взаимодействие CEACAM1.

По определенным вариантам осуществления выделенное антитело или фрагмент антитела связаны с цитотоксической молекулой.

По определенным вариантам осуществления цитотоксическая молекула включает цитотоксин, хемокин, хемотерапевтическую композицию, проапоптотическое средство, интерферон, радиоактивную молекулу или их сочетания.

По определенным вариантам осуществления антитело или фрагмент антитела связаны с поддающейся идентификации молекулой.

По определенным вариантам осуществления клетки злокачественной опухоли по сравнению с незатронутыми клетками характеризуются сверхэкспрессией CEACAM1.

По определенным вариантам осуществления способ лечения злокачественной опухоли дополнительно включает введение индивидууму лимфоцитов.

По определенным вариантам осуществления лимфоциты содержат T-клетки или NK клетки. По определенным вариантам осуществления лимфоциты экспрессируют CEACAM1. По другим вариантам осуществления экспрессирующие CEACAM1 лимфоциты представляют собой проникающие в опухоль лимфоциты (TIL). По другим вариантам осуществления экспрессирующие CEACAM1 лимфоциты представляют собой цитотоксические T-клетки.

Антитело по настоящему изобретению можно использовать для блокировки CEACAM на каждой или на всех из иммунных эффекторных клетках (экспрессирующих CEACAM лимфоцитах, например, проникающих в опухоль клетках, T-клетках или NK клетках) и клеток-мишеней (например, экспрессирующих CEACAM патологических клетках, таких как злокачественные клетки). Примеры злокачественных клеток, являющихся кандидатами для этой терапии, в качестве неограничивающих примеров включают клетки меланомы, легкого, щитовидной железы, молочной железы, толстой кишки, предстательной железы, печени, мочевого пузыря, почки, шейки матки, поджелудочной железы, лейкоза, лимфомы, миелоидной ткани, яичника, матки, саркомы, желчных путей или эндометрия.

По дополнительному аспекту изобретения предоставлен способ обеспечения чувствительности экспрессирующих CEACAM опухолевых клеток к иммуномодуляции. Способ включает приведение экспрессирующих CEACAM опухолевых клеток (например, клеток меланомы, легкого, щитовидной железы, молочной железы, толстой кишки, предстательной железы, печени, мочевого пузыря, почки, шейки матки, поджелудочной железы, лейкоза, лимфомы, миелоидной ткани, яичника, матки, саркомы, желчных путей или эндометрия) в контакт с антителом или фрагментом антитела, описанными выше, таким образом, обеспечивая чувствительность экспрессирующих CEACAM опухолевых клеток к иммуномодуляции.

Дополнительно или альтернативно, настоящее изобретение также относится к способу иммуномодуляции (например, ингибирования гомотипического или гетеротипического белок-белкового взаимодействия CEACAM1) посредством приведения экспрессирующих CEACAM1 лимфоцитов в контакт с антителом или фрагментом антитела, описываемым в настоящем документе.

Терапевтические или профилактические способы по настоящим указаниям можно проводить ex vivo (например, с использованием адоптивной иммунотерапии на основе T-клеток) или in vivo.

Антитела по определенным вариантам осуществления изобретения могут обладать активностью против злокачественных опухолей, которая не зависит от ее иммуномодулирующей активности, описанной выше.

В другом аспекте настоящее изобретение относится к способу увеличения длительности или прогрессирования ответа или продолжительности жизни индивидуума со злокачественной опухолью, включающему введение индивидууму эффективного количества композиции, содержащей антитело, которое распознает CEACAM, и противоопухолевую композицию, где указанная противоопухолевая композиция содержит по меньшей мере одно химиотерапевтическое средство, посредством чего совместное введение антитела и противоопухолевой композиции эффективно увеличивает длительность или прогрессирование ответа или продолжительность жизни.

Кроме того, настоящее изобретение относится к способу лечения индивидуума со злокачественной опухолью, включающему введение индивидууму эффективного количества композиции, содержащей антитело к CEACAM и противоопухолевой композиции, посредством чего совместное введение антитела к CEACAM и противоопухолевой композиции эффективно увеличивает частоту ответа в группе индивидуумов.

Кроме терапевтических приложений антитела по настоящему изобретению также можно использовать в диагностических приложениях.

Таким образом, по дополнительному аспекту предоставлен способ диагностики злокачественной опухоли у нуждающегося в этом индивидуума, где способ включает приведение биологического образца, полученного у индивидуума (in vivo, in vitro или ex vivo) в контакт с антителом или фрагментом антитела, описываемыми в настоящем документе, где формирование комплекса выше предопределенного порога является показателем злокачественной опухоли у индивидуума. По определенным вариантам осуществления клетки злокачественной опухоли характеризуются сверхэкспрессией CEACAM по сравнению с незатронутыми клетками.

По конкретному варианту осуществления диагностируемая злокачественная опухоль выбрана из группы, состоящей из: меланомы, рака поджелудочной железы, рака легких и миеломы.

По другому конкретному варианту осуществления измеряемый белок представляет собой CEACAM5, и диагностируемая злокачественная опухоль выбрана из группы, состоящей из: рака желудочно-кишечного тракта, колоректального рака (CRC), рака поджелудочной железы, немелкоклеточного рака легких (NSCL), рака молочной железы, рака щитовидной железы, рака желудка, рака яичника и рака матки.

Как указано, способ по изобретению проводят в условиях, достаточных для формирования иммунных комплексов; такие условия (например, подходящие концентрации, буферы, температуры, время реакции), а также способы оптимизации таких условий известны специалистам в данной области, и их примеры описаны в настоящем документе. Как используют в настоящем документе, фраза "иммунный комплекс" относится к комплексу, содержащему антитело по изобретению и CEACAM. Определение присутствия или уровня иммунных комплексов по изобретению может быть непосредственным или посредством детекции идентифицируемой (детектируемой) молекулы, которая может быть связана с антителом.

Уровень иммунных комплексов в тестируемых клетках (например, клетках нуждающегося в этом индивидуума) сравнивают с предопределенным порогом. Следует понимать, что антитело по настоящему изобретению также можно использовать для измерения количества растворимого в сыворотке CEACAM. Независимо от этого порог можно определять на основе известного эталонного уровня и/или уровня в контрольных клетках или в сыворотке. Контрольные клетки можно получать у контрольного, здорового индивидуума (например, индивидуума, не страдающего злокачественной опухолью) или у того же индивидуума до начала заболевания или после лечения. По определенным вариантам осуществления изобретения контрольный индивидуум представляет собой индивидуума того же вида, например, человека, предпочтительно совпадающего с нуждающимся в определении индивидуумом по возрасту, массе, полу и т.д.

Для облегчения диагностики, приведенные выше указания можно комбинировать с другими способами диагностики злокачественных опухолей, которые хорошо известны в данной области, включая в качестве неограничивающих примеров, диагностическую визуализацию, молекулярное тестирование и хирургическую биопсию.

По другому аспекту настоящего изобретения предоставлен способ детекции или количественного определения присутствия CEACAM. Таким образом, настоящее изобретение также относится к способам диагностики состояний, ассоциированных с экспрессией CEACAM, с использованием антител, распознающих CEACAM. Способы диагностики по изобретению можно проводить в соответствии с конкретными вариантами осуществления in vitro или ex vivo. Антитела по настоящему изобретению также можно использовать для комплектации способов скрининга. Например, можно разработать анализ ELISA для измерения секретируемых или клеточно-ассоциируемых уровней полипептида с использованием моноклональных и поликлональных антител стандартными способами, известными в данной области.

По одному из вариантов осуществления предоставлен способ детекции или количественного определения присутствия CEACAM, включающий стадии:

i) инкубации биологического образца с антителом к CEACAM или фрагментом этого антитела, содержащим по меньшей мере антигенсвязывающую часть;

ii) детекции связанного CEACAM с использованием детектируемого зонда;

iii) сравнения количества (ii) со стандартной кривой, полученной на основе эталонных образцов, содержащих известные количества CEACAM; и

iv) расчета количества CEACAM в образце на основе стандартной кривой.

По другому варианту осуществления предоставлены способ диагностики заболевания или нарушения, связанного с экспрессией CEACAM, включающий стадии:

i) инкубации биологического образца с антителом к CEACAM или фрагментом этого антитела, содержащим по меньшей мере антигенсвязывающую часть;

ii) детекции связанного CEACAM с использованием детектируемого зонда;

iii) сравнения количества (ii) со стандартной кривой, полученной на основе эталонных образцов, содержащих известные количества CEACAM;

iv) расчета количества CEACAM в биологическом образце на основе стандартной кривой; и

v) сравнения количества (iv) с нормальным количеством CEACAM.

По определенным вариантам осуществления биологический образец представляет собой биологическую жидкость млекопитающего. По конкретным вариантам осуществления млекопитающее представляет собой человека.

Антитела по настоящему изобретению также можно использовать в скрининговых анализах для оценки уровней CEACAM у пациентов и для прогноза эффективности лечения. Скрининговые анализы с антителами по настоящему изобретению могут обеспечить определение уровней CEACAM и, таким образом, прогноз исхода лечения и планирование подходящей схемы лечения.

По другим вариантам осуществления оценивают уровень по меньшей мере одного из CEACAM1, CEACAM3 и CEACAM5. По конкретному варианту осуществления оценивают уровень CEACAM1.

По определенным вариантам осуществления изобретения антитело или фрагмент антитела связаны с идентифицируемой молекулой.

Следует понимать, что такое связывание антител или их фрагментов и идентифицируемой молекулы можно проводить с использованием химической конъюгации или посредством технологии рекомбинантных ДНК хорошо известными в данной области способами.

Идентифицируемая молекула может представлять собой участника пары связывания, которого можно идентифицировать посредством его взаимодействия с другим участником пары связывания и меткой, которую непосредственно визуализируют. В одном из примеров участник пары связывания представляет собой антиген, который идентифицируют посредством соответствующего меченого антитела. В одном из примеров, метка представляет собой флуоресцентный белок или фермент, участвующий в колориметрической реакции.

Другой аспект настоящего изобретения относится к применению антитела к CEACAM или фрагмента этого антитела для диагностики или лечения пролиферативно-клеточного или связанного с ангиогенезом заболевания или нарушения или вирусной инфекции.

По одному из вариантов осуществления пролиферативно-клеточное заболевание представляет собой меланому.

По другим вариантам осуществления пролиферативно-клеточное заболевание или нарушение представляет собой злокачественную опухоль, выбранную из группы, состоящей из: рака желудочно-кишечного тракта, колоректального рака (CRC), рака поджелудочной железы, немелкоклеточного рака легких (NSCL), рака молочной железы, рака щитовидной железы, рака желудка, рака яичника, рака матки и миеломы.

По одному из вариантов осуществления настоящее изобретение относится к применению антитела к CEACAM или фрагмента этого антитела, содержащего по меньшей мере антигенсвязывающую часть, для получения лекарственного средства для лечения нарушения или заболевания, связанного с экспрессией или активацией злокачественной опухоли и вирусной инфекции, но не ограничиваясь ими.

Изобретение также относится к применению антитела к CEACAM или фрагмента этого антитела для получения диагностической композиции для диагностики пролиферативно-клеточного или связанного с ангиогенезом заболевания или нарушения или вирусной инфекции.

По существу все из применений для антител к CEACAM1, CEACAM3 и CEACAM5, известных или полагаемых на известном уровне техники, можно проводить с антителами по настоящему изобретению, для которых показано наличие улучшенной аффинности в отношении этих белков и превосходное ингибирующее и непрямое иммуномодулирующее действие на несущие CEACAM1 клетки. Эти применения включают диагностические, профилактические и терапевтические способы.

Дополнительные варианты осуществления и полный объем применимости настоящего изобретения будет очевиден из подробного описания приводимого далее в настоящем документе.

КРАТКОЕ ОПИСАНИЕ РИСУНКОВ

Фиг. 1 представляет собой изображение SDS-PAGE, демонстрирующее легкие и тяжелые цепи химерного антитела CM10.

На фиг. 2 представлена кривая специфического связывания CM10 с очищенным hCEACAM1.

Фиг. 3 демонстрирует специфическое связывание CM10 с CEACAM1, как детектируют посредством анализа проточной цитометрии.

Фиг. 4 подтверждает, что CM10 блокирует межклеточное взаимодействие CEACAM1-CEACAM1. Секрецию IL-2 мыши у эффекторных клеток (клетки BW/221, экспрессирующие CEACAM1), инкубируемых в присутствии различных концентраций CM10, измеряли посредством ELISA.

На фиг. 5 представлено усиление CM10 специфической цитолитической активности в отношении несущих CEACAM1 клеток меланомы.

Фиг. 6 демонстрирует, что CM10 стимулирует цитолитическую активность инфильтрирующих опухоль лимфоцитов (TIL).

Фиг. 7 демонстрирует, что CM10 усиливает цитолитическую активность NK клеток в отношении линий несущих CEACAM1 клеток меланомы.

Фиг. 8 иммуномодулирующее действие CM10 ингибирует рост опухоли in vivo. Стрелки указывают время введения (CM10 окружностями, TIL треугольниками, CM10 и TIL незакрашенными квадратами).

Фиг. 9 представляет собой схематическое представление механизма иммуномодулирующего действия CM10.

Фиг. 10 представляет уровень интенсивности связывания CEACAM1 в опухолях, как определяют посредством антитела к CEACAM1.

На фиг. 11 представлен количественный анализ молекул CM10, связанных одной клеткой.

Фиг. 12 подтверждает, что CM10 не действует на пролиферацию PBMC. Результаты для каждой обработки представляют собой среднюю скорость пролиферации у трех доноров.

Фиг. 13 представляет анализ FACS связывания CM10 с семейством белков CEACAM. CEACAM1, 5, 6 и 8 экспрессировали посредством клеток 721.221, а CEACAM3 и 4 посредством клеток HEK293T.

Фиг. 14 представляет результаты анализа обусловленной комплементом цитотоксичности (CDC) в линиях клеток меланомы.

Фиг. 15 демонстрирует, что CM10 усиливает секрецию гранзима B TIL в присутствии несущих CEACAM1 и HLA-A2 клеток меланомы.

На фиг. 16 представлено, что CM10 блокирует взаимодействия CEACAM1-CEACAM5.

Фиг. 17 представляет усиление CM10 рестриктированного по HLA цитолиза T-клетками.

Фиг. 18 демонстрирует, что иммуномодулирующая активность CM10 ингибирует рост опухоли in vivo.

На фиг. 19 указано, что CM10 усиливает цитолитическую активность NK клеток в отношении линий несущих CEACAM1 клеток рака поджелудочной железы COLO-357 и BXPC3.

Фиг. 20 демонстрирует, что CM10 усиливает секрецию гранзима B NK клетками в присутствии линий несущих CEACAM1 клеток рака поджелудочной железы.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к антителам, распознающим CEACAM1, содержащим конкретные наборы последовательностей CDR, обладающим улучшенной и уникальной специфичностью, селективностью, аффинностью и/или активностью.

Антитела по настоящему изобретению связывают CEACAM1 с более высокой аффинностью, чем другие антитела к CEACAM1, они блокируют функцию CEACAM1, что делают не все антитела к CEACAM, и более эффективно, чем поликлональные антитела к CEACAM. Кроме того, антитела по настоящему изобретению эффективны против злокачественных клеток, в частности клеток меланомы: антитела обеспечивают большую чувствительность клеток меланомы к лимфоцитам, ингибируют скорость роста меланомы in vivo, действие, которое усиливается, когда антитело комбинируют с адоптивным переносом T-клеток in vivo.

В настоящей работе впервые показано, что противомеланомное действие антител к CEACAM1 по изобретению in vivo представляет собой комбинированное прямое противоопухолевое действие, а также иммуномодулирующее действие, обеспечивающее большую чувствительность клеток к реактивным лимфоцитам.

Антитело по настоящему изобретению, его фрагменты и производные можно использовать в качестве эффективного средства для диагностики, иммуномодуляции и лечения злокачественных опухолей.

Антитело ингибирует гомофильные взаимодействия CEACAM1, как определяют посредством совместной инкубации эффекторных иммуноцитов и клеток-мишеней, экспрессирующих CEACAM1, и анализа секреции IL-2 и посредством анализов цитолиза in vitro.

Показано, что антитело по настоящему изобретению CM10 усиливает рестриктированный по HLA цитолиз T-клетками и усиливает секрецию гранзима B (сериновая протеаза, вовлеченная в опосредование апоптоза клеток-мишеней) из эффекторных NK и T-клеток в присутствии специфических клеток-мишеней, таким образом обеспечивая наблюдаемый усиленный цитолиз клеток-мишеней посредством антитела. Оно также ингибирует связывание CEACAM1 с CEACAM5 зависимым от дозы способом, таким образом, его можно использовать для лечения злокачественных новообразований, экспрессирующих высокий уровень CEACAM5 и использовать линию CEACAM1-CEACAM5 для подавления иммуноцитов.

Кроме того, в настоящей работе показано, что антитело по изобретению эффективно ингибирует инвазию клеток меланомы. Кроме того, показано, что введение антител по изобретению in vivo, отдельно или в комбинации с реактивными лимфоцитами, эффективно ингибирует рост меланомных опухолей. Комбинация адоптивного переноса T-клеток человека с инъекциями моноклональных антител демонстрировала значимую синергию и сильно ингибировала рост ксенотрансплантата по сравнению с группой изотипического контроля.

По дополнительному аспекту изобретения предоставлено выделенное антитело или фрагмент антитела с той же специфичностью и селективностью связывания, что и у антитела, определенного в настоящем документе, содержащего домен распознавания антигена со специфическими участками CDR, описанными выше. По этому аспекту выделенное антитело или фрагмент антитела посредством последовательностей его специфических участков CDR способно к связыванию той же эпитопной детерминанты белка CEACAM1, что и антитело, описанное выше.

В то же время в настоящем документе описана предполагаемая последовательность эпитопа, с которым связывается моноклональное антитело по изобретению, совместно с предполагаемыми выделенными пептидами, производными из этого эпитопа, которые можно использовать для индукции дополнительных моноклональных антител.

Моноклональные антитела (mAb) можно конструировать для селективного поражения опухолевых клеток и вызова множества видов ответа после связывания. Эти средства могут разрушать опухолевые клетки различными способами, такими как блокирование пролиферации опухолевых клеток или активации иммунной системы. Химерные моноклональные антитела по настоящему изобретению сконструированы для специфического связывания и нейтрализации различных функций белка CEACAM1 и белков других подтипов CEACAM и для индукции специфической гибели опухолевых клеток. Не желая быть связанным какой либо теорией, полагают, что моноклональные антитела по настоящему изобретению действуют также посредством активации действия иммунной системы против злокачественных клеток.

И клинические, и биологические данные указывают на CEACAM1, как на перспективную мишень для разработки направленной иммунотерапии. CEACAM1 не выявляют на нормальных меланоцитах, но он претерпевает неоэкспрессию и широко экспрессирован в подавляющем большинстве образцов метастатической меланомы. Ранее по механизму показано, что CEACAM1 защищает клетки меланомы, ингибируя эффекторные функции NK клеток и T-клеток.

В настоящей работе впервые показано, что CM10 представляет собой химерное моноклональное антитело, которое с высокой аффинностью связывается с CEACAM1 человека. In vitro CM10 зависимым от дозы образом эффективно блокировал гомофильные взаимодействия CEACAM1 и улучшал цитолиз несущих CEACAM1 клеток меланомы T-клетками и NK клетками. Кроме того, CM10 значимо ингибировал рост ксенотрансплантатов меланомы in vivo при системном введении вместе с реактивными в отношении меланомы T-лимфоцитами человека (инфильтрирующие опухоль лимфоциты, TIL). Не желая быть связанным какой либо теорией, это соответствует предполагаемому механизму действия: устранению иммунопротективных взаимодействий опухолевых клеток с активированными лимфоцитами.

Опубликовано несколько свидетельств того, что CEACAM1 экспрессирует широкий спектр эпителиальных клеток, включая клетки толстой кишки, предстательной железы, молочной железы, почек и т.д. Проведено интенсивное исследование профиля экспрессии CEACAM1 в нормальных и злокачественных тканях посредством IHC. Анализ экспрессии продемонстрировал сильное окрашивание клеток меланомы по сравнению с отсутствием окрашивания подавляющего большинства тканей, тестируемых в качестве нормальной ткани человека. Однако наблюдали некоторое селективное окрашивание в ограниченных участках некоторых органов. Когда для подсчета количества молекул mAb CM10, связанных со злокачественными и нормальными первичными клетками, использовали более количественный способ, в нормальных клетках можно было детектировать очень мало молекул CM10, что может указывать на то, что CM10 в основном связывается с опухолевыми клетками пациентов. Кроме того, показано, что CM10 не действует на пролиферацию первичных клеток и полностью или почти полностью не способен к индукции CDC или ADCC, что указывает на потенциальную безопасность моноклонального антитела для людей.

Так как CM10 обладает иммуномодулирующей активностью, оценивают возможные побочные эффекты, связанные с иммунной системой. После активации PBMC на активированных лимфоцитах повышается экспрессия CEACAM1 (Gray-Owen and Blumberg 2006, Nat. Rev. Immunol. 6, 433-46). Анализ пролиферации PBMC человека анализ ex vivo выявил, что CM10 не действует на пролиферативный ответ наивных и активированных PBMC.

Основным преимуществом блокирования CEACAM1 над устранением генерализованных ингибиторных механизмов является ожидаемая селективность вблизи опухоли и таким образом меньшие побочные эффекты по сравнению с обычными иммунотоксичными средствами.

Как показано в настоящей работе CM10 демонстрирует обнадеживающие показатели активности и безопасности, и оно является многообещающим кандидатом для иммунотерапии злокачественной опухоли, и его можно использовать в качестве стратегии для селективного усиления противоопухолевых свойств эндогенного иммунного ответа при определенных злокачественных новообразованиях, таких как меланома и немелкоклеточный рак легких.

Связывание с дополнительными подтипами CEACAM усиливает терапевтические показатели антитела, таким образом, его можно использовать для диагностики и лечения других типов злокачественных новообразований, например, которые активно не экспрессируют CEACAM1, но экспрессируют CEACAM5.

Выявлено, что CEACAM5 сверхэкспрессирована в большом проценте многих опухолей человека, включая 90% злокачественных опухолей желудочно-кишечного тракта, колоректальных злокачественных опухолей (CRC) и злокачественных опухолей поджелудочной железы, 70% клеток немелкоклеточного рака легких и 50% злокачественных опухолей молочной железы. Она также сверхэкспрессирована в злокачественных опухолях щитовидной железы, желудка, яичника и матки (Thompson, Grunert et al. 1991, J Clin Lab Anal 5, 344-66). CEACAM5 даже служит в качестве клинического маркера метастазирования в печень при CRC и постхирургического наблюдения рака толстого кишечника (Duffy 2001, Clin Chem 47, 624-30). Данные о том, что CM10 может связываться с CEACAM5 являются очень важными и могут расширить возможные показания, которые можно лечить посредством CM10 с 4-5 типов злокачественных новообразований до более 10. Средства против CEACAM5, для которых начали клинические испытания, включают антитела к CEACAM5, конъюгированные с токсическими веществами, такими как радиоактивные вещества для диагностических целей и для лечения различных злокачественных новообразований. По-видимому, даже эти токсичные конъюгированные формы не демонстрируют проблем с безопасностью, что может указывать на то, что CEACAM5 является безопасной мишенью.

Эквиваленты подклассов IgG мыши у человека основаны на сходствах биологических и функциональных видов активности. IgG2a и IgG2b мыши и IgG1 и IgG3 человека обладают способностью фиксировать комплемент и связываться с белковыми антигенами (Hussain et al., 1995, Clinical and Diagnostic Laboratory Immunology 726-732). IgG1 мыши и IgG4 человека считают сходными ввиду их свойства связываться с тучными клетками. IgG4 человека является единственным подклассом IgG человека, который не активирует комплемент, а подклассы IgG1 и 3 являются наиболее эффективными активаторами комплемента. Для мышей именно подклассы IgG2a и IgG2b являются активными, как IgG1, и возможно IgG3 является неактивным (Clark MR., Chem Immunol. 1997;65:88-110).

Несколько известных моноклональных антител, распознающих CEACAM1, принадлежат подтипу IgG1 мыши. Так как эквивалентом у человека для IgG1 мыши является IgG4, можно рассчитывать получить химерное антитело, содержащее константный каркас IgG4 человека. Неожиданно по определенным вариантам осуществления настоящего изобретения химерные моноклональные антитела содержат константный каркас IgG1 человека.

По одному из аспектов настоящее изобретение относится к моноклональному антителу, которое распознает CEACAM1, или фрагменту антитела, содержащему по меньшей мере его антигенсвязывающую часть, содержащим по меньшей мере одну CDR тяжелой цепи, содержащую последовательность, выбранную из группы, состоящей из: SEQ ID NO: 1, SEQ ID NO: 2 и SEQ ID NO: 3, и по меньшей мере одну CDR легкой цепи, содержащую последовательность, выбранную из группы, состоящей из: SEQ ID NO: 4, SEQ ID NO: 5 и SEQ ID NO: 6, и их аналогам и производным.

В соответствии с определенными вариантами осуществления описаны аналоги и производные моноклонального антитела или его фрагментов с идентичностью последовательности по меньшей мере 90% с последовательностью эталонной последовательности.

В соответствии с другими вариантами осуществления описаны аналоги и производные моноклонального антитела или его фрагментов с идентичностью последовательности по меньшей мере 95% с эталонной последовательностью.

В соответствии с другими вариантами осуществления описаны аналоги и производные моноклонального антитела или его фрагментов с идентичностью последовательности по меньшей мере 98% с последовательностью CDR эталонного антитела.

По одному из вариантов осуществления антитело или фрагмент антитела содержит по меньшей мере две CDR тяжелой цепи, содержащие последовательность, выбранную из группы, состоящей из: SEQ ID NO: 1, SEQ ID NO: 2 и SEQ ID NO: 3, и по меньшей мере одну CDR легкой цепи, содержащую последовательность, выбранную из группы, состоящей из: SEQ ID NO: 4, SEQ ID NO: 5 и SEQ ID NO: 6 и их аналоги и производные с идентичностью последовательности по меньшей мере 97% с последовательностью моноклонального антитела или его фрагмента.

По другим вариантам осуществления антитело или фрагмент антитела содержит по меньшей мере одну CDR тяжелой цепи, содержащую последовательность, выбранную из группы, состоящей из: SEQ ID NO: 1, SEQ ID NO: 2 и SEQ ID NO: 3, и по меньшей мере две CDR легкой цепи, содержащие последовательность, выбранную из группы, состоящей из: SEQ ID NO: 4, SEQ ID NO: 5 и SEQ ID NO: 6 и их аналоги и производные с идентичностью последовательности по меньшей мере 97% с последовательностью моноклонального антитела или его фрагмента.

По другим вариантам осуществления антитело или фрагмент антитела содержит по меньшей мере две CDR тяжелой цепи, содержащие последовательность, выбранную из группы, состоящей из: SEQ ID NO: 1, SEQ ID NO: 2 и SEQ ID NO: 3, и по меньшей мере две CDR легкой цепи, содержащие последовательность, выбранную из группы, состоящей из: SEQ ID NO: 4, SEQ ID NO: 5 и SEQ ID NO: 6 и их аналоги и производные с идентичностью последовательности по меньшей мере 97% с последовательностью моноклонального антитела или его фрагмента.

По определенным вариантам осуществления антитело или фрагмент антитела содержит по меньшей мере одну последовательность CDR тяжелой цепи по меньшей мере из пяти аминокислот, полученную из последовательности, выбранной из группы, состоящей из: SEQ ID NO: 19, SEQ ID NO: 20 и SEQ ID NO: 21, и по меньшей мере одну последовательность CDR легкой цепи по меньшей мере из пяти аминокислот, полученную из последовательности, выбранной из группы, состоящей из: SEQ ID NO: 22, SEQ ID NO: 23 и SEQ ID NO: 24 и их аналоги и производные с идентичностью последовательности по меньшей мере 97% с последовательностью моноклонального антитела или его фрагмента.

По другим вариантам осуществления участок связывания антитела или его фрагмента состоит из трех CDR тяжелой цепи, выбранных из группы, состоящей из SEQ ID NO: 7, 8, 9, 13, 14 и 15, и трех CDR легкой цепи, выбранных из группы, состоящей из SEQ ID NO: 10, 11, 12, 16, 17, 18 и их аналоги и производные с идентичностью последовательности по меньшей мере 97% с участком связывания антитела.

По другим вариантам осуществления участок связывания антитела состоит из шести CDR с SEQ ID NO: 13, 14, 15, 16, 17 и 18.

По другим вариантам осуществления участок связывания антитела состоит из шести CDR с SEQ ID NO: 7, 8, 9, 10, 11 и 12.

Последовательности CDR по изобретению идентифицировали с использованием двух различных алгоритмов: алгоритма IMGT (Lefranc et al., 1999, Nucleic Acids Research, 27, 209-212); и алгоритма КABAT (Wu TT and Кabat E.A., 1970, J. Exp. Med. 132, 211-250). Описанные последовательности выявлены обоими способами.

По определенным вариантам осуществления CDR1 тяжелой цепи антитела по изобретению или его фрагмента выбрана из NNLIE (SEQ ID NO: 7) и GYAFTNNL (SEQ ID NO: 13).

По определенным вариантам осуществления CDR2 тяжелой цепи антитела по изобретению или его фрагмента выбрана из VINPGSGDTNYNEKFKG (SEQ ID NO: 8) и INPGSGDT (SEQ ID NO: 14).

По определенным вариантам осуществления CDR3 тяжелой цепи антитела по изобретению или его фрагмента выбрана из GDYYGGFAVDY (SEQ ID NO: 9) и ARGDYYGGFAVDY (SEQ ID NO: 15).

По определенным вариантам осуществления CDR1 тяжелой цепи антитела по изобретению или его фрагмента выбрана из RTSQDIGNYLN (SEQ ID NO: 10) и QDIGNY (SEQ ID NO: 16).

По определенным вариантам осуществления CDR2 тяжелой цепи антитела по изобретению или его фрагмента выбрана из YTSRLHS (SEQ ID NO: 11) и YTS (SEQ ID NO: 17).

По определенным вариантам осуществления CDR3 тяжелой цепи антитела по изобретению или его фрагмента выбрана из QQGKSLP (SEQ ID NO: 12) и QQGKSLPRT (SEQ ID NO: 18).

По определенным вариантам осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, где CDR тяжелой цепи состоят из последовательностей SEQ ID NO: 7, 8 и 9.

По определенным вариантам осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, где CDR тяжелой цепи состоят из последовательностей SEQ ID NO: 13, 14 и 15.

По определенным вариантам осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, где CDR легкой цепи состоят из последовательностей SEQ ID NO: 10, 11 и 12.

По определенным вариантам осуществления предоставлено моноклональное антитело, которое распознает CEACAM1, или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, где CDR легкой цепи состоят из последовательностей SEQ ID NO: 16, 17 и 18.

По конкретному варианту осуществления антитело содержит последовательность вариабельного домена тяжелой цепи:

По конкретному варианту осуществления антитело или его фрагмент содержит последовательность вариабельного домена тяжелой цепи, состоящую из SEQ ID NO: 26, и последовательность вариабельного домена легкой цепи, состоящую из SEQ ID NO: 28 или его аналог или производное с идентичностью последовательности по меньшей мере 90% с последовательностью антитела или фрагмента.

По определенным конкретным вариантам осуществления настоящее изобретение относится к моноклональному антителу или фрагменту антитела, содержащим набор из шести CDR, выбранных из i. SEQ ID NO: 13, 14, 15, 16, 17 и 18 и ii. SEQ ID NO: 7, 8, 9, 10, 11 и 12; и их аналогам и производным с идентичностью последовательности по меньшей мере 97% с указанными последовательностями CDR, и каркасную последовательность, выбранную из IgG2a мыши, IgG2b мыши, IgG3 мыши, IgG1 человека, IgG2 человека, IgG3 человека, где моноклональное антитело с аффинностью по меньшей мере приблизительно 5×10-7 M связывается по меньшей мере с двумя подтипами CEACAM.

По конкретному варианту осуществления предоставлены химерное моноклональное антитело, которое распознает CEACAM1, содержащее по меньшей мере одну последовательность CDR, выбранную из группы, состоящей из: SEQ ID NO: 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 и 18; и его аналоги и производные с идентичностью последовательности по меньшей мере 97% с указанными последовательностями CDR и с последовательностью константной области, выбранной из IgG1 человека, IgG2 человека и IgG3 человека, где моноклональное антитело с аффинностью по меньшей мере приблизительно 5×10-7 M связывается по меньшей мере с двумя подтипами CEACAM.

По конкретному варианту осуществления предоставлены химерное или гуманизированное моноклональное антитело, которое распознает CEACAM1, содержащее набор из шести CDR, выбранных из i. SEQ ID NO: 13, 14, 15, 16, 17 и 18 и ii. SEQ ID NO: 7, 8, 9, 10, 11 и 12; и его аналоги и производные с идентичностью последовательности по меньшей мере 97% с указанными последовательностями CDR и с подклассом константной области, выбранным из IgG1 человека, IgG2 человека и IgG3 человека, где моноклональное антитело с аффинностью по меньшей мере приблизительно 5×10-7 M связывается по меньшей мере с двумя подтипами CEACAM.

По другому конкретному варианту осуществления предоставлены химерное моноклональное антитело или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, содержащие последовательность тяжелой цепи, соответствующую SEQ ID NO: 30.

По другому конкретному варианту осуществления предоставлены химерное моноклональное антитело или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, содержащие последовательность легкой цепи, соответствующую SEQ ID NO: 31.

По другому конкретному варианту осуществления предоставлены химерное моноклональное антитело или его фрагмент, содержащий по меньшей мере антигенсвязывающую часть, содержащие последовательность тяжелой цепи IgG1 человека, соответствующую SEQ ID NO: 30, и последовательность легкой цепи IgG1 человека, соответствующую SEQ ID NO: 31.

Определения

Термин "CEACAM1" используют для обозначения белкового продукта гена CEACAM1, например, NP_001020083.1, NP_001703.2. У людей к настоящему времени выявлено 11 различных вариантов сплайсинга CEACAM1. Отдельные изоформы CEACAM1 отличаются в отношении количества внеклеточных иммуноглобулиноподобных доменов (например, CEACAM1 с четырьмя внеклеточными иммуноглобулиноподобными доменами известна как CEACAM1-4), крепления в мембране и/или длины их цитоплазматического конца (например, CEACAM1-4 с длинным цитоплазматическим концом известен как CEACAM1-4L, а CEACAM1-4 с коротким цитоплазматическим концом известен как CEACAM1-4S). N-концевой домен CEACAM1 начинается непосредственно после сигнального пептида и его структуру рассматривают как структуру IgV-типа. Например, в аннотации CEACAM1 P13688 N-концевой домен IgV-типа состоит из 108 аминокислот от аминокислоты 35 до 142. Этот домен идентифицирован, как ответственный за активность гомофильного связывания (Watt et al., 2001, Blood. 98, 1469-79). Все варианты, включая эти варианты сплайсинга, включены в термин "CEACAM1".

"Антитело к CEACAM1", "антитело, которое распознает CEACAM1", "антитело против CEACAM1" или "антитело, направленное к CEACAM1" представляет собой антитело, связывающееся с белком CEACAM1 с достаточной аффинностью и специфичностью. Как правило, антитело по настоящему изобретению способно к связыванию CEACAM1 с минимальной аффинностью приблизительно 10-8 или 10-9 M. Некоторые из моноклональных антител по настоящему изобретению способны к связыванию CEACAM3, 5 и/или 8 с минимальной аффинностью приблизительно 5×10-7 M.

Предпочтительно, антитело к CEACAM1 по изобретению можно использовать в качестве диагностического или терапевтического средства для воздействия и препятствия заболеваниям или патологическим состояниям, где вовлечены экспрессия или активность CEACAM1.

"Антиген" представляет собой молекулу или часть молекулы, способную вызывать образование антител и связываемую антителом. Антиген может содержать один или более одного эпитопа. Подразумевают, что специфическая реакция, указанная выше, означает, что антиген высокоселективно реагирует с соответствующим ему антителом, а не с множеством других антител, которые могут индуцировать другие антигены. Антигеном по настоящему изобретению является белок CEACAM1 или его фрагмент.

Термин "антигенная детерминанта" или "эпитоп" по изобретению относится к области молекулы антигена, которая специфически взаимодействует с конкретным антителом. Пептидные последовательности, получаемые из эпитопа отдельно или в сочетании с молекулой носителя, применяя известные в данной области способы, можно использовать для иммунизации животных и для получения дополнительных поликлональных или моноклональных антител. Выделенные пептиды, получаемые из эпитопа, можно использовать в способах диагностики для детекции антител и в качестве терапевтических средств, когда необходимо ингибирование указанных антител.

Антитела или иммуноглобулины содержат две тяжелые цепи, связанные вместе дисульфидными связями, и две легкие цепи, где каждая легкая цепь связана с соответствующей тяжелой цепью дисульфидными связями в "Y"-образной конфигурации. Протеолитическое расщепление антитела дает домены Fv (вариабельный фрагмент) и Fc (кристаллизующийся фрагмент). Антигенсвязывающие домены, Fab, содержат области вариабельности полипептидных последовательностей. Термин F(ab')2 представляет собой два плеча Fab' связанные вместе дисульфидными связями. Центральную ось антитела называют фрагментом Fc. Каждая тяжелая цепь содержит один концевой вариабельный домен (VH) с последующим рядом константных доменов (CH). Каждая легкая цепь содержит вариабельный домен (VL) на одном из концов и константный домен (CL) на другом конце, где вариабельный домен легкой цепи выровнен с вариабельным доменом тяжелой цепи, а константный домен легкой цепи выровнен с первым константным доменом тяжелой цепи (CH1). Вариабельные домены каждой пары легких и тяжелых цепей формируют антигенсвязывающий участок. Домены на легких и тяжелых цепях обладают сходной общей структурой, и каждый домен содержит четыре каркасные области, последовательности которых являются относительно консервативными, связанные тремя гипервариабельными доменами, известными как определяющие комплементарность области (CDR1-3). Эти домены вносят вклад в специфичность и аффинность антигенсвязывающего участка. Изотип тяжелой цепи (гамма, альфа, дельта, эпсилон или мю) определяет класс иммуноглобулина (IgG, IgA, IgD, IgE или IgM, соответственно). Легкая цепь любого из двух изотипов (каппа, κ, или лямбда, λ) находят во всех классах антител.

Термин "антитело" используют в самом широком смысле, и он включает моноклональные антитела (включая полноразмерные или интактные моноклональные антитела), поликлональные антитела, поливалентные антитела, полиспецифические антитела (например, биспецифические антитела) и фрагменты антител при условии, что они проявляют желательную биологическую активность.

Антитело по настоящему изобретению представляет собой молекулу, содержащую по меньшей мере антигенсвязывающую часть антитела. Антитело или антитела по изобретению включают интактные антитела, такие как поликлональные антитела или моноклональные антитела (mAb), а также их протеолитические фрагменты, такие как фрагменты Fab или F(ab')2. Дополнительно в объем изобретения включены химерные антитела; гуманизированные антитела и антитела человека; рекомбинантные и сконструированные антитела и их фрагменты. Кроме того, ДНК, кодирующую вариабельную область антитела, можно встроить в ДНК, кодирующую другие антитела, с получением химерных антител. Также в объеме настоящего изобретения находятся одноцепочечные антитела.

"Фрагменты антител" содержат только часть интактного антитела, как правило, содержащую антигенсвязывающий участок интактного антитела и, таким образом, сохраняющую способность связывать антиген. Примеры фрагментов антител, охватываемых настоящим определением, включают: (i) фрагмент Fab, содержащий домены VL, CL, VH и CH1; (ii) фрагмент Fab', который представляет собой фрагмент Fab, содержащий на C-конце домена CH1 один или несколько остатков цистеина; (iii) фрагмент Fd, содержащий домены VH и CH1; (iv) фрагмент Fd', содержащий домены VH и CH1 и один или несколько остатков цистеина на C-конце домена CH1; (v) фрагмент Fv, содержащий домены VL и VH одного плеча антитела; (vi) фрагмент dAb (Ward et al, Nature 1989, 341, 544-546), который состоит из домена VH; (vii) выделенные области CDR; (viii) фрагменты F(ab')2, двухвалентный фрагмент, содержащий два фрагмента Fab', связанные дисульфидными мостиками в шарнирной области; (ix) молекулы одноцепочечных антител (например, одноцепочечные Fv; scFv) (Bird et al., Science 1988, 242, 423-426; и Huston et al., PNAS (USA) 1988, 85, 5879-5883); (x) "диатела" с двумя антигенсвязывающими участками, содержащие вариабельный домен тяжелой цепи (VH), связанный с вариабельным доменом легкой цепи (VL) в одной полипептидной цепи (см., например, EP 404097; WO 93/11161; и Hollinger et al., Proc. Natl. Acad. Sci. USA, 1993, 90, 6444-6448); (xi) "линейные антитела", содержащие пару тандемных участков Fd (VH-CH1-VH-CH1), которые вместе c полипептидами комплементарной легкой цепи образуют пару антигенсвязывающих областей (Zapata et al. Protein Eng., 1995, 8, 1057-1062; и патент США № 5641870).

Одноцепочечные антитела могут представлять собой одноцепочечные составные полипептиды со способностью к связыванию антигена и содержать аминокислотные последовательности гомологичные или аналогичные вариабельным областям легкой и тяжелой цепи иммуноглобулина, т.е. связанные VH-VL или одноцепочечный Fv (scFv).

Как используют в настоящем документе, "нейтрализующее антитело" относится к молекуле, содержащей участок связывания антигена к специфическим рецептору- или лиганду-мишени, способные снижать или ингибировать (блокировать) активность или передачу сигнала через рецептор, как определяют посредством анализов in vivo или in vitro, в соответствии с описанием.

Как используют в настоящем документе, термин "моноклональное антитело" относится к антителу, получаемому из популяции по существу гомогенных антител, т.е., отдельные антитела, составляющие популяцию, являются идентичными, за исключением возможных природных мутаций, которые могут присутствовать в незначительных количествах. Моноклональные антитела являются высокоспецифичными, являясь направленными к одному антигену. Кроме того, в отличие от препаратов поликлональных антител, которые, как правило, содержат различные антитела, направленные к различным детерминантам (эпитопам), каждое моноклональное антитело направлено к одной детерминанте на антигене. Модификатор "моноклональное" не следует рассматривать, как требующий получения антитела каким-либо конкретным способом. mAb можно получать любыми способами, известными специалистам в данной области. Например, моноклональные антитела для применения в соответствии с настоящим изобретением можно получать гибридомным способом, впервые описанным Kohler et al., Nature 1975, 256, 495, или можно получать способами рекомбинантных ДНК (например, см. патент США № 4816567). "Моноклональные антитела" также можно выделять из фаговых библиотек антител способами, описанными, например, в Clackson et al., Nature 1991, 352, 624-628 или Marks et al., J. Mol. Biol., 1991, 222:581-597.

mAb по настоящему изобретению могут представлять собой любой класс иммуноглобулинов, включая IgG, IgM, IgE, IgA. Гибридому, продуцирующую mAb, можно культивировать in vitro или in vivo. Высокие титры mAb можно получать посредством получения in vivo, когда клетки отдельных гибридом интраперитонеально инъецируют примированным пристином мышам Balb/c с получением асцитной жидкости, содержащей высокие концентрации желаемых mAb. mAb изотипа IgM или IgG можно выделять из таких асцитных жидкостей или из супернатантов культур с использованием способов колоночной хроматографии, хорошо известных специалистам в данной области.

Моноклональные антитела в настоящем документе в частности включают "химерные" антитела, в которых часть тяжелой и/или легкой цепи идентична или гомологична соответствующим последовательностям в антителах, получаемых у конкретных видов или принадлежащих конкретному классу или подклассу антител, тогда как оставшаяся часть цепи(ей) идентична или гомологична соответствующим последовательностям в антителах, получаемых у других видов или принадлежащих другому классу или подклассу антител, а также фрагменты таких антител, при условии, что они проявляют желательную биологическую активность (патент США № 4816567; и Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851-6855 (1984)). Кроме того, можно проводить прививание определяющей комплементарность области (CDR) с изменением определенных свойств молекулы антитела, включая аффинность или специфичность. Неограничивающий пример прививания CDR в патенте США 5225539.

Химерные антитела представляют собой молекулы, различные части которых получены у различных видов животных, например, молекулы, содержащие вариабельную область, полученную из mAb мыши, и константную область иммуноглобулина человека. Антитела, содержащие каркасные остатки вариабельной области в основном из антитела человека (называемого акцепторным антителом) и определяющие комплементарность области в основном из антитела мыши (называемого донорным антителом) также обозначают как гуманизированные антитела. Химерные антитела преимущественно используют для снижения иммуногенности при применении и для увеличения выхода при получении, например, когда mAb мышей обладают более высокими выходами из гибридом, но более высокой иммуногенностью у людей так, что используют химерные mAb человека/мыши. Химерные антитела и способы их получения известны в данной области (например, патентные заявки PCT WO 86/01533, WO 97/02671, WO 90/07861, WO 92/22653 и патенты США 5693762, 5693761, 5585089, 5530101 и 5225539).

"Гуманизированные" формы не принадлежащих человеку (например, принадлежащих мыши) антител представляют собой химерные антитела, содержащие минимальную последовательность, происходящую из не принадлежащего человеку иммуноглобулина. Преимущественно, гуманизированные антитела представляют собой иммуноглобулины человека (реципиентное антитело), в которых остатки гипервариабельной области реципиента замещены остатками из гипервариабельной области не являющихся человеком видов (донорное антитело), таких как мышь, крыса, кролик или не являющийся человеком примат, имеющей желаемую специфичность, аффинность и емкость. В некоторых случаях соответствующими не принадлежащими человеку остатками замещают остатки каркасной области (FR) иммуноглобулина человека. Кроме того, гуманизированные антитела могут содержать остатки, которые не содержаться в реципиентном антителе или в донорном антителе. Эти модификации проводят для дополнительной оптимизации функциональных характеристик антитела. Как правило, гуманизированное антитело содержит по существу все по меньшей мере из одного, а как правило, двух, вариабельных доменов, в которых все или по существу все гипервариабельные петли, соответствуют петлям не принадлежащего человеку иммуноглобулина, и все или по существу все из FR представляют собой FR из последовательности иммуноглобулина человека. Также гуманизированное антитело необязательно содержит по меньшей мере часть константной области иммуноглобулина (Fc), как правило, Fc иммуноглобулина человека. Более подробно, см. Jones et al., Nature 1986, 321, 522-525; Riechmann et al., Nature 1988, 332, 323-329; и Presta, Curr. Op. Struct. Biol., 1992 2, 593-596.

"Антитело человека" представляет собой антитело, с аминокислотной последовательностью, соответствующей аминокислотной последовательности антитела, продуцируемого у человека и/или получаемого любым из способов получения антител человека, как описано в настоящем документе. Это определение антитела человека конкретно исключает гуманизированное антитело, содержащее не принадлежащие человеку антигенсвязывающие остатки. Антитела человека можно получать различными способами, известными в данной области. В одном из вариантов осуществления антитело человека выбрано из фаговой библиотеки, где эта фаговая библиотека экспрессирует антитела человека (Vaughan et al. Nature Biotechnology 1996 14,309-314; Sheets et al. PNAS (USA), 1998, 95, 6157-6162); Hoogenboom and Winter, J. Mol. Biol., 1991, 227, 381; Marks et al., J. Mol. Biol., 1991, 222, 581). Антитела человека также можно получать посредством введения локусов иммуноглобулинов человека трансгенному животному, например, мыши, у которой эндогенные гены иммуноглобулинов частично или полностью инактивированы. После стимуляции антигеном, наблюдают продукцию антител человека, которая во всех отношениях очень похожа на ту, что наблюдают у людей, включая перестановку, сборку генов и репертуар антител. Этот подход описан, например, в патентах США №№ 5545807; 5545806; 5569825; 5625126; 5633425; 5661016 и в следующих научных публикациях: Marks et al, Bio/Technology 10: 779-783 (1992); Lonberg et al., Nature 368: 856-859 (1994); Morrison, Nature 368:812-13 (1994); Fishwild et al., Nature Biotechnology 14: 845-51 (1996); Neuberger, Nature Biotechnology 14: 826 (1996); Lonberg and Huszar, Intern. Rev. Immunol. 13:65-93 (1995). Альтернативно, антитела человека можно получать посредством иммортализации B-лимфоцитов человека, продуцирующих антитела, направленные к антигену-мишени (такие B-лимфоциты можно получать у индивидуума или можно иммунизировать in vitro). См., например, Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J. Immunol., 147 (1):86-95 (1991) и патент США № 5750373.

Под термином "одноцепочечный вариабельный фрагмент (scFv)" подразумевают слияние вариабельных областей тяжелой и легкой цепей иммуноглобулина, связанных вместе коротким (как правило, сериновым, глициновым) линкером. Одноцепочечные антитела могут представлять собой одноцепочечные составные полипептиды с антигенсвязывающей способностью и содержать аминокислотные последовательности, гомологичные или аналогичные вариабельным областям легкой и тяжелой цепей иммуноглобулина (связанные VH-VL или одноцепочечный Fv (scFv)). VH и VL могут являться копиями природных последовательностей моноклональных антител или одна или обе цепи могут содержать конструкцию CDR-FR вида, описанного в патенте США 5091513, полное содержание которого включено в настоящий документ в качестве ссылки. Отдельные полипептиды, аналогичные вариабельным областям легкой и тяжелой цепей, удерживает вместе полипептидный линкер. Способы получения таких одноцепочечных антител, особенно, где известны ДНК, кодирующие полипептидные структуры цепей VH и VL, можно использовать в соответствии со способами, описанными, например, в патентах США 4946778, 5091513 и 5096815, полное содержание которых включено в настоящий документ в качестве ссылки.

Как используют в настоящем документе, термин "молекула, содержащая антигенсвязывающую часть антитела" предназначен для включения не только молекул интактных иммуноглобулинов любого изотипа и получаемых посредством линий клеток животных или микроорганизмов, но также их антигенсвязывающих реакционноспособных частей, включая в качестве неограничивающих примеров, фрагмент Fab, фрагмент Fab', фрагмент F(ab')2, вариабельную часть их тяжелых и/или легких цепей, мини-антитела Fab (см. WO 93/15210, патентная заявка США 08/256790, WO 96/13583, патентная заявка США 08/817788, WO 96/37621, патентная заявка США 08/999554, полное содержание которых включено в настоящий документ в качестве ссылки), димерные биспецифические мини-антитела (см. Muller et al., 1998) и химерные или одноцепочечные антитела, содержащие такие реакционно-способные части, а также молекулы или клетки любого другого типа, у которых физически встроена такая реакционно-способная часть антитела, такие как химерный T-клеточный рецептор или T-клетка с таким рецептором, или молекулы, разработанные для доставки терапевтических молекул посредством части молекулы, содержащей такую реакционно-способную часть. Такие молекулы можно получать любым известным способом, включая в качестве неограничивающих примеров, ферментативное расщепление, пептидный синтез или рекомбинантные способы.

Антитела по изобретению можно получать посредством введения CEACAM1 или его несущих эпитопы фрагментов, аналогов или экспрессирующих его клеток, животному, предпочтительно не являющемуся человеком с использованием стандартных протоколов. Для получения моноклональных антител можно использовать любой способ, известный в данной области, обеспечивающий получение антител, продуцируемых посредством непрерывных культур линий клеток. Примеры включают различные способы, такие как способы, описанные в Kohler, G. and Milstein, C., Nature 256: 495-497 (1975); Kozbor et al., Immunology Today 4: 72 (1983); Cole et al., pg. 77-96 in MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc. (1985).

Кроме общепринятых способов индукции антител in vivo, антитела можно получать in vitro с использованием технологии фагового дисплея. Такое получение рекомбинантных антител по сравнению с общепринятым получением антител является намного более быстрым и их можно получать к очень большому количеству антигенов. Кроме того, при использовании общепринятого способа, многие антигены оказываются неиммуногенными или крайне токсичными, и, таким образом, их нельзя использовать для получения антител у животных. Кроме того, очень простой и относительно быстрой является созревание аффинности (т.е., увеличение аффинности и специфичности) рекомбинантных антител. Наконец, можно получать большие количества различных антител к конкретному антигену за одну процедуру отбора. Для получения рекомбинантных моноклональных антител можно использовать различные способы, все на основе дисплейных библиотек с получением большой совокупности антител с различными участками распознавания антигена. Такую библиотеку можно получать несколькими способами: можно получать синтетический репертуар, клонируя синтетические области CDR3 в совокупность генов тяжелой цепи зародышевой линии и, таким образом, получая большой репертуар антител, из которых можно выбирать рекомбинантные фрагменты антител с различной специфичностью. Можно в качестве исходного материала для конструирования библиотеки антител использовать совокупность лимфоцитов людей. Можно конструировать репертуары не подвергавшихся воздействию антител IgM человека и, таким образом, получать библиотеку человека с большим разнообразием. Этот способ широко и успешно используют для отбора больших количеств антител к различным антигенам. Протоколы для конструирования и отбора рекомбинантных антител посредством библиотеки бактериофагов предоставлены в хорошо известном справочнике Current Protocols in Immunology, Colligan et al (Eds.), John Wiley & Sons, Inc. (1992-2000), Chapter 17, Section 17.1.

Не принадлежащие человеку антитела можно гуманизировать любыми известными в данной области способами. В одном из таких способов в антитело человека или консенсусную каркасную последовательность антитела встраивают не принадлежащие человеку определяющие комплементарность области (CDR). Затем в каркасе антитела можно проводить дальнейшие изменения для модуляции аффинности или иммуногенности.

Например, в патенте США 5585089, выданном Queen et al., описан гуманизированный иммуноглобулин и способы его получения, где гуманизированный иммуноглобулин содержит определяющие комплементарность области (CDR) из донорного иммуноглобулина и каркасы вариабельных областей тяжелой и легкой цепей из тяжелых и легких цепей акцепторного иммуноглобулина человека, где указанный гуманизированный иммуноглобулин содержит аминокислоты из каркаса донорного иммуноглобулина вне CDR по Kabat и Chothia, где донорные аминокислоты замещают соответствующие аминокислоты в каркасах тяжелой или легкой цепей акцепторного иммуноглобулина.

В патенте США 5225539, выданном Winter, также описано измененное антитело или его антигенсвязывающий фрагмент и способы их получения, где вариабельный домен антитела или антигенсвязывающий фрагмент содержат каркасные области из вариабельных доменов тяжелой или легкой цепей первого иммуноглобулина и определяющие комплементарность области из вариабельных доменов тяжелой или легкой цепей второго иммуноглобулина, где указанные вариабельные домены тяжелой или легкой цепей второго иммуноглобулина отличаются от указанных вариабельных доменов тяжелой или легкой цепей первого иммуноглобулина по специфичности связывания антигена, аффинности связывания антигена, виду, классу или подклассу.

Также включены антиидиотипические антитела специфически иммунореактивные в отношении антитела по изобретению.

Для получения одноцепочечных антител к полипептидам или полинуклеотидам по настоящему изобретению можно адаптировать способы получения одноцепочечных антител (патент США № 4946778). Также для экспрессии гуманизированных антител, иммуноспецифичных к полипептидам или полинуклеотидам по изобретению, можно использовать трансгенных мышей или другие организмы, такие как другие млекопитающие.

Альтернативно, для отбора генов антител с активностью связывания в отношении полипептида по изобретению из репертуаров амплифицированных посредством ПЦР v-генов лимфоцитов людей, подвергнутых скринингу на наличие антител к CEACAM1, или из библиотеки можно использовать технологию фагового дисплея (McCafferty, et al., 1990, Nature 348, 552-554; Marks, et al., 1992, Biotechnology 10, 779-783). Аффинность этих антител также можно улучшить, например, посредством перестановки цепей (Clackson et al., 1991, Nature 352:628).

Описанные выше антитела можно использовать для выделения или идентификации клонов, экспрессирующих полипептиды, для очистки полипептидов, например, посредством аффинной хроматографии.

Изобретение также относится к вариантам с консервативными аминокислотами в молекулах антител по изобретению. Также можно получать варианты по изобретению, которые сохраняют общую молекулярную структуру кодируемых белков. Учитывая свойства отдельных аминокислот, составляющих описываемые белковые продукты, специалистам понятны определенные разумные замены. Замены аминокислот, т.е. "консервативные замены", можно производить, например, на основе сходства полярности, заряда, растворимости, гидрофобности, гидрофильности и/или амфипатического характера затрагиваемых остатков.

"Нарушение" представляет собой любое состояние, при котором можно получить положительный результат от лечения антителом. Оно включает хронические и острые нарушения или заболевания, включая такие патологические состояния, которые предрасполагают млекопитающего к рассматриваемому нарушению. Неограничивающие примеры нарушений для лечения по настоящему изобретению, включают доброкачественные и злокачественные опухоли; лейкозные и лимфоидные злокачественные новообразования; нейрональные, глиальные, астроцитарные, гипоталамические и другие железистые, макрофагальные, эпителиальные, стромальные и бластоцельные нарушения; и воспалительные, ангиогенные, иммунологические нарушения или состояния с повышенной проницаемостью.

Термин "терапевтически эффективное количество" относится к количеству лекарственного средства, эффективному для лечения заболевания или нарушения у млекопитающего. В случае злокачественной опухоли терапевтически эффективное количество лекарственного средства может снижать количество злокачественных клеток; уменьшать размер опухоли; ингибировать (т.е., до некоторой степени замедлять, а предпочтительно останавливать) инфильтрацию злокачественных клеток в периферические органы; ингибировать (т.е., до некоторой степени замедлять, а предпочтительно останавливать) метастазирование опухолей; до некоторой степени ингибировать рост опухолей и/или до некоторой степени ослаблять один или несколько симптомов, ассоциированных с нарушением. В тех случаях, когда лекарственное средство может предотвращать рост и/или уничтожать злокачественные клетки, оно может быть цитостатическим и/или цитотоксическим. Для лечения злокачественных опухолей эффективность in vivo можно измерять, например, оценивая длительность выживания, время до прогрессирования заболевания (TTP), частоты ответа (RR), длительность ответа и/или качество жизни.

"Лечение" относится к терапевтическому лечению и профилактическим или превентивным мерам. Индивидуумы, нуждающиеся в лечении, включают индивидуумов, у которых уже присутствует нарушение, а также индивидуумов, которым нарушение необходимо предотвратить.

Термины "злокачественная опухоль" и "злокачественный" относятся или описывают физиологическое состояние у млекопитающих, которое, как правило, характеризуется нерегулируемым клеточным ростом. Примеры злокачественных опухолей в качестве неограничивающих примеров включают карциному, лимфому, бластому, саркому и лейкоз. Более конкретные примеры таких злокачественных опухолей включают меланому, злокачественные опухоли легких, щитовидной железы, молочной железы, толстой кишки, предстательной железы, печени, мочевого пузыря, почки, шейки матки, поджелудочной железы, лейкоз, лимфому, миелоидные злокачественные опухоли, злокачественные опухоли яичника, матки, саркому, злокачественные опухоли желчных путей или эндометрия.

В соответствии с определенными вариантами осуществления антитело по настоящему изобретению связано с цитотоксической или терапевтической молекулой. Цитотоксическая или терапевтическая молекула может представлять собой, например, цитотоксическую молекулу, токсическую молекулу, молекулу цитокина, молекулу биспецифического антитела, цитотоксин, хемокин, химиотерапевтическое средство, проапоптотическое средство, интерферон, радиоактивную молекулу или их сочетания, примеры которых предоставлены ниже.

Термин "противоопухолевая композиция" относится к композиции, пригодной для лечения злокачественной опухоли, содержащей по меньшей мере одно активное терапевтическое средство, способное ингибировать или предотвращать рост или функционирование опухоли и/или вызывать разрушение опухолевых клеток. Терапевтические средства, подходящие для противоопухолевой композиции для лечения злокачественной опухоли, включают, но не ограничиваются ими, химиотерапевтические средства, радиоактивные изотопы, токсины, цитокины, такие как интерфероны, и антагонистические средства, направленные к цитокинам, рецепторам цитокинов или антигенам, ассоциированным с опухолевыми клетками. Предпочтительно, терапевтическое средство представляет собой химиотерапевтическое средство.

Как используют в настоящем документе, термин "диагностика" относится к определению наличия или отсутствия патологии, классификации патологии или симптома, определения тяжести патологии, мониторингу прогрессирования патологии, предсказанию исхода патологии и/или перспектив восстановления.

Фармакология

Настоящее изобретение также относится к фармацевтическим составам для медицинского применения для человека, которые в качестве активного средства содержат по меньшей мере одно антитело, которое распознает CEACAM1, для получения терапевтических или диагностических композиций для лечения, диагностики или профилактики состояний отдельно описываемых в настоящем документе.

В таких фармацевтических и лекарственных составах активное средство предпочтительно используют вместе с одним или несколькими фармацевтически приемлемыми носителями) и, необязательно, с любыми другими терапевтическими ингредиентами. Носитель(и) должен быть фармацевтически приемлемым в смысле совместимости с другими ингредиентами состава и отсутствия чрезмерного вреда для принимающего его индивидуума. Активное средство предоставлено в количестве, эффективном для достижения желаемого фармакологического эффекта, как описано выше, и в количестве, достаточном для достижения желаемой суточной дозы.

Как правило, молекулы по настоящему изобретению, содержащие антигенсвязывающую часть антитела или содержащие другой полипептид, включая пептидомиметик, суспендируют в стерильном физиологическом растворе для терапевтического применения. Альтернативно можно формулировать фармацевтические композиции с контролем высвобождения активного ингредиента (молекулы, содержащей антигенсвязывающую часть антитела) или с продлением его присутствия в организме пациента. Известно множество подходящих систем доставки лекарственных средств, и они включают, например, имплантируемые системы высвобождения лекарственных средств, гидрогели, гидроксиметилцеллюлозу, микрокапсулы, липосомы, микроэмульсии, микросферы и т.п. Препараты с контролируемым высвобождением можно получать с использованием полимеров, образующих комплекс с молекулой по настоящему изобретению или адсорбирующих ее. Например, биосовместимые полимеры включают матриксы из сополимера этилена с винилацетатом и матриксы из полиангидридного сополимера димера стеариновой кислоты и себариновой кислоты. Скорость высвобождения молекулы по настоящему изобретению, т.е. антитела или фрагмента антитела, из таких матриксов зависит от молекулярной массы молекулы, количества молекулы в матриксе и размера желаемых частиц.

Фармацевтическую композицию по настоящему изобретению можно вводить любыми подходящими способами, например, перорально, местно, интраназально, подкожно, внутримышечно, внутривенно, внутриартериально, внутрь сустава, внутрь очага или парентерально. Как правило, предпочтительным является внутривенное (в/в), внутрисуставное, местное или парентеральное введение.

Специалистам в данной области очевидно, что терапевтически эффективное количество молекулы по настоящему изобретению в числе прочего зависит от схемы введения, стандартной дозы вводимой молекулы, вводят ли молекулу в комбинации с другими терапевтическими средствами, иммунного статуса и состояния здоровья пациента, терапевтической активности вводимой молекулы и решения лечащего врача. Как используют в настоящем документе, "терапевтически эффективное количество" относится к количеству молекулы, необходимому для ослабления одного или нескольких симптомов, ассоциированных с нарушением, подвергаемым лечению в течение периода времени.

Хотя подходящая доза молекулы по изобретению варьирует в зависимости от способа введения, типа молекулы (полипептид, полинуклеотид, органическая молекула и т.д.), возраста, массы тела, пола или состояния пациента, и в конечном счете ее должен определить врач, в случае перорального введения суточная доза, как правило, может составлять приблизительно от 0,01 мг до приблизительно 500 мг, предпочтительно приблизительно от 0,01 мг до приблизительно 50 мг, более предпочтительно приблизительно от 0,1 мг до приблизительно 10 мг на кг массы тела. В случае парентерального введения суточная доза, как правило, может составлять приблизительно от 0,001 мг до приблизительно 100 мг, предпочтительно приблизительно от 0,001 мг до приблизительно 10 мг, более предпочтительно приблизительно от 0,01 мг до приблизительно 1 мг на кг массы тела. Суточную дозу можно вводить, например, в схемах лечения, как правило, 1-4 отдельных введений ежесуточно. Другие предпочтительные способы введения включают внутрисуставное введение приблизительно от 0,01 мг до приблизительно 100 мг на кг масса тела. Различные факторы, рассматриваемые в отношении достижения эффективного количества, описаны, например, в Goodman and Gilman's: The Pharmacological Bases of Therapeutics, 8th ed., Pergamon Press, 1990; и Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Co., Easton, Pa., 1990.

Подходящие режимы дозирования комбинации химиотерапевтических средств известны в данной области и описаны, например, в Saltz et al. Proc ASCO 1999, 18, 233a и Douillard et al., Lancet 2000, 355, 1041-7.

Молекулы по настоящему изобретению в качестве активных ингредиентов растворяют, диспергируют или примешивают в эксципиент, который является фармацевтически приемлемым и совместимым с активным ингредиентом, как хорошо известно. Подходящие эксципиенты представляют собой, например, воду, физиологический раствор, фосфатно-солевой буфер (PBS), декстрозу, глицерин, этанол или т.п. и их сочетания. Специалистам в данной области хорошо известны другие подходящие носители. Кроме того, при желании, композиция может содержать незначительные количества вспомогательных веществ, таких как, увлажнители или эмульгаторы, средства для буферирования pH.

Фармацевтическую композицию по настоящему изобретению можно вводить вместе с противоопухолевой композицией. По конкретному варианту осуществления противоопухолевая композиция содержит по меньшей мере одно химиотерапевтическое средство. Химиотерапевтическое средство, которое можно вводить вместе с антителом по настоящему изобретению или раздельно, может включать любое такое средство, известное в данной области, демонстрирующее противоопухолевую активность, включая в качестве неограничивающих примеров: митоксантрон, ингибиторы топоизомеразы, яды стебля барвинка: винбластин, винкристин, винорелбин (таксол), паклитаксел, доцетаксел; алкилирующие средства: мехлоретамин, хлорамбуцил, циклофосфамид, мелфалан, ифосфамид; метотрексат; 6-меркаптопурин; 5-фторурацил, цитарабин, гемцитабин; подофиллотоксины: этопозид, иринотекан, топотекан, дакарбазин; антибиотики: доксорубицин (адриамицин), блеомицин, митомицин; нитрозомочевину: кармустин (BCNU), ломустин, эпирубицин, идарубицин, даунорубицин; неорганические ионы: цисплатин, карбоплатин; интерферон, аспарагиназу; гормоны: тамоксифен, лейпролид, флутамид и мегестролацетат.

По конкретному варианту осуществления химиотерапевтическое средство выбрано из группы, состоящей из алкилирующих средств, антиметаболитов, аналогов фолиевой кислоты, аналогов пиримидинов, аналогов пуринов и родственных ингибиторов, алкалоидов барвинка, эпиподофиллотоксинов, антибиотиков, L-аспарагиназы, ингибитора топоизомеразы, интерферонов, координационных комплексов платины, замещенной антрацендионом мочевины, производных метилгидразина, супрессора гормонов коры надпочечника, адренокортикостероидов, прогестинов, эстрогенов, антиэстрогена, андрогенов, антиандрогенов и аналога ганадолиберина. По другому варианту осуществления химиотерапевтическое средство выбрано из группы, состоящей из 5-фторурацила (5-FU), лейковорина (LV), иринотекана, оксалиплатина, капецитабина, паклитаксела и доцетаксела. В смеси для введения в комбинации с введением антитела к CEACAM1 можно использовать два или более химиотерапевтических средств.

Приводимые ниже примеры предназначены для иллюстрации того, как получать и применять соединения и способы по настоящему изобретению, и их никоим образом не следует рассматривать как ограничение. Хотя изобретение далее будет описано в соответствии с его конкретными вариантами осуществления, очевидно, что специалистам в данной области понятны модификации и вариации. Таким образом, полагают, что оно охватывает все такие модификации и вариации, которые соответствуют сущности и попадают в широкие рамки приложенной формулы изобретения.

ПРИМЕРЫ

Способы получения и характеристики антител хорошо известны в данной области. Описание приведено для иллюстрации способов получения, характеристики и применения антител к CEACAM1 по настоящему изобретению.

Как правило, номенклатура, используемая в настоящем документе, и лабораторные способы, используемые в настоящем изобретении, включают молекулярные, биохимические, микробиологические способы и технологии рекомбинантных ДНК. Такие способы подробно описаны в литературе. См., например, "Molecular Cloning: A Laboratory Manual" Sambrook et al., 1989; "Current Protocols in Molecular Biology" Volumes I-III Ausubel, R. M., ed. 1994; Ausubel et al., "Current Protocols in Molecular Biology", John Wiley and Sons, Baltimore, Maryland 1989; Perbal, "A Practical Guide to Molecular Cloning", John Wiley & Sons, New York 1988; Watson et al., "Recombinant DNA", Scientific American Books, New York; Birren et al. (eds) "Genome Analysis: A Laboratory Manual Series", Vols. 1-4, Cold Spring Harbor Laboratory Press, New York 1998; способы, приведенные в патентах США №№ 4666828; 4683202; 4801531; 5192659 и 5272057; "Cell Biology: A Laboratory Handbook", Volumes I-III Cellis, J. E., ed. 1994; "Current Protocols in Immunology" Volumes I-III Coligan J. E., ed. 1994; Stites et al. (eds), "Basic and Clinical Immunology" (8th Edition), Appleton & Lange, Norwalk, CT 1994; Mishell and Shiigi (eds), "Selected Methods in Cellular Immunology", W. H. Freeman and Co., New York 1980; доступные иммунологические анализы, подробно описанные в патентной и научной литературе, см., например, патенты США №№ 3791932; 3839153; 3850752; 3850578; 3853987; 3867517; 3879262; 3901654; 3935074; 3984533; 3996345; 4034074; 4098876; 4879219; 5011771 и 5281521; "Oligonucleotide Synthesis" Gait, M. J., ed. (1984); "Nucleic Acid Hybridization" Hames, B. D., and Higgins S. J., eds. 1985; "Transcription and Translation" Hames, B. D., and Higgins S. J., Eds. 1984; "Animal Cell Culture" Freshney, R. I., ed. 1986; "Immobilized Cells and Enzymes" IRL Press, (1986); "A Practical Guide to Molecular Cloning" Perbal, B., 1984 и "Methods in Enzymology" Vol. 1-317, Academic Press; "PCR Protocols: A Guide To Methods And Applications", Academic Press, San Diego, CA 1990; Marshak et al, "Strategies for Protein Purification and Characterization - A Laboratory Course Manual" CSHL Press 1996. Полагают, что описанные в этих ссылках способы хорошо известны в данной области.

Пример 1: Получение и характеристика моноклональных антител, распознающих CEACAM

Моноклональные антитела, эффективно блокирующие гомофильные взаимодействия CEACAM1 in vitro в наномолярных концентрациях получали посредством иммунизации мышей рекомбинантным белком CEACAM1 человека. Получали гибридомы, продуцирующие блокирующие CEACAM1 антитела, и несколько раз повторно клонировали с получением стабильного клона.

Последовательности ДНК и аминокислот одного из иллюстративных моноклональных антител, распознающих CEACAM1, определяли с помощью Fusion Antibodies Ltd. мРНК экстрагировали из осадков гибридомных клеток и из осадков выделяли тотальную РНК с использованием протокола выделения РНК. Из РНК посредством обратной транскрипции с праймером олиго(dT) с использованием ОТ-ПЦР получали кДНК. Для амплификации ДНК областей VH и VL моноклонального антитела использовали реакции ПЦР с использованием праймеров для вариабельных доменов.

Продукты VH и VL клонировали в вектор для секвенирования Invitrogen pCR2.1 и трансформировали в TOP 10 для получения трансформантов. Выбранные колонии накалывали и анализировали посредством секвенирования. Определенные в результате последовательности ДНК и аминокислот представляют собой:

Вариабельная область тяжелой цепи (VH)

Последовательность ДНК домена VH:

ATGGGATGGACCTTGGTCTTTCTCTTTCTCCTGTCAGTAACTGCAGGTGTTCACTCCCAGGTCCAGCTGCAGCAGTCTGGAGCTGAGCTGGTAAGGCCTGGGACTTCAGTGAAGGTGTCCTGCAAGGCTTCTGGATACGCCTTCACTAATAACTTGATAGAGTGGGTAAAACAGAGGCCTGGACAGGGCCTTGAGTGGATTGGAGTGATTAATCCTGGAAGTGGTGATACTAACTACAATGAGAAGTTCAAGGGCAAGGCAACACTGACTGCAGACAAATCCTCCAACACTGCCTACATGCAGCTCAGCAGCCTGACATCTGATGACTCTGCGGTCTATTTCTGTGCAAGAGGGGATTACTACGGTGGCTTTGCTGTGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCCAAAACGACACCCCCATCCGTTTATCCCTTGGCCCCTGGAAGCTTGGG (SEQ ID NO: 25).

Аминокислотная последовательность домена VH:

QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSGDTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYWGQGTSVTVSS (SEQ ID NO: 26).

Вариабельная область легкой цепи (VL1)

Последовательность ДНК домена VL:

ATGGTGTCCTCAGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGAACCAGATGTGATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGACAAGTCAGGACATTGGCAATTATTTAAACTGGTATCAGCAGAAACCAGATGGAACTGTTAAACTCCTGATCTACTACACATCAAGATTACACTCAGGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACCATTAGCAACCTGGAGCAAGAAGATATTGCCACTTACTTTTGCCAACAGGGTAAAAGCCTTCCTCGGACGTTCGGTGGAGGCACCAAGTTGGAAATCAAACGGGCTGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAGAGA (SEQ ID NO: 27).

Аминокислотная последовательность домена VL:

DIQMTQTTSSLSASLGDRVTISCRTSQDIGNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKSLPRTFGGGTKLEIK (SEQ ID NO: 28).

Для подтверждения подлинности VL и VH использовали N-концевое секвенирование аминокислот и масс-спектрометрический анализ.

Пример 2: Подтверждение N-концевой последовательности аминокислот

Для подтверждения N-концевой последовательности легкой цепи одного из моноклональных антител проводили анализ последовательности аминокислот легкой цепи способом деградации по Эдману. Полученная N-концевая последовательность представляла собой: DIQMTQTTSS (SEQ ID NO: 29), что соответствовало ожидаемой N-концевой последовательности на основе последовательности ДНК.

Пример 3: Последовательности определяющих комплементарность областей (CDR)

Участки CDR идентифицировали с использованием двух различных алгоритмов:

1. Алгоритм IMGT (Lefranc et al., 1999, Nucleic Acids Research, 27, 209-212);

2. Алгоритм KABAT (Wu TT and Kabat E.A., 1970, J. Exp. Med. 132, 211-250).

В таблице 1 обобщены определенные с использованием этих двух способов последовательности CDR, а также минимальная консенсусная последовательность и комбинированная последовательность из последовательностей, идентифицированных двумя этими способами.

Пример 4: Конструирование и получение химерного моноклонального антитела

Последовательности ДНК вариабельных областей тяжелой и легкой цепей (SEQ ID NO: 25 и 27) использовали для конструирования химерного антитела, содержащего константные домены изотипа IgG1 человека и константный домен легкой цепи (CL) каппа Ig человека. Хотя исходное моноклональное антитело представляет собой IgG1 мыши и его эквивалент у человека представляет собой IgG4, для конструирования некоторых химерных антител по настоящему изобретению использовали каркас IgG1 человека. Последовательности ДНК легкой цепи и тяжелой цепи синтезировали и клонировали в экспрессирующий вектор pFUSION-DHFR1 под контролем отдельных промоторов.

Транзиторная трансфекция клеток CHO

Суспензию клеток CHO (Invitrogen, UK) культивировали при 130 об./мин., 8% CO2, 37°C в среде без сыворотки Pro CHO 5 (Lonza, UK) в 250 и 500 мл вентилируемых колбах Эрленмейера (Corning, Netherlands). На сутки трансфекции клетки высевали при плотности 2,0×106 клеток/мл, в клетки трансфицировали 2,5 г/мл плазмидной ДНК (Geneart, Germany) с использованием полиэтиленимина (Polysciences Inc, PA, US). Трансфицированные культуры инкубировали при 130 об./мин., 8% CO2, 37°C в течение 9-10 суток. Перед сбором культуры супернатанты центрифугировали при 4000 об./мин. в течение 40 минут.

Среды собирали и очищали в двух отдельных порциях. Среды фильтровали через 0,8 мкм фильтр GyroDisc и очищали с 1 мл использованием колонки с белком A. Антитело очищали посредством FPLC. Вносили 320 мл образца при 0,2 мл/мин в течение ночи и через 17 часов увеличивали до 0,5 мл/мин. Колонку отмывали/уравновешивали PBS при 0,5 мл/мин с последующей элюцией буфером для элюции Gly/HCL с pH 3,0. Наблюдали хороший пик и фракции от 1 до 5 количественно определяли посредством анализа по Брэдфорду. Анализ по Брэдфорду продемонстрировал присутствие белка во фракциях 1-4, которые объединяли и подвергали диализу для замены буфера в течение ночи в 1 литре PBS (4°C, 120 об./мин.). Для 4 мл образца наблюдали концентрацию 1,823 мг/мл, таким образом, очистку проводили с общим выходом приблизительно 7,32 мг. Во второй партии результаты анализа по Брэдфорду продемонстрировали присутствие белка во фракциях 1-3, которые объединяли и подвергали диализу. Из 320 мл кондиционированной среды очистку проводили с общим выходом приблизительно 7,32 мг (партия A). Из 910 мл культуры очистку проводили с общим выходом приблизительно 15,74 мг (партия B). Общая транзиторная экспрессия приводила к выходу приблизительно 23 мг очищенного белка. После определения концентрации и анализа SDS/PAGE получали 19,65 мг химерного антитела. Образцы очищенного антитела анализировали посредством SDS-PAGE для оценки чистоты. На фиг. 1 приведено изображение геля SDS-PAGE, демонстрирующее легкие и тяжелые цепи химерного антитела. MS анализ выявил, что молекулярная масса тяжелой цепи CM10 составляет 48,6 КДа, а легкой цепи составляет 23,3 КДа.

Аминокислотные последовательности тяжелой и легкой цепей полученного антитела, обозначенного CM10, представляют собой:

Аминокислотная последовательность тяжелой цепи (без сигнального пептида):

QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSGDTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 30).

Вариабельный домен приведен полужирным шрифтом, CDR в соответствии с IMGT подчеркнуты.

Аминокислотная последовательность легкой цепи (без сигнального пептида):

DIQMTQTTSSLSASLGDRVTISCRTSQDIGNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKSLPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:31).

Вариабельный домен приведен полужирным шрифтом, CDR в соответствии с IMGT подчеркнуты.

Плазмиду, содержащую последовательности ДНК тяжелой и легкой цепей иллюстративного химерного моноклонального антитела, обозначенного CM10, депонировали 28 сентября 2011 года под номером доступа ATCC PTA-12130.

Пример 5: Характеристика аффинности химерного моноклонального антитела CM10

Связывание CM10 с очищенной CEACAM1 человека

Специфичность связывания CM10 с CEACAM1 человека тестировали в анализе ELISA с использованием очищенной CEACAM1 человека. Применяли непрямой ELISA с использованием 23 двойных разведений CM10 с получением кривой специфического связывания. Результаты, представленные на фиг. 2, представляют среднюю O.D. из трех повторений ±SE. Сходные результаты получали из десяти независимых экспериментов.

Для тестирования возможного влияния процесса химеризации на аффинность связывания антитела химерное антитело CM10 оценивали на связывание CEACAM1 в анализах конкурентного ELISA и BIAcore.

Для ELISA рекомбинантную очищенную CEACAM1 человека связывали с подложкой. В качестве метки использовали химически биотинилированный CM10 при постоянной концентрации, и осуществляли его конкуренцию с увеличивающимися концентрациями немеченого CM10. После инкубации и отмывки планшет обрабатывали конъюгатом стрептавидин-HRP и проводили цветовую реакцию с TMB в качестве субстрата HRP.

С использованием 50 нг/мл метки детектируемые значения видимой аффинности для CM10 составляли 1,2-1,6 нМ.

Анализ BIAcore

Каждое антитело иммобилизовали на одном канале сенсорного чипа CM5 устройства Biacore3000 посредством химического связывания NHS-EDC.

Над чипом при 50 мкл/мин пропускали поток рекомбинантной CEACAM1 в различных концентрациях (0,19, 0,39, 0,78, 1,56, 3,12, 6,25, 12,5 и 25 нМ). Пропускаемый буфер представлял собой PBS-ET (10 мМ фосфатный буфер pH 7,4, 150 мМ NaCl, 3,4 мМ ЭДТА и 0,005% Tween 20). Данные анализировали с использованием программного обеспечения BIAEvaluation версии 3.0 и значения KD для аффинности CM10-CEACAM1, рассчитанные из трех независимых экспериментов составляли (KD): 4,07-5,05 нМ (среднее 4,56 нМ).

Специфичность связывания CM10 с мембраносвязанной эндогенной CEACAM1

Для тестирования связывания CM10 с мембраносвязанной эндогенной CEACAM1 проводили анализ FACS. На экспрессию hCEACAM1 скринингу подвергали несколько линий клеток меланомы человека, при этом линию клеток 526mel использовали в качестве положительного контроля, а 003mel - в качестве линии отрицательного контроля. Линии клеток 526mel, 003mel, Malme 3M, Skmel 5 и A375 окрашивали CM10. Незакрашенные гистограммы представляют собой окрашивание mAb, тогда как закрашенные гистограммы представляют собой фоновое окрашивание. Для анализа экспрессии CEACAM1 для каждой гистограммы использовали по меньшей мере 5000 клеток.

Как можно понять из фиг. 3, посредством CM10 детектируют мембраносвязанную эндогенную CEACAM1. Линии клеток Malme3M и Skmel5 продемонстрировали высокую экспрессию CEACAM1, тогда как в линии клеток меланомы A375 экспрессию детектировать не удалось.

Выводы

Процесс химеризации проводили успешно. Химерное антитело связывает CEACAM1 c аффинностью 1,4 нМ, что подтверждали двумя различными подходами. Анализ FACS, где тестировали специфичность связывания CM10 с различными линиями клеток меланомы, продемонстрировал, что антитело сохраняло свою биологическую связывающую способность.

Пример 6. Оценка активности CM10

Анализ блокирования межклеточного взаимодействия

В анализе, определяющем способность mAb к CEACAM1 блокировать межклеточные взаимодействия посредством CEACAM1, использовали T-клетки мыши (клетки BW), стабильно трансфицированные химерной молекулой, состоящей из внеклеточной части CEACMA1 человека, слитой с z-цепью мыши (BW/CEACAM1). Включение CEACAM1 посредством совместной инкубации клеток BW/CEACAM1 с B-клетками, стабильно трансфицированными CEACAM1 (221/CEACAM1), приводит к секреции IL-2 мыши, опосредуемой z-цепью.

Эффекторные клетки (BW, экспрессирующие CEACAM1) инкубировали в присутствии CM10 или PBS в течение 30 минут на льду. После инкубации эффекторные клетки совместно культивировали в течение ночи с клетками-мишенями, экспрессирующими CEACAM1 (221+) или не несущими CEACAM1 (221-). Секрецию IL-2 мыши измеряли посредством коммерческого ELISA. Результаты, представленные на фиг. 4, представляют среднюю секрецию IL-2 в дублированных лунках. Как показано на фигуре, после добавления CM10, опосредуемые CEACAM1 межклеточные взаимодействия между T- и B-клетками устранялись зависимым от дозы способом, на что указывает блокирование секреции IL-2.

Анализы иммуномодулирующего цитолиза in vitro

Анализы цитолиза T-клетками: реактивные в отношении меланомы T-клетки TIL (проникающие в опухоль лимфоциты, получаемые у пациентов с меланомой) могут разрушать клетки меланомы с совпадающим HLA. TIL приобретали в ELLA Institute at Shiba medical center и выращивали в соответствии с протоколами клинических лабораторий. Меченные CFSE клетки меланомы (SKmel5) предварительно инкубировали с CM10 (10 мкг/мл) в течение 30 минут на льду. В течение дальнейших 10 часов инкубации при 37°C добавляли TIL. Процент цитолиза определяли посредством окрашивания йодидом пропидия меченных CFSE клеток меланомы. Соотношение эффектора к мишени составляло 5:1. В другом анализе, меченные CFSE клетки меланомы предварительно инкубировали c CM10 в течение 30 минут на льду. В течение дальнейших 5 часов инкубации при 37°C добавляли TIL. Процент цитолиза определяли посредством окрашивания йодидом пропидия меченных CFSE клеток меланомы. Результаты представляют средний % специфического цитолиза из трижды повторенных лунок ±SE на обработку. Соотношение эффектора к мишени составляло 5:1.

Результаты, представленные на фиг. 5, демонстрируют, что цитолитическая активность T-клеток в присутствии mAb к CEACAM1, CM10, возрастает. Кроме того, в условиях анализа, когда TIL были неспособны уничтожить какие либо клетки меланомы (короткий период инкубации или низкое отношение TIL), добавление CM10 стимулировало цитолитическую активность TIL, тогда как при использовании изотипического контроля IgG1 цитолиза детектировать не удалось (фиг. 6).

Анализ цитолиза NK клетками

Естественные клетки-киллеры (NK клетки) представляют собой тип цитотоксических лимфоцитов, который может разрушать злокачественные клетки, высвобождая небольшие белки, называемые перфорином и гранзимом, которые вызывают гибель клетки-мишени посредством апоптоза. NK клетки можно активировать несколькими различными путями, включая цитокины, рецептор FC и отсутствие MHC 1 класса на клетках-мишенях. Конечную цитотоксическую активность NK клеток регулируют несколько активирующих и ингибирующих рецепторов для различных лигандов на клетках-мишенях. Клетки NK 92MI являются независимой от IL-2 линией NK клеток, которую приобретали в ATCC.

NK 92MI инкубировали с CM10 (0,2 мкг/мл, 1 мкг/мл или 5 мкг/мл) или совпадающим по изотипу контрольным Ab (5 мкг/мл) в течение 30 минут при 37°C, в течение последующих 5 часов добавляли клетки-мишени, экспрессирующие CEACAM1. Процент цитолиза определяли посредством классического анализа высвобождения LDH. Результаты представляют средний % цитотоксичности из трижды повторенных лунок ±SE на обработку. Соотношение эффектора к мишени составляло 2,5:1.

Анализ, описанный на фиг. 7, демонстрирует, что CM10 по сравнению с PBS или совпадающим по изотипу IgG резко усиливает цитолитическую активность NK клеток в отношении двух линий клеток меланомы, экспрессирующих CEACAM1 (SKMel5 и G361). Сходные результаты продемонстрированы для двух других несущих CEACAM1 линий клеток меланомы и для различных отношений эффектора к мишени (E:T).

Антителозависимая клеточная цитотоксичность

Антителозависимая клеточная цитотоксичность (ADCC) представляет собой механизм клеточного иммунитета, посредством которого эффекторные клетки иммунной системы (главным образом NK клетки) активно лизируют клетки-мишени, связанные специфическим антителом. Для оценки показателей безопасности CM10 авторы провели предварительный анализ ADCC, где исследовали способность CM10 индуцировать ADCC в трех линиях клеток меланомы (линии несущих CEACAM1 клеток: G361 и SKmel5 и линия клеток без CEACAM1: SKmel28).

Способность CM10 индуцировать ADCC исследовали в сравнении с антителом положительного контроля (поликлональные Ab к CEACAM1, продемонстрировавшие активность ADCC в предварительном эксперименте). В качестве отрицательного контроля служило совпадающее по изотипу антитело (hIgG1 K). Результаты свидетельствуют, что CM10 не инициирует ADCC в тестируемых условиях.

Обусловленная комплементом цитотоксичность

Белки комплемента находятся в крови и их действие "дополняет" работу антител. Обусловленная комплементом цитотоксичность (CDC) представляет собой механизм цитолиза клеток, у которых антитело, связанное с поверхностью клетки-мишени, фиксирует комплемент, что приводит к сборке мембраноатакующего комплекса, создающего поры в мембране клетки-мишени и в конечном итоге приводящего к лизису клетки.

Для оценки показателей безопасности CM10, исследовали способность CM10 индуцировать CDC в двух линиях клеток меланомы (SKmel28 и SKmel5), экспрессирующих CEACAM1. В качестве источника белков комплемента использовали коммерческую смешанную сыворотку человека. В качестве положительного контроля анализа использовали коммерческое моноклональное антитело ритуксимаб, инкубируемое с клетками Daudi, а в качестве совпадающего по изотипу контроля для CM10 использовали коммерческий IgG1K. Линии клеток меланомы - SKMEL5 и SKMEL28 или клетки положительного контроля Daudi инкубировали с CM10 или ритуксимабом, соответственно, в течение 1 часа при комнатной температуре с последующим добавлением нормальной сыворотки человека с конечной концентрацией 50% в течение 2 дальнейших часов во влажном инкубаторе (37°C, 5% CO2). Процент лизированных клеток определяли посредством окрашивания йодидом пропидия (PI). Результаты (фиг. 14), представляющие среднее ±SE из 2 отдельных экспериментов, проводимых в двух повторениях, свидетельствуют, что CM10 не индуцирует лизис CDC в тестируемых условиях.

Эксперимент оценки эффективности in vivo

Целью этого эксперимента является тестирование прямого действия CM10 на клетки меланомы in vivo, а также оценка иммуномодулирующего действия, которое отсутствует в условиях ксенотрансплантации.

Калибровка экспериментов с ксенотрансплантацией

Линию несущих CEACAM1 клеток меланомы человека приобретали в "ATCC" (SKMel5) и использовали совпадающих по возрасту мышей NOD-SCID из "Harlan laboratories". Калибровочный анализ проводили для контроля роста опухолей и для нахождения оптимального режима для TIL. Клетки меланомы SKMel5 п/к (подкожно) инъецировали мышам SCID-NOD и объем опухоли контролировали посредством физических измерений. Когда объем опухоли достигал 100 мм3, мышей разделяли на 5 случайных групп. TIL инъецировали IT (внутрь опухоли) в двух различных концентрациях или в/в (внутривенно) в одной концентрации (20×106 одной мыши), при этом одной группе проводили только одну инъекцию, а второй группе проводили 2 инъекции TIL. После каждой инъекции TIL проводили введение hIL-2 в течение 5 суток. Калибровочный эксперимент продемонстрировал, что в/в инъекция TIL оказывает большее влияние на размер опухоли, чем введение IT. Кроме того, режим повторного введения TIL обеспечивал лучшее ингибирование роста опухоли по сравнению с одной инъекцией, как можно предсказать на основе времени полужизни T-клеток. На основе этих данных в последующих экспериментах с ксенотрансплантацией TIL вводили каждые 10 суток посредством в/в инъекций.

Иммуномодулирующая противоопухолевая активность CM10 in vivo

Несущие CEACAM1 клетки меланомы человека SKmel5 инъецировали п/к мышам SCID-NOD. Когда опухоли достигали объема приблизительно 100 мм3, мышей случайно распределяли по следующим группам обработки: a) еженедельные в/в инъекции PBS; b) еженедельные в/в инъекции 0,45 мг CM10; c) три в/в инъекции 20×106 реактивных против опухоли T-клеток человека (TIL) и еженедельные в/в инъекции PBS; d) три в/в инъекции 20×106 реактивных против опухоли T-клеток человека и еженедельные в/в инъекции 0,45 мг CM10. Объем опухолей 2-3 раза в неделю определял индивидуум, не информированный об условиях эксперимента. Результаты на фиг. 8 представляют средний объем опухоли ±SE 6-10 мышей на группу. Стрелки означают время введения (CM10 - окружность, TIL - треугольники, CM10 и TIL - незакрашенные квадраты). Как показано, при введении CM10 отдельно или TIL отдельно наблюдали умеренное ингибирование роста опухоли, но при сравнении с контрольной обработкой различия не достигали статистической значимости. Примечательно, что комбинация адоптивного переноса T-клеток человека с инъекциями CM10 демонстрировала значимый синергизм и сильно ингибировала рост ксенотрансплантата. Это наблюдение согласуется с данными in vitro, демонстрирующими потенцирующее действие CM10 на цитолиз T-клетками (фиг. 5 и 6).

Значимое ингибирование роста наблюдали в группе, обрабатываемой CM10 в присутствии TIL. Эти результаты усиливают иммуностимулирующее действие mAb к CEACAM1 в различных линиях клеток и указывают, что CM10 можно использовать в качестве многообещающего иммуномодулирующего антитела. Это наблюдение согласуется с данными in vitro, демонстрирующими стимулирующее действие CM10 на цитолиз клеток меланомы T-клетками.

Выводы

CEACAM1 известен как регулятор активации лимфоцитов. CM10 представляет собой антитело, блокирующее взаимодействия между двумя молекулами CEACAM1 (фиг. 4) и, таким образом, устраняет ингибирующие сигналы, опосредуемые CEACAM1, что приводит к большей активации цитотоксических лимфоцитов в отношении опухолевых клеток (фиг. 6 и 7). Ксенотрансплантация in vivo приводит (фиг. 8) к усилению иммуностимулирующего характера CM10 и демонстрирует значимое ингибирование роста опухолей у мышей, обработанных CM10 в присутствии TIL. Схема, представленная на фиг. 9, демонстрирует не ограниченный теорией механизм действия CM10, предотвращающий взаимодействие CEACAM1-CEACAM1, обеспечивающий активацию цитолитических сигналов клетками иммунной системы.

Пример 7: Оценка безопасности CM10 in vitro

Действие CM10 на нормальные клетки человека

Для избегания действия иммунной системы злокачественные клетки изменяют экспрессию множества молекул. Определенные данные продемонстрировали, что экспрессия CEACAM1 при злокачественной трансформации клеток меланомы возрастает. Из литературы известно, что CEACAM1 также экспрессирована на нормальных клетках, таким образом, важным является картирование возможных участков связывания CM10 в организме и определение возможности того, что связывание CM10 с нормальными клетками может приводить к какому-либо нежелательному исходу.

Перекрестная реактивность с нормальными тканями человека

В этом исследовании изучали интенсивность связывания mAb к CEACAM1 с микропанелью тканей человека, содержащих образцы нормальных тканей и злокачественной меланомы. Интенсивность связывания оценивали с использованием стандартной системы оценки патологии. Микропанель тканей (TMA), содержащую 100 образцов случаев злокачественной меланомы (первичная, метастазирование) и доброкачественных невусов анализировали на интенсивность связывания с CEACAM1 стандартным способом IHC. Каждую область опухоли ранжировали от 0 до +3. Как представлено на фиг. 10, определенную интенсивность связывания mAb к CEACAM1 наблюдали более чем в 50% образцов меланомы и в 65% образцов метастатической меланомы.

Микропанель тканей (TMA) нескольких нормальных органов человека включала 33 типа нормальных органов, где каждый тип взят у 3 здоровых людей. Возраст находился в диапазоне 2-67 лет, 43 образца получали у женщин, а 57 образцов получали у мужчин. Связывание mAb к CEACAM1 отсутствовало у следующих тканей: головной мозг, мозжечок, яичник, поджелудочная железа, паращитовидная железа, гипофиз, щитовидная железа, миндалина, костный мозг, селезенка, тимус, легкое, сердечная мышца, желудок, скелетные мышцы, кожа, периферические нервы, мезотелий и сетчатка. В некоторых органах детектировали клеточно-специфичное окрашивание, в основном на люминальной стороне эпителиальных клеток, формирующих протоки или железы полых внутренних органов, таких как: щеточная каемка тонкого кишечника; некоторые апикальные железы толстого кишечника; протоковый эпителий молочной железы; желчные канальцы печени; внутренняя поверхность почечных канальцев; некоторые железы эндометрия; люминальная часть слюнной железы. Кроме того, наблюдали определенное несильное окрашивание клеток в коре надпочечника, апикальной поверхности предстательной железы, клетках Лейдига семенника и единичные рассеянные клетки в поджелудочной железе. Клетками иммунной системы, которые были позитивны, являлись только нейтрофилы в пределах капилляров. Окрашивания лимфоцитов в тканях и лимфатических органах не выявлено. Наконец, наблюдали от слабого до умеренного окрашивание эндотелиальных клеток небольших кровеносных сосудов в отдельных участках, включая: яичник, надпочечник, почку и, иногда, поджелудочную железу, предстательную железу, гипофиз и эндометрий.

Анализ IHC продемонстрировал сильное окрашивание на CEACAM1 клеток меланомы по сравнению с отсутствием окрашивания подавляющего большинства тканей, тестируемых в тесте нормальной ткани человека. Однако наблюдали определенное селективное окрашивание с люминальной стороны эпителиальных клеток протоков или желез в полых органах. Эта клеточная сторона, как правило, менее доступна антителам, вводимым через периферическую кровь.

Количественный подсчет молекул CM10, связываемых одной клеткой

Для подсчета точного количества молекул CM10 связывающихся с каждым из типов клеток использовали набор QuantiBRITE. С использованием набора MFI (среднюю интенсивность флуоресценции) непосредственно преобразовывали в количество молекул, связываемых одной клеткой. В ATCC приобретали три типа первичных клеток человека тканей, в которых выявлено наличие связывания с CEACAM1. Клетки HUVEC, представляющие наличие окрашивания, выявляемого у эндотелиальных клеток; первичные эпителиальные клетки предстательной железы, так как апикальная поверхность предстательной железы демонстрирует наличие окрашивания, и первичные эпителиальные клетки проксимальных почечных канальцев, так как у внутренней поверхности канальцев наблюдают окрашивание. Более подробно, SkMel 5, G361, Malme 3M, NK 92MI, HUVEC, первичные клетки почки и первичные клетки предстательной железы выращивали по протоколам ATCC. CM10 конъюгировали с молекулой PE (наборы RPE LYNX Rapid Conjugation Kits Serotec) по протоколу производителя и использовали (1 мкг/мл) с набором гранул QuantiBRITE PE (BD) с определением ABC (антител, связываемых одной клеткой) посредством проточной цитометрии. Количество молекул CM10, связываемых одной клеткой, с использованием проточной цитометрии анализировали у указанных первичных клеток по сравнению с линиями клеток меланомы. Для каждой линии клеток насчитали по меньшей мере 10000 клеток.

Количественный анализ (фиг. 11, результаты представляют среднее 2-3 независимых экспериментов ±SE) продемонстрировал, что несущие CEACAM1 клетки меланомы связывают 20000-50000 молекул CM10, тогда как нормальные эндотелиальные и эпителиальные клетки (например, HUVEC, клетки почки и предстательной железы), у которых выявлена определенная экспрессия CEACAM1, связывают только до 2000 молекулы CM10. Кроме того, большие количества антител CM10 связывались c NK клетками (≈ 20000), что коррелирует с опубликованными данными, демонстрирующими высокую экспрессию на активированных лимфоцитах. Эти результаты поддерживают показатели безопасности CM10 (низкую экспрессию на первичных клетках) и его активность (результаты для NK) как участника опосредуемого активированными лимфоцитами цитолиза.

Пролиферация первичных клеток человека в присутствии CM10

Так как выявлено наличие определенного окрашивания в нормальных тканях, исследовали действие CM10 на рост первичных клеток. Выращивали клетки HUVEC и первичные клетки предстательной железы по протоколам ATCC, и проводили мониторинг пролиферации клеток с использованием стандартного анализа XTT. Никакого действия на пролиферацию клеток выявить не удалось.

Выводы

Идентифицировали профиль связывания mAb к CEACAM1 с нормальными тканями и клетками меланомы. CEACAM1 отсутствует на нормальных меланоцитах, но претерпевает неоэкспрессию и широко экспрессирован в подавляющем большинстве образцов метастатической меланомы (фиг. 10), в других нормальных органах наблюдают ограниченную экспрессию CEACAM1 в специфических клетках в нескольких тканях. Количественный анализ, где измеряли количество молекул CM10, связанных с клетками, выявил очень малые количества связанного CM10 на нормальных первичных клетках человека (фиг. 11). Эти результаты позволяют предположить, что большее количество молекулы CM10, инъецируемой пациентам, в основном направляется к злокачественным клеткам, а не к нормальным тканям, вследствие различий в экспрессии. Кроме того, CM10 не действует на клеточную пролиферацию, активность CDC и несущественно или мало воздействует на активность ADCC, что позволяет предположить, что связывание CM10 не с клетками-мишенями, может не приводить к нежелательным исходам для клеток.

Действие CM10 на иммунную систему

CM10 представляет собой иммуностимулирующее антитело, блокирующее взаимодействие между двумя молекулами CEACAM1 и в силу этого опосредующее стимуляцию лимфоцитов против злокачественных клеток. Важно проверить, что антитело не вызывает неконтролируемую стимуляцию иммунной системы, которая может вызывать тяжелые побочные эффекты. В нормальных лимфоцитах на клеточной мембране выявляют пренебрежимо низкую экспрессию CEACAM1, только после активации клеток CEACAM1 перемещается к мембране, где у активированных лимфоцитов быстро и сильно повышается ее экспрессия (Gray-Owen and Blumberg 2006, Nat. Rev. Immunol. 6, 433-46). Как показано выше, перекрестной реактивности с нормальными лимфатическими тканями (селезенка, тимус, костный мозг) или с лимфоцитами не наблюдали; однако для помощи в предсказании возможных побочных эффектов проводили различные анализы иммунотоксичности in vitro и ex vivo.

Действие CM10 на пролиферацию лимфоцитов человека

Одним из наиболее общих и приемлемых путей оценить безопасность иммуномодулирующих антител in vitro является анализ их действия на пролиферацию и секрецию цитокинов у нормальных PBMC (мононуклеарные клетки периферической крови) человека. Выделяли PBMC человека 3 неродственных доноров и инкубировали с CM10 с использованием 3 различных концентраций (2 мкг/мл, 20 мкг/мл или 200 мкг/мл) или c контрольным mAb IgG1K (200 мкг/мл) в течение 60 минут и в восьми повторяющихся лунках. В 4 повторных анализируемых лунки добавляли PHA (1 мкг/мл) и клетки инкубировали в течение 96 часов. Для анализа клеточной пролиферации использовали включение 3H-тимидина. В качестве отрицательного и положительного контролей анализа использовали клетки с проведенной имитацией стимуляции и клетки, стимулированные только PHA, соответственно. Пролиферацию оценивали у покоящихся лимфоцитов, а также у активированных лимфоцитов (обработанных PHA). В качестве отрицательного и положительного контролей анализа использовали клетки с проведенной имитацией стимуляции и клетки, стимулированные только PHA, соответственно. Результаты (фиг. 12) отчетливо демонстрируют, что CM10 не действует на пролиферацию наивных или активированных лимфоцитов человека. В дополнение к исследованию пролиферации PBMC оценивают действие CM10 на секрецию цитокинов PBMC человека. Исследования секреции цитокинов определяют иммуномодулирующее действие CM10 и помогают в предсказании возможных побочных эффектов.

Пример 8. Панель селективности CM10

Характеристику профиля связывания проводили с использованием линий клеток, сверхэкспрессирующих различные белки семейства CEACAM, и анализ проточной цитометрии.

У людей семейство CEA кодируют 18 генов и 11 псевдогенов на хромосоме 19q13.2. К семейству CEACAM принадлежит несколько близкородственных представителей (CEACAM1, 3, 4, 5, 6, 7, 8), и они дифференциально экспрессированы различными типами клеток человека. Белки CEACAM вовлечены в различные опосредуемые адгезией эффекты, которые регулируют рост и дифференцировку нормальных и злокачественных клеток (Gray-Owen and Blumberg 2006, Nat. Rev. Immunol. 6, 433-46). Близкородственные белки в семействе обладают высоким сходством аминокислот, которое варьирует от 45% до 90% между различными представителями.

Использовали стандартный протокол FACS с CM10, конъюгированным с молекулой биотина, и APC со стрептавидином в качестве вторичных посредников. Клетки 721.221, экспрессирующие CEACAM1, 5, 6, 8, или HEK 293 T, транзиторно экспрессирующие CEACAM 3, 4, окрашивали биотинилированным CM10 (1 мкг/мл) и APC со стрептавидином в качестве вторичных посредников. Незакрашенные гистограммы представляют окрашивание mAb, тогда как закрашенные красным гистограммы представляют фоновое окрашивание. Для анализа связывания CM10 для каждой гистограммы использовали по меньшей мере 10000 клеток. FAB рассчитывали, деля MFI окрашенных клеток клетки на MFI фонового окрашивания. Результаты, представленные на фиг. 13, отчетливо указывают на то, что CM10 сильно связывается с клетками, экспрессирующими CEACAM1. У клеток, экспрессирующих CEACAM3 и 5, наблюдали умеренное окрашивание. В клетках, экспрессирующих CEACAM 4, 6, 8, наблюдали слабое или пренебрежимо малое связывание.

Выводы

CM10 представляет собой mAb, сконструированное для распознавания CEACAM1 человека, белка, для которого выявлено, что он ассоциирован со злокачественными опухолями вообще, и с меланомой в частности. Сверхэкспрессия CEACAM1 идентифицирована в нескольких злокачественных новообразованиях, среди которых находятся меланома, NSCLC, рак щитовидной железы и рак желудка. Данные свидетельствуют, что сверхэкспрессия CEACAM1 может коррелировать с неблагоприятным прогнозом у пациентов с меланомой и NSCLC. Выявлено, что CEACAM5 сверхэкспрессирована в большом проценте многих опухолей человека, включая 90% рака желудочно-кишечного тракта, колоректального рака (CRC) и рака поджелудочной железы, 70% клеток немелкоклеточного рака легких и 50% случаев рака молочной железы. Она также сверхэкспрессирована при раке щитовидной железы, желудка, яичника и матки (Thompson, Grunert et al. 1991, J. Clin. Lab. Anal. 5, 344-66). CEACAM5 даже служит в качестве клинического маркера метастазирования печени в CRC и при постхирургических наблюдениях рака толстого кишечника (Duffy 2001, Clin. Chem. 47, 624-30). Доказательства того, что CM10 способен связывать CEACAM5 являются очень важными и могут расширить возможные показания, которые можно лечить посредством CM10 с 4-5 типов злокачественных новообразований до более 10. Средства против CEACAM5, для которых начали клинические испытания, включают антитела к CEACAM5, конъюгированные с токсическими веществами, такими как радиоактивные вещества для диагностических целей и для лечения различных злокачественных новообразований. По-видимому, даже эти токсичные конъюгированные формы не демонстрируют проблем с безопасностью, что может указывать на то, что CEACAM5 является безопасной мишенью (Liersch, et al. 2005, J. Clin. Oncol. 23(27), 6763-70; Ychou, et al. 2008, Clin. Cancer. Res. 14(11), 3487-93). С другой стороны, ни одно из этих средств не затрагивает иммунологическую регуляцию опухолей, на которую можно воздействовать антителом, которое может связывать и CEACAM1, и CEACAM5, таким как CM10.

Пример 9: Картирование эпитопов CM10

Для реконструкции прерывистых эпитопов молекулы-мишени, синтезировали библиотеку структурированных пептидов. Молекула-мишень представляла собой молекулу N-домена CEACAM1 человека с последовательностью:

1 QLTTESMPFN VAEGKEVLLL VHNLPQQLFG YSWYKGERVD GNRQIVGYAI50

51 GTQQATPGPA NSGRETIYPN ASLLIQNVTQ NDTGFYTLQV IKSDLVNEEA100

101 TGQFHVYP108 (SEQ ID NO:35).

Библиотеку синтезировали с использованием технологии Pepscan химически связанных на каркасах пептидов (CLIPS), которая обеспечивает структурирование пептидов в одиночные петли, двойные петли, тройные петли, слоевидные укладки, спиралевидные укладки и их сочетания (Timmerman et al. 2007, J. Mol. Recognit. 20:283-99 и Slootstra et al. 1996, Molecular Diversity 1: 87-96). Матрицы CLIPS связывают с остатками цистеина. Боковые цепи нескольких цистеинов в пептидах связывают с одной или двумя матрицами CLIPS. Например, 0,5 мМ раствор матрицы T2 CLIPS 1,3-бис(бромметил)бензола растворяют в бикарбонате аммония (20 мМ, pH 7,9)/ацетонитрил (1:1 (об./об.)). Этот раствор добавляют в панели пептидов. Матрица CLIPS связывается с боковыми цепями двух остатков цистеина, присутствующих в пептидах, связанных с твердой фазой панели пептидов (455-луночный планшет с 3 мкл лунками). Панели пептидов аккуратно прополаскивают в растворе в течение от 30 до 60 минут при полном погружении в раствор. В заключение панели пептидов тщательно отмывают избытком H2O и обрабатывают ультразвуком в разрушающем буфере, содержащем 1% SDS/0,1% бета-меркаптоэтанол в PBS (pH 7,2) при 70°C в течение 30 минут с последующей обработкой ультразвуком в H2O в течение дополнительных 45 минут. Несущие T3 CLIPS пептиды получали сходным способом, но с тремя остатками цистеина.

Пептиды синтезировали в общем количестве 3002 пептидов, которое включало: набор матриц CLIPS, комбинирующих две различных области целого белка, где природные остатки цистеина замещены остатками аланина; наборы линейных пептидов длиной 6, 10, 15, 20, 25 и 33 остатков; наборы линейных пептидов длиной 15 остатков, где средний остаток замещали аланином; набор конформационных петель CLIPS длиной 15 остатков, где природные остатки цистеина замещали остатками аланина; и набор конформационных петель CLIPS длиной 15 остатков с заменой центрального остатка на аланин, где природные остатки цистеина замещали на остатки аланина.

Связывание антитела с каждым из синтезированных пептидов тестировали в основанном на PEPSCAN ELISA. Панели пептидов инкубировали с раствором первичного антитела (CM10) (в течение ночи при 4°C). После отмывки панели пептидов инкубировали с разведением 1/1000 конъюгата антитела с пероксидазой в течение одного часа при 25°C. После отмывки добавляли субстрат пероксидазы 2,2'-азино-ди-3-этилбензтиазолинфосфат (ABTS) и 2 микролитра/миллилитр 3 процентной H2O2. Через один час измеряли развитие окрашивания. Развитие окрашивания количественно определяли посредством устройства с зарядовой связью (CCD), камеры, и системы обработки изображений.

Значения, полученные с CCD-камеры, находились в диапазоне от 0 до 3000 мОЕ, сходно со стандартным сканером 96-луночных планшетов ELISA. Полученные данные определяют количественно и хранят в базе данных Peplab. Значения связывания получают из результатов анализа с использованием графического представления данных, где значения, взятые за переменные на двухмерной карте, представлены в виде цветов.

На основе наблюдаемых профилей связывания основная часть эпитопа CM10.S91 состоит из остатков 17VLLLVHNLPQQLF29. На последовательности наблюдали вторичную область связывания в последовательности вокруг 68YPNASLLIQNVT79. Когда наблюдаемые профили связывания сравнивают с доступной кристаллической структурой белка-мишени, полагают, что прерывистый эпитоп CM10.S91 состоит из 17VLLLVHNLPQQLF29 (основная часть) совместно с 68PNASLLI75 (дополнение).

Пример 10: Дополнительные эксперименты для оценки активности CM10

Секреция гранзима B эффекторными клетками в качестве потенциального PD маркера

Разработка надежных фармакодинамических (PD) маркеров является критичной для улучшения успешной проверки лекарственных средств в клинических испытаниях и помогает в выборе оптимальной дозы лекарственного средства с балансом эффективности и токсичности. PD маркеры часто находятся вблизи молекулярного пути к мишени лекарственного средства, и их используют для измерения эффекта лекарственного средства вне зависимости от терапевтического эффекта. Гранзим B представляет собой сериновую протеазу, которая высвобождается из цитоплазматических гранул цитотоксических T-клеток (CTL) и NK клеток после распознавания специфических мишеней. Это в свою очередь опосредует апоптоз клеток-мишеней. Авторы стремились определить, усиливает ли CM10 секрецию гранзима B эффекторными NK и T-клетками в присутствии специфических клеток-мишеней, таким образом, обеспечивая наблюдаемый усиленный цитолиз клеток-мишеней посредством антитела.

TIL инкубировали с CM10 (0,2 мкг/мл, 1 мкг/мл, 5 мкг/мл или 10 мкг/мл) или с совпадающим по изотипу контрольным Ab (IPI - ипилимумаб 10 мкг/мл) в течение 30 минут при 37°C; в течение ночной инкубации добавляли несущие мишень клетки меланомы, экспрессирующие CEACAM1 и HLA-A2 - SKMEL5, при соотношении эффектора к мишени 2,5:1. Секрецию гранзима B определяли посредством ELISA. Результаты представляют среднее ±SE значений высвобождения гранзима B из 6 повторений на обработку. В другом независимом эксперименте наблюдали сходные результаты.

Представленные на фиг. 15 TIL секретируют низкие исходные уровни гранзима B, которые в присутствии только CM10 остаются низкими. Только когда к TIL добавляли клетки-мишени, уровень гранзима B существенно возрастал. При этом CM10 мог значимо увеличивать секрецию гранзима B выше наибольших исходных уровней. Сходные результаты наблюдали, когда в качестве эффекторных клеток использовали клетки NK92MI, что демонстрирует, что CM10 может усиливать секрецию гранзима B из NK клеток сходным образом. Использование гранзима B в качестве PD маркера для лечения CM10 также исследовали в дополнительной группе экспериментов, включающих модели in vivo и образцы, полученные у пациентов.

CM10 блокирует взаимодействия CEACAM1-CEACAM5

Выявлено, что раково-эмбриональный антиген (CEA, CEACAM5 и CD66e) ассоциирован с различными типами злокачественных опухолей, в частности, с колоректальной карциномой, а также раком желудочно-кишечного тракта, раком поджелудочной железы, немелкоклеточным раком легких, раком молочной железы, раком щитовидной железы, желудка и яичника. Проведена разработка, чтобы сделать эту молекулу мишенью для диагностики и лечения злокачественной опухоли.

Гомофильные взаимодействия CEACAM1 между линиями клеток меланомы с дефицитом MHC-I и NK клетками значимо ингибировали цитолиз злокачественных клеток NK клетками (Markel et al J. Immunol. 2002;168:2803-2810). Подобным образом, принудительная экспрессия CEACAM5 в клетках с дефектным HLA I класса 721.221 также подавляла опосредуемую NK клетками цитотоксичность (Stern et al J. Immunol. 2005;174:6692-6701), что указывает на то, что гетерофильные взаимодействия CEACAM5-CEACAM1 также способны инициировать передачу ингибирующего сигнала CEACAM1 в иммунные клетки.

Несущую CEACAM1 линию клеток (SKMel 5) инкубировали с изотипическим контролем или CM10 в различных концентрациях, несвязанный CM10 дважды отмывали, с последующей инкубацией с растворимой биотинилированной CEACAM5 или без нее. Связывание биотинилированной CEACAM5 c клетками детектировали посредством вторичных APC со стрептавидином и анализа FACS. Результаты представляют среднее из дублированных лунок ±SE. В двух других независимых экспериментах получали сходные результаты.

Результаты на фиг. 16 демонстрируют, что CM10 ингибирует связывание CEACAM1 с CEACAM5 зависимым от дозы способом. Таким образом, CM10 можно использовать для лечения злокачественных новообразований, экспрессирующих высокие уровни CEACAM5 и использовать линию CEACAM1-CEACAM5 для подавления иммуноцитов.

CM10 усиливает рестриктированный по HLA цитолиз T-клетками

Цитотоксические T-клетки разрушают инфицированные вирусами клетки и опухолевые клетки, а также участвуют в отторжении трансплантата. Эти клетки распознают свои мишени, связываясь с антигенами, ассоциированными с молекулами HLA, которые присутствуют на поверхности почти каждой клетки организма. Цитолиз инфицированных или злокачественных клеток для получения надлежащего ответа требует привлечения нескольких путей.

В этой группе анализов стремились определить, усиливает ли CM10 "природную" активность CTL, которая рестриктирована по HLA, или, альтернативно, вызывает общую стимуляцию иммунной системы.

TIL инкубировали с CM10 (0,2 мкг/мл, 1 мкг/мл, 5 мкг/мл или 10 мкг/мл) или совпадающим по изотипу контрольным антителом в течение 30 минут при 37°C. Клетки-мишени меланомы SKMEL5, экспрессирующие CEACAM1 и HLA-A2, предварительно инкубировали с блокирующим HLA-A2 моноклональным антителом или без него в течение 1 часа и добавляли в течение ночной инкубации с соотношением эффектора к мишени 2,5:1. Цитолиз определяли стандартным анализом высвобождения LDH. Результаты представляют среднее ±SE значений высвобождения LDH из 3 повторов на обработку.

Результаты на фиг. 17 демонстрируют, что в присутствии блокирующих HLA-A2 антител CM10 не мог усиливать цитолиз клеток меланомы TIL, и что активность CM10 рестриктирована по HLA. Сходные результаты наблюдали в другом независимом эксперименте. Таким образом предположили, что в соответствии с этими результатами CM10 увеличивает активность CTL против злокачественных клеток in vivo и не содействует неспецифической активации иммунной системы.

Иммуномодулирующая активность CM10 ингибирует рост опухолей in vivo

Одной из наиболее широко используемых моделей для оценки действия новых противоопухолевых средств in vivo является модель с ксенотрансплантацией опухоли человека. В этой модели, опухолевые клетки человека трансплантируют под кожу мышам с иммунной недостаточностью, которые не отторгают клетки человека. В зависимости от количества инъецированных клеток и скорости роста клеток, опухоль развивается в течение нескольких недель и ответ на соответствующую схему лечения можно исследовать in vivo. Преимуществом модели, включающей лечение на ранних стадиях формирования опухоли, является возможность исследовать влияние средства в условиях, которые могут являться более сходными с метастазированием у пациентов и определить действие лечения на имплантацию исходной опухоли.

Таким образом, иммуномодулирующую активность CM10 in vivo в схеме профилактического лечения исследовали у мышей SCID-NOD, которым трансплантировали клетки меланомы человека. Мышей SCID-NOD случайным образом распределяли по пяти группам обработки, указанным на фиг. 18. На сутки 0 подкожно инъецировали 6×106 клеток SKmel5 (линия клеток меланомы). Мышей обрабатывали антителами/TIL, как указано на фигуре. Стрелки указывают время введения; тонкие стрелки представляют антитела - 0,25 мг/мышь/инъекцию (CM10, контрольное IgG и контроль ипилимумаб), а широкие стрелки - TIL (20×106 клеток одной мыши за одну инъекцию). Объем опухолей измеряли вслепую 2-3 раза в неделю. Результаты представляют средние объемы опухолей ±SE из 8-9 мышей на группу.

На фиг. 18 показано, что комбинация адоптивного переноса T-клеток человека с инъекциями CM10 демонстрировала значимую синергию и сильно ингибировала рост ксенотрансплантата по сравнению с группой изотипического контроля (69% TGI). Результаты демонстрируют, что CM10 также действовал в качестве единственного средства (45% TGI на сутки 32) и вероятно действует непосредственно на опухолевые клетки или окружение опухоли, ингибируя пролиферацию, ангиогенез или другими биологическими путями.

В сходной группе экспериментов определяли общую массу опухоли на сутки завершения эксперимента. Полученные результаты, подтверждают измерения объема и демонстрируют значительное снижение опухолевой массы в обработанной TIL+CM10 группе, а также статистически значимое снижение массы опухоли в обработанной CM10 группе.

CM10 усиливает иммуномодулирующую цитолитическую активность NK клеток в отношении несущих CEACAM1 линий клеток рака поджелудочной железы

Предварительный скрининг продемонстрировал, что линии и полученные у пациентов образцы клеток рака поджелудочной железы экспрессируют высокие уровни CEACAM1 (94% образцов рака поджелудочной железы несли CEACAM1). Таким образом, проводили эксперимент для исследования того, увеличивает ли CM10 активность иммунных клеток в отношении линий клеток рака поджелудочной железы. Анализы цитолиза проводили посредством совместного культивирования клеток NK92MI, которые предварительно инкубировали с различными концентрациями CM10, с различными несущими CEACAM1 линиями клеток-мишеней рака поджелудочной железы. NK92MI инкубировали с CM10 (0,2 мкг/мл, 1 мкг/мл или 10 мкг/мл) или совпадающим по изотипу контрольным Ab (10 мкг/мл) в течение 30 минут при 37°C; A. Добавляли клетки-мишени, экспрессирующие CEACAM1, в течение последующих 5 часов при отношении эффектора и мишени 2,5:1 (COLO-357) или в течение ночи при отношении эффектора и мишени 5:1 (BXPC3). Результаты представляют средний % цитотоксичности ±SE, как определяют посредством классического анализа высвобождения LDH из трижды повторенных лунок на обработку.

Результаты, представленные на фиг. 19, демонстрируют, что хотя цитолиз клеток рака поджелудочной железы NK клетками был относительно низким, CM10 усиливал эту активность вплоть до уровня, в 2 раза большего исходного уровня цитотоксичности (PBS или контрольное Ab). У дополнительных двух линий наблюдали сходные результаты.

CM10 усиливает секрецию гранзима B NK клетками в присутствии несущих CEACAM1 линий клеток рака поджелудочной железы

Эксперимент планировали для определения того, может ли CM10 сходно с клетками меланомы усиливать секрецию гранзима B из NK клеток в присутствии клеток рака поджелудочной железы. В сходных с анализом цитолиза условиях NK клетки предварительно обрабатывали различными концентрациями CM10, а затем совместно культивировали с четырьмя различными линиями клеток-мишеней рака поджелудочной железы. Супернатанты анализировали на содержание гранзима B посредством специфичного ELISA. NK92MI инкубировали с CM10 (0,2 мкг/мл, 1 мкг/мл или 10 мкг/мл) или совпадающим по изотипу контрольным антителом (10 мкг/мл) в течение 30 минут при 37°C. В течение последующих 5 часов добавляли клетки-мишени поджелудочной железы, экспрессирующие CEACAM1, A. (COLO-357 и ASPC-1) и B. (SU8686) при отношении эффектора и мишени 2,5:1 или C. (BXPC3) при отношении E:T 10:1. Секрецию гранзима B измеряли посредством ELISA. Результаты представляют среднее ±SE значений высвобождения гранзима B из 2-6 повторений на обработку.

На фиг. 20 отчетливо показано, что CM10 увеличивает секрецию гранзима B из NK клеток в присутствии клеток рака поджелудочной железы.

Пример 11: Гуманизированные антитела и антитела человека

Как правило, гуманизированное антитело содержит каркас человека с привитыми CDR, не принадлежащими человеку. Таким образом, гуманизированное антитело содержит одну или несколько аминокислотных последовательностей, вводимых в него из источника, который не принадлежит человеку. Часто эти не принадлежащие человеку аминокислотные остатки обозначают как "импортируемые" остатки, которые, как правило, берут из "импортируемого" вариабельного домена. Гуманизирование по существу можно проводить способом Winter с коллегами (Jones et al., Nature, 321:522-525, 1986; Riechmann et al., Nature, 332:323-327, 1988; Verhoeyen et al., Science, 239:1534-1536, 1988) замещая на CDR грызунов или последовательности CDR соответствующие последовательности антитела человека. Таким образом, такие "гуманизированные" антитела представляют собой химерные антитела (патент США № 4816567), где соответствующей последовательностью не являющегося человеком вида замещено значительно меньше интактного вариабельного домена человека. На практике гуманизированные антитела, как правило, представляют собой антитела человека, в которых некоторые остатки CDR и возможно некоторые остатки FR замещены остатками из аналогичных участков антител грызунов.

Выбор вариабельных доменов человека, легких и тяжелых цепей, для использования в получении гуманизированных антител является очень важным для снижения антигенности. В соответствии с так называемым способом "наилучшего соответствия" последовательность вариабельного домена антитела грызуна подвергают скринингу в отношении полной библиотеки известных последовательностей вариабельных доменов человека. Затем последовательность человека, наиболее близкую последовательности грызуна принимают в качестве каркаса человека (FR) для гуманизированного антитела (Sims et al., J. Immunol., 151:2296, 1993; Chothia et al., J. Mol. Biol., 196:901, 1987). В другом способе используют конкретный каркас, получаемый из консенсусной последовательности всех антител человека конкретной подгруппы легких или тяжелых цепей. Один и тот же каркас можно использовать для нескольких различных гуманизированных антител (Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285, 1992; Presta et al., J. Immunol., 151:2623, 1993).

Кроме того, важно, чтобы антитела гуманизировали с сохранением высокой аффинности к антигену и других благоприятных биологических свойств. Для достижения этой цели в соответствии с предпочтительным способом гуманизированные антитела получают способом анализа исходных последовательностей и различных умозрительных гуманизированных продуктов с использованием трехмерных моделей исходных и гуманизированных последовательностей. Трехмерные модели иммуноглобулинов являются общедоступными и хорошо известны специалистам в данной области. Доступны компьютерные программы, которые иллюстрируют и представляют возможные трехмерные конформационные структуры выбранных последовательностей иммуноглобулинов-кандидатов. Исследование этих изображений позволяет анализировать возможную роль остатков в функционировании последовательности иммуноглобулина-кандидата, т.е., анализ остатков, которые влияют на способность иммуноглобулин-кандидатов связываться со своим антигеном. Таким образом, можно выбирать и комбинировать остатки FR из реципиентных и важных последовательностей так, что достигаются желаемые характеристики антитела, такие как увеличенная аффинность к антигену(ам)-мишени. В основном во влияние на связывание антигена непосредственно и наиболее значительно вовлечены остатки CDR.

Альтернативно, в настоящее время возможно получать трансгенных животных (например, мышей), способных после иммунизации к продукции всего репертуара антител человека в отсутствие продукции эндогенных иммуноглобулинов. Например, описано, что гомозиготная делеция гена области соединения (JH) тяжелой цепи антитела у химерных и мутантных по зародышевой линии мышей приводит к полному ингибированию эндогенной продукции антител. Перенос таким мутантным по зародышевой линии мышам набора генов иммуноглобулинов зародышевой линии человека при стимуляции антигеном приводит к продукции антител человека (например, Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551, 1993; Jakobovits et al., Nature, 362:255-258, 1993; Bruggermann et al., Year in Immuno., 7:33, 1993; и Duchosal et al. Nature 355:258, 1992). Антитела человека также можно получать из библиотеки фагового дисплея (Hoogenboom et al., J. Mol. Biol., 227:381, 1991; Marks et al., J. Mol. Biol., 222:581-597, 1991; Vaughan et al. Nature Biotech 14:309, 1996).

Пример 12. Фрагменты антител

Разработаны различные способы получения фрагментов антител. Как правило, эти фрагменты получают посредством протеолитического расщепления интактных антител (например, Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117, 1992 и Brennan et al., Science, 229:81, 1985). Однако эти фрагменты в настоящее время можно получать непосредственно из рекомбинантных клеток-хозяев. Например, фрагменты антител можно выделять из фаговой библиотеки антител, описываемой выше. Альтернативно, можно непосредственно восстанавливать фрагменты Fab'-SH из E. coli и химически связывать с формированием фрагментов F(ab')2 (Carter et al., Bio/Technology 10:163-167, 1992). В соответствии с другим подходом фрагменты F(ab')2 можно выделять непосредственно из культуры рекомбинантных клеток-хозяев. Практикующим специалистам очевидны другие способы получения фрагментов антител. В других вариантах осуществления антителом выбора является одноцепочечный фрагмент Fv (scFv).

Пример 13. Активность антитела к CEACAM против вирусных инфекций

Для определения активности CM10 против вирусной инфекции используют описанные ниже эксперименты. Эксперименты включают различные клетки-мишени, различные вирусы и различные модели in vivo и in vitro.

Детекция/диагностика: Исследование уровня экспрессии CEACAM в линиях клеток и первичных клеток, инфицированных различными типами вирусов посредством анализа FACS, ОТ-ПЦР и иммуногистохимии.

Профилактика: предварительная инкубация клеток-мишеней с антителом к CEACAM и определение вирусной нагрузки или репликации вирусов после инфекции вирусом.

Лечение: после инфекции вирусом инфицированные клетки инкубируют с клетками иммунной системы и исследуют способность эффекторных клеток к цитолизу и вирусную нагрузку. Кроме того, определяют вирусную нагрузку и репликацию и общую продолжительность жизни in vivo после инфекции вирусом и лечения антителами к CEACAM.

Таким образом, приведенное выше описание конкретных вариантов осуществления полностью раскрывает общий характер изобретения так, что другие специалисты с использованием современного уровня знаний легко могут модифицировать и/или адаптировать эти конкретные варианты осуществления для различных применений без излишнего экспериментирования и без отклонения от основного направления, и, таким образом, следует и надлежит понимать, что такие адаптации и модификации входят в определение и диапазон эквивалентов описанных вариантов осуществления. Следует понимать, что язык или терминология, используемые в настоящем документе, используются с целью описания, а не ограничения. Средства, материалы и стадии проведения различных описанных способов осуществления могут принимать множество альтернативных форм без отклонения от изобретения.

1. Моноклональное антитело, которое специфично связывается с CEACAM1 человека, содержащее вариабельный домен тяжелой цепи с последовательностью, указанной в SEQ ID NO: 26 и вариабельный домен легкой цепи с последовательностью, указанной в SEQ ID NO: 28, или фрагмент этого антитела, содержащий по меньшей мере антигенсвязывающую часть, которая специфично связывается с CEACAM1 человека.

2. Моноклональное антитело или его фрагмент по п. 1, содержащие тяжелую цепь с последовательностью, указанной в SEQ ID NO: 30, и легкую цепь с последовательностью, указанной в SEQ ID NO: 31.

3. Выделенный полинуклеотид, кодирующий моноклональное антитело или фрагмент антитела по п. 1 или 2.

4. Выделенный полинуклеотид по п. 3, содержащий последовательности ДНК, указанные в SEQ ID NO: 25 или SEQ ID NO: 27, или их аналоги с идентичностью последовательности по меньшей мере 90% с указанными последовательностями.

5. Плазмида для продукции моноклонального антитела по п.1, содержащая по меньшей мере одну выделенную полинуклеотидную последовательность полинуклеотида по п. 4.

6. Плазмида по п. 5, включающая вектор pFusion-DHFR, депонированный 28 сентября 2011 года под номером доступа ATCC PTA-12130.

7. Фармацевтическая композиция для лечения злокачественного новообразования, характеризующегося сверхэкспрессией CEACAM1, содержащая терапевтически эффективное количество моноклонального антитела или фрагмента по любому из пп. 1-2; и фармацевтически приемлемый носитель.

8. Диагностическая композиция для детекции CEACAM1 человека у индивидуума, содержащая по меньшей мере одно моноклональное антитело или фрагмент антитела по любому из пп. 1-2; и носитель или эксципиент.

9. Способ профилактики или лечения заболевания или нарушения, связанного с экспрессией, активацией или функцией CEACAM1 человека, включающий введение нуждающемуся в этом индивидууму фармацевтической композиции по п. 7.

10. Способ по п. 9, где выделенное антитело или фрагмент антитела, содержащиеся в фармацевтической композиции, являются связанными с цитотоксической молекулой, и заболевание представляет собой злокачественную опухоль.

11. Способ по п. 9, дополнительно включающий введение индивидууму экспрессирующих CEACAM1 лимфоцитов.

12. Способ по п. 11, где лимфоциты содержат T-клетки, NK-клетки или проникающие в опухоль лимфоциты.

13. Способ иммуностимуляции, где способ включает приведение экспрессирующих CEACAM1 лимфоцитов в контакт с антителом или фрагментом антитела по любому из пп. 1-2.

14. Способ ингибирования взаимодействия CEACAM1 человека с CEACAM1, где способ включает приведение экспрессирующих CEACAM1 лимфоцитов в контакт с антителом или фрагментом антитела по любому из пп. 1-2, таким образом, ингибируя взаимодействие CEACAM1 с CEACAM1.

15. Способ диагностики злокачественной опухоли, экспрессирующей CEACAM1, у нуждающегося в этом индивидуума, где способ включает приведение биологического образца, полученного у индивидуума, в контакт с композицией, содержащей моноклональное антитело или его фрагмент по любому из пп. 1-2, где сверхэкспрессия CEACAM1 по сравнению с незатронутыми клетками является показателем злокачественной опухоли у индивидуума.

16. Способ диагностики злокачественной опухоли, экспрессирующей CEACAM1, у нуждающегося в этом индивидуума, включающий этапы:

(i) инкубации биологического образца с моноклональным антителом или фрагментом антитела по любому из пп. 1-2;

(ii) детекции количества CEACAM1, связанного с моноклональным антителом или фрагментом антитела;

(iii) сравнения количества (ii) со стандартной кривой, полученной на основе эталонных образцов, содержащих известные количества CEACAM1;

(iv) расчета количества CEACAM1 в биологическом образце на основе стандартной кривой; и

(v) сравнения количества (iv) с нормальным количеством CEACAM1,

где сверхэкспрессия CEACAM1 по сравнению с незатронутыми клетками является показателем злокачественной опухоли у индивидуума.



 

Похожие патенты:

Группа изобретений относится к биотехнологии и медицине. Предложены композиция, набор и способ для обнаружения присутствия биопленки в жизнеспособных тканях.

Настоящая группа объектов изобретения относится к области иммунологии. Предложено антитело, которое специфически связывает B7-H7CR человека, и его антигенсвязывающий фрагмент.
Изобретение относится к области медицины, а именно к пульмонологии и неонатологии, и может быть использовано для раннего прогнозирования бронхолегочной дисплазии (БЛД) тяжелой степени у недоношенных детей, родившихся с экстремально низкой массой тела (ЭНМТ).
Изобретение относится к области медицины, а именно к акушерству, и может быть использовано для выбора акушерской тактики у беременных с сахарным диабетом. Для этого в сыворотке крови беременной в 37-38 недель гестации определяют уровень ИЛ-1β и окситоцина.

Изобретение относится к области медицины, а именно к кардиологии, и касается способа прогнозирования исхода острой ишемии миокарда. Способ включает определение в плазме крови уровня свободно циркулирующей митохондриальной ДНК (мтДНК) крови методом полимеразной цепной реакции в реальном времени с амплифицированием фрагмента гена 16S рРНК прямым и обратным праймерами.
Изобретение относится к области медицины, а именно к акушерству, и найдет применение для прогнозирования у беременных женщин нарушений вегетативной регуляции в послеродовом периоде.
Изобретение относится к области медицины, а именно к акушерству, и найдет применение для прогнозирования у беременных женщин нарушений вегетативной регуляции в послеродовом периоде.

Изобретение относится к медицине, а именно к кардиологии и может быть использовано для оценки риска формирования хронической сердечной недостаточности у молодых мужчин при артериальной гипертензии.

Изобретение относится к медицине и может быть использовано в кардиологии, ангиологии, кардиохирургии, реабилитологии, и может быть использовано в качестве способа диагностики рестенозов стентов у больных ишемической болезнью сердца (ИБС) с хронической сердечной недостаточностью (ХСН).

Изобретение относится к области ветеринарной вирусологии, в частности к способу диагностики оспы овец и коз. Способ экспресс-диагностики вируса оспы коз и овец включает отбор проб патологического материала из очага инфекционного заболевания, экстракцию ДНК бактерий инфекционного заболевания из полученных проб, идентификацию видовой принадлежности возбудителя болезни методом полимеразной цепной реакции с флуоресцентным учетом результатов в режиме реального времени с применением термоциклера типа RotorGene на основании наличия/отсутствия пересечения кривой флуоресценции с пороговой линией.

Изобретение относится к биотехнологии. Описана выделенная мультиспецифическая гетеромультимерная конструкция для индуцирования киллинга В-клетки, содержащая: первую полипептидную конструкцию, содержащую CD3-связывающую полипептидную конструкцию, которая связывается с комплексом человека CD3 по меньшей мере на одной экспрессирующей CD3 клетке, при этом первая полипептидная конструкция представляет собой scFv-область; вторую полипептидную конструкцию, содержащую антигенсвязывающую полипептидную конструкцию, которая связывается с целевым антигеном человека CD19 по меньшей мере на одной В-клетке, при этом вторая полипептидная конструкция представляет собой Fab-область или scFv-область; и гетеродимерную Fc-область IgG1 человека, содержащую вариант домена СН3 иммуноглобулина, содержащий первую СН3 последовательность и вторую СН3 последовательность, первая СН3 последовательность содержит аминокислотные замены в L351, F405 и Y407, а вторая СН3 последовательность содержит аминокислотные замены в Т366, K392 и Т394, при этом аминокислотными заменами для L в L351 являются Y, F или W, для F в F405 являются А или G и для Y в Y407 являются V, М, L или I, а аминокислотными заменами для Т в Т366 являются L, I, М или V, для K в K392 являются М, I, L или V и для Т в Т394 являются W, Y или F, при этом и первая полипептидная конструкция, и вторая полипептидная конструкция связаны с N-концом гетеродимерной Fc-области IgG1 человека.

Представленная группа изобретений касается полинуклеотида, кодирующего вариант хоминг-эндонуклеазы (ХЭ) I-OnuI, экспрессионного вектора, содержащего такой полинуклеотид, полипептида эндонуклеазы, композиции для лечения гемоглобинопатии и клетки, содержащей указанные полинуклеотид, вектор или полипетид эндонуклеазы.

Настоящее изобретение относится к иммунологии. Предложены изолированные антитела и их антигенсвязывающие фрагменты, связывающие CD30L (CD153) и охарактеризованные аминокислотными последовательностями гипервариабельных участков (CDR) и вариабельных доменов.

Изобретение относится к биохимии. Описана комбинация иммуноконъюгата, который содержит(i) первое антитело, направленное на фибробласт-активирующий белок (FAP) и включающее вариабельную область тяжелой цепи SEQ ID NO: 12 и вариабельную область легкой цепи SEQ ID NO: 11, вариабельную область тяжелой цепи SEQ ID NO: 17 и вариабельную область легкой цепи SEQ ID NO: 16, вариабельную область тяжелой цепи SEQ ID NO: 47 и вариабельную область легкой цепи SEQ ID NO: 46, вариабельную область тяжелой цепи SEQ ID NO: 63 и вариабельную область легкой цепи SEQ ID NO: 62 или вариабельную область тяжелой цепи SEQ ID NO: 67 и вариабельную область легкой цепи SEQ ID NO: 66 или направленное на карциноэмбриональный антиген (СЕА) и включающее вариабельную область тяжелой цепи SEQ ID NO: 114 и вариабельную область легкой цепи SEQ ID NO: 115, где первое антитело представляет собой полноразмерное антитело IgG-класса и включает аминокислотные замены L234A, L235A и P329G (EU-нумерация, представленная у Кэбота) в тяжелых цепях иммуноглобулина, и(ii) молекулу мутантного человеческого IL-2, содержащую аминокислотные замены F42A, Y45A и L72G,и второго антитела, выбранного из группы(i) антитела IgG-класса, направленного на рецептор эпидермального фактора роста (EGFR), содержащего вариабельный домен тяжелой цепи SEQ ID NO: 102 и вариабельный домен легкой цепи SEQ ID NO: 103, где антитело сконструировано таким образом, чтобы оно имело повышенное соотношение нефуколизированных олигосахаридов в Fc-области по сравнению с несконструированным антителом,(ii) антитела IgG-класса к HER3, содержащего вариабельный домен тяжелой цепи SEQ ID NO: 142 и вариабельный домен легкой цепи SEQ ID NO: 146, где антитело сконструировано таким образом, чтобы оно имело повышенное соотношение нефуколизированных олигосахаридов в Fc-области по сравнению с несконструированным антителом, и(iii) цетуксимаба,для применения при лечении рака у нуждающегося в этом индивидуума.

Изобретение относится к области биотехнологии, конкретно к получению вариантов альбумина, что может быть использовано в медицине. Получают полипептиды, характеризующиеся по меньшей мере 90% идентичностью с исходным человеческим альбумином, а также их конъюгаты, слитые с ними белки, ассоциаты, наночастицы и фармацевтические композиции.

Настоящее изобретение относится к иммунологии. Предложен способ получения биспецифической антигенсвязывающей молекулы, включающей Fc домен и Fab фрагменты, специфично связывающиеся с первым и вторым антигенами, причем биспецифическая антигенсвязывающая молекула обеспечивает моновалентное связывание с первым и/или вторым антигенами.

Изобретение относится к области биотехнологии, в частности к способу очистки рекомбинантного белка - аналога интерферона альфа-17, представленного последовательностью SEQ ID NO: 1.

Изобретение относится к биохимии. Описано антитело, которое специфично связывается с IL-6, где это антитело включает аминокислотные последовательности SEQ ID NO: 9 и SEQ ID NO: 10.

Изобретение относится к области фармацевтической технологии и относится к ацетату KIFGSLAFL в форме твердого аморфного вещества, способу его получения и фармацевтическому препарату пептидной вакцины, содержащему указанный ацетат.

Настоящее изобретение относится к области биотехнологии и фармацевтики, в частности к конъюгатам антитела для лечения ревматоидного артрита у пациента. Антитело, входящее в состав указанных конъюгатов, специфически связывает Экстра-Домен-A (ED-A) фибронектина и конъюгировано с интерлейкином-10.

Изобретение относится к биотехнологии. Описана выделенная мультиспецифическая гетеромультимерная конструкция для индуцирования киллинга В-клетки, содержащая: первую полипептидную конструкцию, содержащую CD3-связывающую полипептидную конструкцию, которая связывается с комплексом человека CD3 по меньшей мере на одной экспрессирующей CD3 клетке, при этом первая полипептидная конструкция представляет собой scFv-область; вторую полипептидную конструкцию, содержащую антигенсвязывающую полипептидную конструкцию, которая связывается с целевым антигеном человека CD19 по меньшей мере на одной В-клетке, при этом вторая полипептидная конструкция представляет собой Fab-область или scFv-область; и гетеродимерную Fc-область IgG1 человека, содержащую вариант домена СН3 иммуноглобулина, содержащий первую СН3 последовательность и вторую СН3 последовательность, первая СН3 последовательность содержит аминокислотные замены в L351, F405 и Y407, а вторая СН3 последовательность содержит аминокислотные замены в Т366, K392 и Т394, при этом аминокислотными заменами для L в L351 являются Y, F или W, для F в F405 являются А или G и для Y в Y407 являются V, М, L или I, а аминокислотными заменами для Т в Т366 являются L, I, М или V, для K в K392 являются М, I, L или V и для Т в Т394 являются W, Y или F, при этом и первая полипептидная конструкция, и вторая полипептидная конструкция связаны с N-концом гетеродимерной Fc-области IgG1 человека.

Настоящее изобретение относится к биотехнологии и медицине, в частности к моноклональному антителу, которое специфично связывается с CEACAM1 человека. Настоящее изобретение также раскрывает полинуклеотид, кодирующий указанное антитело, плазмиду для его продукции, фармацевтическую и диагностическую композиции для лечения злокачественного новообразования, характеризующегося сверхэкспрессией CEACAM1, и для детекции CEACAM1 человека у индивидуума соответственно. Раскрыты способ профилактики или лечения заболевания или нарушения, связанного с экспрессией, активацией или функцией CEACAM1 человека, способ иммуностимуляции, способ ингибирования взаимодействия CEACAM1 человека с CEACAM1, а также способы диагностики злокачественной опухоли, экспрессирующей CEACAM1. Настоящее изобретение позволяет повысить специфичность антител против CEACAM1 человека. 10 н. и 6 з.п. ф-лы, 20 ил., 1 табл., 13 пр.

Наверх