Анализ адромедуллина и способы определения зрелого адромедуллина

Изобретение касается способа in vitro контроля терапии у пациентов, у которых подозревают наличие сепсиса. Сущность способа: концентрацию зрелого адромедуллина (ADM) 1-52 амида и/или зрелого ADM 1-52-Gly в образце биологической жидкости указанного пациента с сепсисом определяют, используя иммунологический анализ с применением комбинации двух связующих, которые выбраны из группы, состоящей из антитела к ADM и/или фрагмента антитела к ADM, и которые связывают две различные области в пределах области зрелого ADM 1-52 амида и/или ADM 1-52-Gly, которая представляет собой аминокислотный 21-52-амид (SEQ ID No. 1) или аминокислотный 21-52-Gly (SEQ ID No. 2) соответственно. Каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот, при этом контролируют терапию путем сравнения определенной концентрации зрелого ADM 1-52 амида и/или зрелого ADM 1-52-Gly с пороговым значением, где значения концентрации зрелого ADM 1-52 амида и/или зрелого ADM 1-52-Gly выше порогового значения определяют пациента, который не поддается или плохо поддается терапии, а значения ниже порогового значения определяют пациента, который поддается терапии. Изобретение касается комбинации двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце, которые связываются с двумя различными областями в пределах области зрелого ADM 1-52 амида и/или ADM 1-52-Gly, которая представляет собой аминокислотный 21-52-амид (SEQ ID No. 1) или аминокислотный 21-52-Gly зрелого адромедуллина (SEQ ID No. 2) соответственно, где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот, и где иммунологический анализ не является сэндвич анализом, выполняемым вручную с трубкой, покрытой сложным эфиром акридиния. Также изобретение касается набора для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце, содержащего комбинацию двух указанных связующих. 4 н. и 21 з.п. ф-лы, 6 пр., 6 табл., 11 ил.

 

Предметом настоящего изобретения является способ in vitro для терапии периода наблюдения у пациентов с сепсисом, в котором концентрацию зрелого ADM 1-52 и/или зрелого ADM 1-52-Gly в образце биологической жидкости указанного пациента с сепсисом определяют, используя анализ, включающий два связующих, которые связывают две различные области в пределах области зрелого адромедуллина и/или адромедуллина-Gly, которая представляет собой аминокислотный 21-52-амид SEQ ID No. 1 или аминокислотный 21-52-Gly SEQ ID No. 2, где каждая из указанных областей содержит, по меньшей мере, 4 или 5 аминокислот.

Предметом представленного изобретения, кроме того, являются анализы и способы калибрования.

Пептидный адромедуллин (ADM) описан впервые у Kitamura et al., (смотри также 1; цифровые данные основаны на прилагаемом списке литературы) как новый гипотензивный пептид, содержащий 52 аминокислоты, который был выделен из феохромоцитомы человека. В том же году, также были описаны кДНК, кодирующая пептид предшественника, содержащий 185 аминокислот, и полная аминокислотная последовательность данного пептида предшественника. Пептид предшественника, который содержит, среди прочего, сигнальную последовательность из 21 аминокислоты на N-конце, называют как "пре-проадреномедуллин" (пре-проADM). Пре-проADM содержит 185 аминокислот и имеет последовательность, которая соответствует SEQ ID No: 3. Зрелый ADM отображается в SEQ ID No. 4 и зрелый ADM-Gly отображается в SEQ No. 5.

Пептидный адромедуллин (ADM) представляет собой пептид, который содержит 52 аминокислоты (SEQ ID No: 2), и который содержит аминокислоты от 95 по 146 из пре-проADM, из которого он формируется путем протеолитического расщепления. В настоящее время, по сути, только несколько фрагментов из пептидных фрагментов, образованных при расщеплении пре-проADM, были более точно охарактеризованы, в частности физиологически активные пептиды адромедуллина (ADM) и "РАМР", пептид, содержащий 20 аминокислот (22-41), которые следуют за 21 аминокислотой сигнального пептида в пре-проADM. Для обоих как ADM, так и РАМР, к тому же физиологически активные суб-фрагменты были обнаружены и исследованы более детально. Открытие и характеристика ADM в 1993 инициировало интенсивные исследования активности и поток публикаций, результаты которых были недавно подытожены в различных обзорных статьях, в контексте представленного описания, в котором ссылка делается, в частности, на статьи, которые были найдены в выпуске "Peptides", посвященном ADM (Peptides 22 (2001)), в частности (2) и (3). Дополнительным обзором является (4). В научных исследованиях на сегодняшний день, было обнаружено, среди прочего, что ADM может быть рассмотрен как полифункциональный регуляторный пептид. Он высвобождается в кровообращение в неактивной форме, продолженной глицином (5). Кроме того, существует связывающий белок (6), который является специфическим для ADM, и возможно, аналогичным образом, модулирует действие ADM.

Данные физиологические воздействия ADM, а также РАМР, которые имеют первостепенное значение в исследованиях на сегодняшний день, представляли собой воздействия, влияющие на кровяное давление. Таким образом, ADM является эффективным вазодилататором, причем существует возможность связать гипотензивный эффект, в частности, с пептидными сегментами в C-терминальной части ADM.

Кроме того, было обнаружено, что вышеуказанный далее физиологически активный пептид РАМР, образованный из пре-проADM, аналогичным образом демонстрирует гипотензивное действие, даже если он по-видимому, имеет механизм действия, отличающийся от такого ADM (смотри также в дополнение к вышеупомянутым обзорным статьям (3) и (4) также (7), (8) или (9) и (10)).

Кроме того, было обнаружено, что концентрации ADM, которые могут быть измерены в кровотоке и других биологических жидкостях, присутствуют, при ряде патологических состояний, значительно выше концентраций, которые были обнаружены у здоровых контрольных личностей. Таким образом, уровень ADM значительно возрастает у пациентов с застойной сердечной недостаточностью, инфарктом миокарда, заболеваниями почек, гипертоническими расстройствами, сахарным диабетом, в острой фазе шока и при сепсисе, и при септическом шоке, хотя и в разной степени. Концентрации РАМР, кроме того, являются возросшими при некоторых указанных патологических состояниях, но уровни плазмы снижаются по отношению к ADM ((3); страница 1702).

Кроме того, известно, что необычно высокие концентрации ADM должны наблюдаться при сепсисе или при септическом шоке (смотри также (3) и (11), (12), (13), (14) и (15)). Полученные результаты относятся к типичным гемодинамическим изменениям, которые известны как типичный симптом развития болезни у пациентов с сепсисом и другими тяжелыми синдромами, такими как, например, SIRS.

Хотя, предполагается, что ADM и РАМР образуются из одного и того же пептида предшественника, пре-проADM (SEQ ID No: 3), в котором аминокислотные последовательности, соответствующие данным пептидам присутствуют в виде частичных пептидов в эквимолярных количествах, концентрации ADM или РАМР, измеряемые в биологических жидкостях, по всей видимости, отличаются. В этом нет ничего необычного.

Таким образом, измеряемые концентрации различных продуктов разрушения одного и того же пептида предшественника могут различаться, например, потому что они представляют собой результат различных конкурирующих путей разрушения, которые, например, в случае различных патологических состояний, приводят к различной фрагментации предшествующего пептида и, следовательно, различным продуктам разрушения. Определенные частичные пептиды, содержащиеся в пептиде предшественника, могут быть образованы как свободные пептиды или не могут быть образованы, и/или различные пептиды образуются различными путями и в различных количествах. Даже если только один путь разрушения берут для обработки пептида предшественника, и, следовательно, все продукты разрушения происходят от одного и того же пептида предшественника, и должны быть сформированы в чистом виде, главным образом, в эквимолярных количествах, сравнительно устойчивые концентрации различных частичных пептидов и фрагментов, измеряемые в биологических жидкостях могут быть очень разными, а именно, например, когда их индивидуальные пептиды образуются с разной скоростью и/или имеют различные индивидуальные стабильности (время жизни) в соответствующей биологической жидкости, или если же они удаляются из кровотока на основании различных механизмов выведения и/или при разных скоростях выведения.

Адромедуллин играет решающие роли во время развития сепсиса ((16), (17)) и при многочисленных острых и хронических заболеваниях ((18), (4)).

ADM повышается при сепсисе и является прогностическим для последствий при сепсисе ((19), (14), (11)). Лечение сепсиса доводят до конца для раннего контролируемого наблюдения успешности лечения или неблагоприятного исхода, что является существенной остаточной неудовлетворенной клинической необходимостью.

В настоящее время не существует никаких ADM анализов, пригодных для рутинных диагностик. Чувствительность общедоступных в настоящее время тестов, чтобы определить зрелый ADM, является слишком низкой. Таким образом, для анализа является необходимым большой объем плазмы. Кроме того, в настоящее время, общедоступные анализы демонстрируют стабильность, связанную предварительно аналитическими ограничениями, например, образцы должны быть стабилизированы апротинином ((20), (21)). Вдобавок, некоторые анализы ADM требуют широкомасштабную подготовку образцов перед измерением (11).

Целью представленного изобретения является обеспечение анализа, который пригоден как рутинный способ для прямого измерения зрелого ADM, подходящий для стандартной автоматизированной лаборатории и технологии диагностики на месте.

Удивительно, но оказалось, что такой анализ может быть использован для контроля лечения у пациентов с сепсисом.

Объектом представленного изобретения является способ in vitro для контролирования терапии у пациентов с сепсисом, в котором определяют концентрацию зрелого ADM 1-52 и/или зрелого ADM 1-52-Gly в образце биологической жидкости указанного пациента с сепсисом, используя анализ, включающий два связующих вещества, которые связываются с двумя различными областями в пределах области зрелого адромедуллина и/или адромедуллина-Gly, который является аминокислотным 21-52-амидом SEQ ID No. 1 или аминокислотным 21-52-Gly SEQ ID No. 2, в котором каждая из указанных областей содержит, по меньшей мере, 4 или 5 аминокислот.

В одном варианте осуществления изобретения объектом является способ in vitro для контролирования терапии у пациентов с сепсисом, в котором одно из указанных связующих связывается с областью, которая включена в следующую последовательность зрелого ADM и/или зрелого ADM 1-52-Gly: ADM 21-32: CTVQKLAHQIYQ (SEQ ID No. 6)

и в котором указанный второй из данных связующих связывается с областью, которая включена в следующую последовательность зрелого ADM и/или зрелого ADM 1-52-Gly: ADM 42-52: APRSKISPQGY (SEQ ID No. 7)

В одном варианте осуществления изобретения чувствительность анализа указанного анализа способна определять количество ADM у здоровых субъектов и составляет <10 пг/мл, предпочтительно <40 пг/мл, более предпочтительно <70 пг/мл.

В одном варианте осуществления изобретения указанное связующее демонстрирует аффинность связывания со зрелым ADM и/или зрелым ADM 1-52-Gly, по меньшей мере, 107 Μ-1, предпочтительно 108 Μ-1, предпочтительная аффинность составляет больше чем 109 М-1, наиболее предпочтительная - больше чем 1010 М-1. Квалифицированный специалист в данной области с уровня техники знает, что может быть рассмотрено компенсирование более низкой аффинности путем применения более высокой дозы соединений и данное мероприятие не будет приводить к выходу за пределы объема изобретения.

Для определения аффинности антител к адромедуллину, определяли кинетики связывания адромедуллина с иммобилизованным антителом посредством поверхностного плазмонного резонанса без введения метки, используя систему Biacore 2000 (GE Healthcare Europe GmbH, Freiburg, Germany). Обратимую иммобилизацию антител осуществляли, используя анти-мышиное Fe антитело, ковалентно связанное с высокой плотностью с поверхностью СМ5 сенсора в соответствии с инструкциями производителя (набор для захвата мышиного антитела; GE Healthcare), (22).

В одном варианте осуществления изобретения указанное связующее выбирают из группы, включающей анти-адромедуллиновое антитело, или фрагмент анти-ADM антитела, связывающийся с ADM, или не-Ig матрицу, связывающуюся с адромедуллином.

Доведение до конца терапии означает, что, по меньшей мере, одну концентрацию ADM зрелого 1-52 (SEQ ID No. 4) и/или зрелого ADM 1-52-Gly (SEQ ID No. 5) определяют в образце, предпочтительно больше чем один раз, предпочтительно два раза или один раз в день после начала терапии.

В одном варианте осуществления изобретения он может быть так называемым POC-тестом (диагностика на месте), который представляет собой технологию тестирования, которая позволяет выполнение теста в пределах менее чем 1 час около пациента без требования полностью автоматизированной системы анализа. Одним из примеров данной технологии является иммунохроматографическая технология проведения теста.

В одном варианте осуществления изобретения такой анализ представляет собой сэндвич иммуноанализ, с использованием какого-либо вида технологии детектирования, включая, но, не ограничиваясь этим, ферментную метку, хемилюминесцентную метку, электрохемилюминесцентную метку, предпочтительно полностью автоматизированный анализ. В одном варианте осуществления изобретения такой анализ представляет собой меченый ферментом сэндвич анализ. Примеры автоматизированного или полностью автоматизированного анализа включают анализы, которые могут быть использованы для одной из следующих систем: Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, Biomerieux Vidas®, Alere Triage®.

Разнообразные иммунологические анализы известны и могут быть использованы для анализов и способов представленного изобретения, они включают: радиоиммунологические анализы ("RIA"), гомогенные иммуноферментные анализы ("EMIT"), фермент-связанные иммуносорбентные исследования ("ELISA"), апоферментный реактивационный иммуноанализ ("ARIS"), иммуноанализы с индикаторными полосками и иммунно-хроматографические анализы.

В одном варианте осуществления изобретения, по меньшей мере, один из указанных двух связующих метят для того, чтобы их детектировать.

Предпочтительные способы детектирования включают иммуноанализы в различных форматах, таких как, например, радиоиммунологический анализ (RIA), хемилюминесцентные- и флуоресцентные-иммуноанализы, фермент-связанные иммуноанализы (ELISA), сферические матрицы на основе Luminex, белковые микроматричные анализы, и быстрые форматы исследований, такие как, например, иммунно-хроматографические тест-полоски.

В предпочтительном варианте осуществления указанную метку выбирают из группы, включающей хемилюминесцентную метку, ферментную метку, флуоресцентную метку, метку с радиоактивным йодом.

Анализы могут быть гомогенными или гетерогенными анализами, конкурентными и неконкурентными анализами. В одном варианте осуществления, анализ представлен в форме сэндвич анализа, который является неконкурентным иммуноанализом, в котором молекула, которую детектируют и/или количественно определяют, связывается с первым антителом и со вторым антителом. Первое антитело может быть связанным с твердой фазой, например, сферой, поверхностью лунки или другого контейнера, чипом или полоской, и второе антитело представляет собой антитело, которое метят, например красителем, радиоактивным изотопом, или реакционно-способным, или каталитически активным фрагментом. Количество меченого антитела, связанного с анализируемым образцом, затем измеряют, используя соответствующий способ. Общий состав и процедуры, связанные с "сэндвич анализами" хорошо установлены и известны квалифицированному специалисту в данной области (23).

В другом варианте осуществления анализ включает две молекулы захвата, предпочтительно, антитела, которые оба присутствуют как дисперсии в жидкой реакционной смеси, в которой первый маркирующий компонент присоединяется к первой молекуле захвата, где указанный первый маркирующий компонент является частью маркирующей системы, основанной на флуоресцентном- или хемилюминесцентном гашении или усилении, и второй маркирующий компонент указанной маркирующей системы присоединяется ко второй молекуле захвата, таким образом, что при связывании обеих молекул захвата с анализируемым образцом измеряемый сигнал генерируется таким образом, что позволяет детектирование сформированных сэндвич-комплексов в растворе, содержащем образец.

В другом варианте осуществления, указанная маркирующая система содержит криптаты редкоземельных металлов или хелаты редкоземельных металлов в комбинации с флуоресцентным красителем или хемилюминесцентным красителем, в частности с красителем цианинового типа.

В контексте представленного изобретения, анализы, основанные на флуоресценции, включают использование красителей, которые, например, могут быть выбраны из группы, состоящей из FAM (5- или 6-карбоксифлуоресцеина), VIC, NED, флуоресцеина, флуоресцеинизотиоцианата (FITC), IRD-700/800, цианиновых красителей, таких как CY3, CY5, CY3.5, CY5.5, Cy7, ксантен, 6-карбокси-2',4',7',4,7-гексахлорфлуоресцеин (HEX), ΤΕΤ, 6-карбокси-4',5'-дихлор-2',7'-диметоксифлуоресцеин (JOE), Ν,Ν,Ν',Ν'-тетраметил-6-карбоксиродамин (TAMRA), 6-карбокси-Х-родамин (ROX), 5-карбоксиродамин-6G (R6G5), 6-карбоксиродамин-6С (RG6), родамин, родамин зеленый, родамин красный, родамин 110, BODIPY красителей, таких как BODIPY TMR, орегоновый зеленый, кумаринов, таких как умбеллиферон, бензимидов, таких как хехст 33258; фенантридинов, таких как техасский красный, якима желтый, Alexa Fluor, PET, бромистый этидий, акридиновых красителей, карбазольных красителей, феноксазиновых красителей, порфириновых красителей, полиметиновых красителей, и т.д.

В контексте представленного изобретения, анализы, основанные на хемилюминесценции, включают использование красителей, которые основаны на физических принципах, описанных для хемилюминесцентных материалов в (24). Предпочтительными хемилюминесцентными красителями являются сложные эфиры акридиния.

Как упоминается в данном документе, "анализ" или "диагностический анализ" может быть какого-либо типа, применяемого в области диагностики. Такой анализ может быть основан на связывании с анализируемым образцом, чтобы быть детектированным одним или больше зондами захвата с определенной аффинностью. Что касается взаимодействия между молекулами захвата и молекулами-мишенями, или молекулами, представляющими интерес, константа аффинности предпочтительно составляет больше, чем

В контексте представленного изобретения, "молекулы связующего вещества" представляют собой молекулы, которые могут быть использованы для связывания молекул-мишеней или молекул, представляющих интерес, то есть с анализируемыми образцами (то есть в контексте представленного изобретения РСТ и его фрагментов), из образца. Молекулы связующего вещества, таким образом, должны иметь соответствующую форму, как пространственную, так и с точки зрения особенностей поверхности, таких как поверхностный заряд, гидрофобность, гидрофильность, присутствие или отсутствие доноров и/или акцепторов Льюиса, чтобы специфически связываться с молекулами-мишенями или молекулами, представляющими интерес. Таким образом, связывание, например, может быть опосредованным через взаимодействия ионной, ван-дер-Ваальсовской, пи-пи, сигма-пи, гидрофобной или водородной связи или комбинации из двух или больше упомянутых выше взаимодействий между молекулами захвата и молекулами-мишенями или молекулами, представляющими интерес. В контексте представленного изобретения, молекулы связующего вещества, например, могут быть выбраны из группы, состоящей из молекулы нуклеиновой кислоты, молекулы углевода, молекулы РНК, белка, антитела, пептида или гликобелка. Предпочтительно, молекулы связующего вещества представляют собой антитела, включая их фрагменты с достаточной аффинностью к мишени или молекуле, представляющей интерес, и включая рекомбинантные антитела или фрагменты рекомбинантных антител, а также химически и/или биохимически модифицированные производные указанных антител или фрагментов, полученных из вариантной цепи с длиной, по меньшей мере, из их 12 аминокислот.

Хемилюминесцентная метка может быть меткой сложного эфира акридиния, стероидными метками, включающими изолюминольные метки и тому подобное.

Ферментные метки могут быть лактатдегидрогеназой (LDH), креатинкиназой (CPK), щелочной фосфатазой, аспартатаминотрансферазой (AST), аланинаминотрансферазой (ALT), кислой фосфатазой, глюкозо-6-фосфатдегидрогеназой и т.д.

В одном варианте осуществления изобретения, по меньшей мере, один из указанных двух связывающих веществ является связанным с твердой фазой, как магнитные частицы, и полистирольными поверхностями.

В одном варианте осуществления изобретения концентрация зрелого ADM 1-52 и/или зрелого ADM 1-52-Gly, измеренная в образце плазмы или крови, находится в диапазоне 10-500 пг/мл.

Уровни ADM представленного изобретения определялись согласно описанному ADM анализу. Указанные выше значения могли быть отличающимися в других ADM анализах, в зависимости от их способа калибровки. Указанные выше значения соответственно должны применяться для таких по-разному откалиброванных ADM анализов, принимая во внимание различия в калибровке. ADM анализы могли быть откалиброваны согласно корреляции и корректированию посредством своих нормальных диапазонов (здоровое население). Альтернативно, коммерчески доступные контрольные образцы могли быть использованы для корректирования различных калибровок (ICI Diagnostics, Berlin, Germany). Согласно описанному ADM анализу определяли среднее значение нормальной совокупности, которое составляло 24,7 пг/мл.

В одном варианте осуществления изобретения применяется пороговая чувствительность в соответствии, с чем значение выше пороговой чувствительности показывает, что пациент не реагирует или плохо реагирует на терапию, тогда как значение ниже указанной пороговой чувствительности показывает пациента, который реагирует на терапию.

В одном варианте осуществления изобретения применяется пороговая чувствительность от 60 до 80 пг/мл, предпочтительно 70 пг/мл.

В одном варианте осуществления изобретения указанный образец выбирают из группы, включающей человеческую цитратную плазму, гепаринизированную плазму, ЭДТА плазму, цельную кровь.

В одном варианте осуществления изобретения взятый указанный образец непосредственно измеряют без какой-либо дополнительной подготовки образца.

В одном варианте осуществления изобретения указанный способ осуществляют на полностью автоматизированном приборе. Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, Biomerieux Vidas®, Alere Triage®.

В одном варианте осуществления изобретения зрелый ADM 1-52 и/или зрелый ADM 1-52-Gly определяют, по меньшей мере, в двух образцах, где указанные образцы берут в различные моменты времени от указанных пациентов с сепсисом. Указанные образцы могут браться один раз в день в дни терапии. Такой диагностический режим может быть применен для другого биомаркера, который описывают, например (25) и также (26).

В одном варианте осуществления изобретения объем измеряемого образца составляет меньше или равно 50 мкл.

Способ in vitro для контролирования терапии у пациентов с сепсисом в соответствии с представленным изобретением может быть комбинированным с дополнительными клиническими и/или лабораторными параметрами и/или клиническими показателями, такими как, например, Apache 2 показатель, SOFA показатель, или другие, или одним или больше параметрами, содержащимися в пределах показателя. Изменяемые величины/параметры могут комбинировать постоянно или с перерывами, используя стандартные статистические способы.

Объектом изобретения, кроме того, является анализ для определения зрелого адромедуллина и/или адромедуллина-Gly в образце, который включает два связующих, которые связываются с двумя различными областями в пределах области зрелого адромедуллина и/или адромедуллина-Gly, который представляет собой аминокислотный 21-52-амид SEQ ID No. 1 или аминокислотный 21-52-Gly зрелого адромедуллина SEQ ID No. 2, где каждая из указанных областей содержит, по меньшей мере, 4 или 5 аминокислот, и где указанный анализ не является выполняемым вручную сэндвич анализом с трубкой покрытой сложным эфиром акридиния.

Объектом изобретения, кроме того, является анализ для определения зрелого адромедуллина, и/или адромедуллина-Gly, и/или адромедуллина-Gly в образце, который включает два связующих, которые связываются с двумя различными областями в пределах области зрелого адромедуллина и/или адромедуллина-Gly, который представляет собой аминокислотный 21-52-амид SEQ ID No. 1 или аминокислотный 21-52-Gly зрелого адромедуллина SEQ ID No. 2, где каждая из указанных областей содержит, по меньшей мере, 4 или 5 аминокислот, и где указанный анализ не является выполняемым вручную сэндвич анализом с трубкой покрытой сложным эфиром акридиния, и где одно из указанных связующих представляет собой антитело, которое связывается с SEQ ID No. 4, и где второе из указанных связующих представляет собой антитело, которое связывается с SEQ ID No. 7 (APRSKISPQGY-CO-NH2).

В одном варианте осуществления анализов для определения зрелого адромедуллина и/или адромедуллина-Gly в образце в соответствии с представленным изобретением одно из указанных связующих связывается с областью, содержащейся в следующей последовательности зрелого ADM:

CTVQKLAHQIYQ (SEQ ID No. 6)

и где указанное второе из данных связующих связывается с областью, содержащейся в следующей последовательности зрелого ADM:

APRSKISPQGY (SEQ ID No. 7)

В одном варианте осуществления анализов для определения зрелого адромедуллина и/или адромедуллина-Gly в образце в соответствии с представленным изобретением чувствительность анализа указанного анализа, которая способна быть количественно определенной ADM у здоровых субъектов, и составляет <10 пг/мл, предпочтительно <40 пг/мл и более предпочтительно <70 пг/мл.

В одном варианте осуществления анализов для определения зрелого адромедуллина и/или адромедуллина-Gly в образце в соответствии с представленным изобретением указанное связующее демонстрирует аффинность связывания с адромедуллином, по меньшей мере, 107 Μ-1, предпочтительно 108 Μ-1, предпочтительная константа аффинности составляет больше чем 109 М-1, наиболее предпочтительно - больше чем 1010 М-1. Квалифицированный специалист в данной области с уровня техники знает, что может быть рассмотрено компенсирование более низкой аффинности путем применения более высокой дозы соединений и данное мероприятие не будет приводить к выходу за пределы объема изобретения. Аффинность связывания может быть определена, как описано выше.

В одном варианте осуществления анализов для определения зрелого адромедуллина и/или адромедуллина-Gly в образце в соответствии с представленным изобретением указанное связующее выбирают из группы, включающей анти-адромедуллиновое антитело или фрагмент анти-ADM антитела, которое связывается с ADM, или не-Ig матрицу, которая связывается с адромедуллином.

В одном варианте осуществления анализов для определения зрелого адромедуллина и/или адромедуллина-Gly в образце в соответствии с представленным изобретением такой анализ представляет собой сэндвич анализ, предпочтительно, полностью автоматизированный анализ. Это может быть ELISA, полностью автоматизированный или выполняемый в ручную. Это может быть так называемый PCT-тест (диагностика на месте). Примеры автоматизированного или полностью автоматизированного анализа включают анализы, которые могут быть использованы для одной из следующих систем: Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, Biomerieux Vidas®, Alere Triage®. Примеры форматов исследований приведены выше.

В одном варианте осуществления анализов для определения зрелого адромедуллина и/или адромедуллина-Gly в образце в соответствии с представленным изобретеним, по меньшей мере, один из указанных двух связующих является меченным, для того чтобы быть определенным. Примеры меток представлены выше.

В одном варианте осуществления анализов для определения зрелого адромедуллина и/или адромедуллина-Gly в образце в соответствии с представленным изобретением, по меньшей мере, один из указанных двух связующих является связанным с твердой фазой. Примеры твердых фаз представлены выше.

В одном варианте осуществления анализов для определения зрелого адромедуллина и/или адромедуллина-Gly в образце в соответствии с представленным изобретением указанную метку выбирают из группы, включающей хемилюминесцентную метку, ферментную метку, флуоресцентную метку, метку с радиоактивным йодом.

Следующим объектом представленного изобретения является набор, включающий анализ в соответствии с представленным изобретением, в котором компоненты указанного анализа могут содержаться в одном или больше контейнере.

Следующим объектом представленного изобретения является способ калибрования анализа в соответствии с представленным изобретением, в котором связующее, предпочтительно антитело, используют таким образом, что он связывается с областью, по меньшей мере, из 5 аминокислот в пределах аминокислот 1-16 (SEQ ID No. 8) зрелого адромедуллина и/или адромедуллина-Gly. Указанное связующее может быть антителом, или фрагментом антитела, или не-Ig матрицей, которая связывается с областью, по меньшей мере, из 5 аминокислот в пределах аминокислот 1-16 (SEQ ID No. 8) зрелого адромедуллина и/или адромедуллина-Gly.

В одном варианте осуществления способа калибрования анализа в соответствии с изобретением указанное N-терминальное антитело, или фрагмент, или матрица распознает и связывается с N-терминальным концом (aal) зрелого адромедуллина и/или адромедуллина-Gly. Данный способ в другом предпочтительном варианте осуществления указанное анти-ADM-антитело или анти-адромедуллиновый фрагмент антитела или не-Ig матрица связывается только с областью в последовательности зрелого ADM, если N-терминальный конец ADM является свободным. В указанном варианте осуществления анти-ADM-антитело, или анти-адромедуллиновый фрагмент антитела, или не-Ig матрица не могли бы связываться с областью в последовательности зрелого ADM, если указанная последовательность является включенной в про-ADM.

Антитела, приемлемые для калибрования анализа в соответствии с изобретением, являются такими связующими, которые смягчают адсорбционные свойства ADM. Кроме того, такое связующее должно быть совместимым со связующими, используемыми в анализе детектирования, например, указанное связующее не должно препятствовать при связывании меченого связующего и твердофазного связующего в случае ELISA.

Представленные способы и анализы являются приемлемыми для рутинных применений. В большинстве случаев рутинные применения требуют того, что необходимый объем образца не должен превышать 50 мкл. Рутинное применение, кроме того, требует того, что предшествующая аналитическая обработка остается минимальной или является нулевой (использование рутинных образцов подобных ЭДТА плазме, цитратной плазме). Предварительные аналитические требования должны соответствовать клинической практике: минимальная стабильность анализируемого образца (>90% восстановление) должна быть при комнатной температуре, по меньшей мере, 2 часа.

Антитело в соответствии с представленным изобретением представляет собой белок, включающий один или больше полипептидов, в значительной степени кодированных иммуноглобулиновыми генами, которые специфически связывают антиген. Распознающие иммуноглобулиновые гены включают каппа, лямбда, альфа (IgA), гамма (IgG1, IgG2, IgG3, IgG4), дельта (IgD), эпсилон (IgE) и мю (IgM) константные области генов, а также огромное количество вариабельных областей иммуноглобулиновых генов. Иммуноглобулиновые легкие цепи полной длины имеют, в основном, приблизительно 25 Кд или 214 аминокислот в длину. Иммуноглобулиновые тяжелые цепи полной длины имеют, в основном, приблизительно 50 Кд или 446 аминокислот в длину. Легкие цепи кодируются геном с вариабельной областью на NH2-терминальном конце (приблизительно 110 аминокислот в длину) и каппа или лямбда ген с константной областью на COOH-терминальном конце. Тяжелые цепи кодируются, подобным образом, геном с вариабельной областью (приблизительно 116 аминокислот в длину) и одним из других генов с константной областью.

Основной структурной единицей антитела, как правило, является тетрамер, который состоит из двух идентичных пар иммуноглобулиновых цепей, где каждая пара имеет одну легкую и одну тяжелую цепь. В каждой паре, вариабельные области легкой и тяжелой цепи связываются с антигеном, и константные области являются посредниками эффекторных функций. Иммуноглобулины, кроме того, существуют в различных других формах, включая, например, Fv, Fab и (Fab')2, а также бифункциональные гибридные антитела и единичные цепи ((27), (28), (29), (30), (31)). Вариабельная область иммуноглобулиновой легкой или тяжелой цепи включает структурную область, прерванную тремя гипервариабельными областями, также называемые области определения комплементарности (CDR) смотри (32). Как указано выше, CDR являются, прежде всего, ответственными за связывание с эпитопом антигена. Иммунный комплекс представляет собой антитело, такое как моноклональное антитело, химерное антитело, гуманизированное антитело или человеческое антитело, или функциональный фрагмент антитела, специфически связанный с антигеном.

Химерные антитела представляют собой антитела, чьи гены с легкой и тяжелой цепью были сконструированными, как правило, путем генной инженерии, из иммуноглобулиновых генов с вариабельной и константной областями, которые принадлежат к различным видам. Например, вариабельные сегменты генов из мышиного моноклонального антитела могут быть связаны с человеческими константными сегментами, такими как каппа и гамма 1 или гамма 3. В одном примере, терапевтическое химерное антитело является, таким образом, гибридным белком, состоящим из вариабельного или антиген-связывающего домена из мышиного антитела и константного или эффекторного домена из человеческого антитела, хотя другие виды, относящиеся к млекопитающим, могут быть использованы, или вариабельная область может быть получена, путем использования молекулярных способов. Способы создания химерного антитела хорошо известны в данной области с уровня техники, например, смотри (33). "Гуманизированное" иммуноглобулин представляет собой иммуноглобулин, который включает человеческую структурную область и один или больше CDR из нечеловеческого (такого как мышиного, крысиного или синтетического) иммуноглобулина. Нечеловеческий иммуноглобулин, обеспечивающий CDR, называется "донором" и человеческий иммуноглобулин, обеспечивающий структуру, называется "акцептором". В одном варианте осуществления, все CDR являются из донорного иммуноглобулина в гуманизированном иммуноглобулине. Не существует необходимости в присутствии константных областей, но если они присутствуют, они должны быть в значительной степени идентичными к константным областям человеческого иммуноглобулина, то есть, по меньшей мере, приблизительно 85-90%, такая как приблизительно 95% или больше идентичность. Следовательно, все части гуманизированного иммуноглобулина, за исключением возможно CDR, являются в значительной степени идентичными соответствующим частям природных последовательностей человеческого иммуноглобулина. "Гуманизированное антитело" представляет собой антитело, содержащее гуманизированную легкую цепь и гуманизированную тяжелую цепь иммуноглобулина. Гуманизированное антитело связывается с тем же антигеном, что и донорное антитело, которое обеспечивает CDR. Акцепторная структура гуманизированного иммуноглобулина или антитела может иметь ограниченное количество заместителей аминокислотами, взятыми из донорной структуры. Гуманизированные или другие моноклональные антитела может иметь дополнительные консервативные аминокислотные замещения, которые в значительной степени не оказывают влияния на связывание антигена или другие функции иммуноглобулина. Иллюстративные консервативные замещения являются такими как gly, ala; val, ile, leu; asp, glu; asn, gln; ser, thr; lys, arg; и phe, tyr. Гуманизированные иммуноглобулины могут быть сконструированы посредством генной инженерии (например, смотри (34)). Человеческое антитело представляет собой антитело, в котором гены с легкой и тяжелой цепью являются человеческого происхождения. Человеческие антитела могут быть сгенерированы, используя способы, используя способы, известные в данной области с уровня техники. Человеческие антитела могут быть получены путем иммортализации человеческой В клетки, секретирующей антитело, представляющей интерес. Иммортализации может быть осуществлена, например, путем EBV инфицирования или путем слияния человеческой В клетки с клеткой миеломы или гибридомы с получением триомной клетки. Человеческие антитела, кроме того, могут быть получены согласно способам фагового дисплея (смотри, например, (35), (36), (37), которые включены в данный документ в виде ссылки), или выбраны из комбинаторной библиотеки человеческого моноклонального антитела (смотри Morphosys website). Человеческие антитела, кроме того, могут быть получены путем использования трансгенных животных, несущих человеческий иммуноглобулиновый ген (например, смотри (38) и (39) которые включены в данный документ в виде ссылки).

Таким образом, ADM антитело может иметь форматы, известные в данной области с уровня техники. Примерами являются человеческие антитела, моноклональные антитела, гуманизированные антитела, химерные антитела, CDR-привитые антитела. В предпочтительном варианте осуществления антитела в соответствии с представленным изобретением представляют собой рекомбинантно полученные антитела как, например, IgG, типовый, полной длины иммуноглобулин или фрагмент антител, содержащий, по меньшей мере, F-вариабельный домен тяжелой и/или легкой цепи как, например, химически связанные антитела (связывание фрагмента антигена), включая, но не ограничиваясь этим, Fab-фрагменты, включая Fab минитела, Fab антитело с одиночной цепью, моновалентное Fab антитело с эпитопными метками, например, Fab-V5Sx2; бивалентный Fab (мини-антитело) димеризованный с СНЗ доменом; бивалентный Fab или мультивалентный Fab, например, образованный посредством мультимеризации с помощью гетерологического домена, например, посредством димеризации dHLX доменов, например, Fab-dHLX-FSx2; Р(ab')2-фрагменты, scFv-фрагменты, мультимеризованные мультивалентные или/и мультиспецифические scFv-фрагменты, бивалентные и/или биспецифические диатела, BITE® (биспецифический Т-клеточный блокиратор), трифункциональные антитела, поливалентные антитела, например, из отличающегося класса, чем G; антитела с одиночным доменом, например, нанотела, полученные из верблюжьих или рыбьих иммуноглобулинов и многих других.

В дополнение к анти-ADM антителам другие полимерные матрицы являются хорошо известными в данной области с уровня техники как такие, что образуют комплекс мишенной молекулы и используются для генерирования высоко мишенных специфических биополимеров. Примерами являются аптамеры, шпигельмеры, антикалины и конотоксины.

В предпочтительном варианте осуществления формат ADM антитела format выбирают из группы, включающей Fv фрагмент, scFv фрагмент, Fab фрагмент, scFab фрагмент, (Fab)2 фрагмент и scFv-Fc слитый белок. В другом преимущественном варианте осуществления формат антитела выбирают из группы, включающей scFab фрагмент, Fab фрагмент, scFv фрагмент и их биологически доступные оптимизированные конъюгаты, такие как ПЭГилированные фрагменты. Одним из наиболее предпочтительных форматов является scFab формат.

He-Ig матрицы могут быть белковыми матрицами и могут быть использованы как имитаторы антитела, так как они способны связываться с лигандами или антигенами. He-Ig матрицы могут быть выбраны из группы, состоящей из не-Ig матриц на основе тетранектина (например, описанных в (40)), фибронектиновых матриц (например, описанных в (41)); матриц на основе липокалина {например, описанных в (42)); убиквинтиновых матриц (например, описанных в (43)), матриц переноса (например, описанных в (44)), белковых А матриц (например, описанных в (45)), матриц на основе повтора анкирина (например, описанных в (46), микробелковых (предпочтительно микробелки, образующие цистеиновый узел) матриц (например, описанных в (47)), матриц на основе Fyn SH3 домена (например, описанных в (48)), матриц на основе EGFR-A-домена (например, описанных в (49)) и матриц на основе домена Куница (например, описанных в (59)).

В другом преимущественном варианте осуществления анти-ADM антитело или фрагмент антитела, связывающийся с ADM, представляет собой моноспецифическое антитело. Моноспецифические антитела представляют собой антитела, которые все имеют аффинность к одному и тому же антигену. Моноклональные антитела являются моноспецифическими, но моноспецифические антитела, кроме того, могут быть получены, используя другие способы, чем продуцирование их из обыкновенной зародышевой клетки.

В одном предпочтительном варианте осуществления изобретения антитела в соответствии с представленным изобретением могут быть получены следующим образом:

Balb/c мыши иммунизировали 100 мкг ADM-пептид-BSA-конъюгата в 0 и на 14 день (эмульгированный в 100 мкл полного адъюванта Фрейнда) и 50 мкг на 21 и 28 день (в 100 мкл неполного адъюванта Фрейнда). За три дня до этого проводили эксперимент слияния, в котором животное получало 50 мкг конъюгата, растворенного в 100 мкл физиологического раствора, которое давалось в виде одной внутрибрюшинной и одной внутривенной инъекции.

Спленоциты от иммунизированной мыши и клетки из миеломной клеточной линии SP2/0 были слитыми с 1 мл 50% полиэтиленгликоля в течение 30 с при 37°C. После промывания, клетки высевали в 96-луночные планшеты для клеточной культуры. Гибридные клоны выбирали на основании роста в HAT среде [RPMI 1640 культуральная среда, дополненная 20% эмбриональной телячьей сывороткой и HAT-добавкой]. Через две недели HAT среду заменяют на HT среду в течение трех переносов, с последующим возвращением к нормальной клеточной культуральной среде.

Клеточные культуральные супернатанты первично подвергали скринингу на антиген-специфические IgG антитела через три недели после слития. Давшие положительный результат микрокультуры переносили в 24-лунковые планшеты для культивирования. После повторного исследования выбранные культуры клонировали и переклонировали, используя способ предельного разведения, и определяли изотопы (смотри также (51) и (52)).

Антитела могут быть получены посредством фагового дисплея в соответствии со следующим способом:

Библиотеки генов человеческого интактного антитела HAL7/8 использовали для выделения рекомбинантной одиночной цепи F-вариабельных доменов (scFv) против пептида адромедуллина. Библиотеки генов антитела подвергали скринингу, используя стратегию пэннинга, которая включает использование пептидов, содержащих биотиновую метку, связанную через два различных спейсера с пептидной последовательностью адромедуллина. Смесь циклов пэннинга, используя неспецифически связанный антиген и стрептавидин-связанный антиген, использовали, чтобы минимизировать фон неспецифических связующих. Элюированные фаги из третьего цикла пэннинга использовали для генерирования моноклонального scFv, экспрессирующего E. coli штаммы. Супернатант из культивирования данных клональных штамов непосредственно использовали для антиген ELISA исследования. (53) и (54).

Гуманизацию мышиных антител могут проводить в соответствии со следующим способом:

Для гуманизации антитела последовательность антитела мышиного происхождения анализируют для структурного взаимодействия скелетных областей (FR) с областями определения комплементарности (CDR) и антигеном. Основываясь на структурном моделировании выбирают соответствующий FR человеческого происхождения, и последовательности мышиной CDR трансплантируют в человеческую FR. Вариации в аминокислотной последовательности CDR или FR могут быть введены в структурные взаимодействия восстановления, которые были отменены переключателем видов для FR последовательностей. Данное восстановление структурных взаимодействий может быть достигнуто, используя библиотеки фагового дисплея или с помощью направленного подхода, руководствуясь молекулярным моделированием (55.)

Создание антител

Нами были созданы мышиные моноклональные антитела, связывающиеся с N-терминальным концом, среднераспространенным и C-терминальной частью hADM, и определены их константы аффинности (таблица 1).

Пептиды для иммунизации

Пептиды были поставлены компанией JPT Peptide Technologies GmbH (Berlin, Germany). Пептиды связывали с BSA, используя способ Сульфо-SMCC перекрестного сшивания. Способ перекрестного сшивания выполняли в соответствии с инструкциями производителя (Thermo Fisher/Pierce).

Пример 1

Генерация антител и определение их констант аффинности

Мышиные антитела генерировали в соответствии сое следующим способом: Balb/c мышь иммунизировали 100 мкг пептид-BSA-конъюгат на 0 и 14 день (эмульгированный в 100 мкл полного адъюванта Фрейнда) и 50 мкг на 21 и 28 день (в 100 мкл неполного адъюванта Фрейнда). За три дня до этого проводили эксперимент слияния, в котором животное получало 50 мкг конъюгата, растворенного в 100 мкл физиологического раствора, которое давалось в виде одной внутрибрюшинной и одной внутривенной инъекции.

Спленоциты от иммунизированной мыши и клетки из миеломной клеточной линии SP2/0 были слитыми с 1 мл 50% полиэтиленгликоля в течение 30 с при 37°C. После промывания, клетки высевали в 96-луночные планшеты для клеточной культуры. Гибридные клоны выбирали на основании роста в HAT среде [RPMI 1640 культуральная среда, дополненная 20% эмбриональной телячьей сывороткой и HAT-добавкой]. Через две недели HAT среду меняют на HT среду в течение трех переносов, с последующим возвращением к нормальной клеточной культуральной среде.

Клеточные культуральные супернатанты первично подвергали скринингу на антиген-специфические IgG антитела через три недели после слития. Давшие положительный результат микрокультуры переносили в 24-лунковые планшеты для культивирования. После повторного исследования выбранные культуры клонировали и переклонировали, используя способ предельного разведения, и определяли изотипы ((51) и (52)).

Получение моноклонального антитела

Антитела получали, используя стандартные способы получения антитела (56), и чистили с помощью белка А. Чистота антитела составляла >95%, основываясь на SDS гель-электрофорезном анализе.

Константы аффинности

Для определения аффинности антител к адромедуллину, определяли кинетики связывания адромедуллина с иммобилизированным антителом с помощью поверхностного плазмонного резонанса без меток, используя систему Biacore 2000 (GE Healthcare Europe GmbH, Freiburg, Germany). Обратимую иммобилизацию антител проводили, используя анти-мышиное Fe антитело, ковалентно связанное с высокой плотностью с поверхностью СМ5 датчика в соответствии с инструкциями производителя (комплект захвата мышиного антитела; GE Healthcare) (22).

Способ введения метки (меченое вещество): 100 мкг (100 мкл) антитела (1 мг/мл в PBS, pH 7,4,) смешивали с 10 мкл NHS-сложный эфир акридиния (1 мг/мл в ацетонитриле, In Vent GmbH, Germany) (57) и инкубировали в течение 20 мин при комнатной температуре. Меченный СТ-Н чистили, используя гель-фильтрационную ВЭЖХ на Bio-Sil® SEC 400-5 (Bio-Rad Laboratories, Inc., USA). Очищенное меченое антитело разбавляли в (300 ммоль/л фосфата калия, 100 ммоль/л NaCl, 10 ммоль/л Na-ЭДТА, 5 г/л бычьего сывороточного альбумина, рН 7,0). Конечная концентрация составляла приблизительно 800.000 относительных световых единиц (RLU) меченого соединения (приблизительно 20 нг меченого антитела) на 200 мкл. Хемилюминесценцию сложного эфира акридиния измеряли путем использования AutoLumat LB 953 (Berthold Technologies GmbH & Co. KG).

Твердая фаза: Полистирольные трубки (Greiner Bio-One International AG, Austria) покрывали (18 часов при комнатной температуре) антителом ((1.5 мкг антитело/0,3 мл 100 ммоль/л NaCl, 50 ммоль/л TRIS/HCl, рН 7.8). После блокирования 5% бычьим сывороточным альбумином, трубки промывали PBS, pH 7,4 и сушили в вакууме.

Калибровочные стандарты:

Синтетический человеческий ADM (Bachem, Switzerland) линейно разбавляли, используя 50 мМ Трис/HCl, 250 мМ NaCl, 0,2% Triton Х-100, 0,5% BSA, 20 табл./л полных протеазных таблеток смеси ингибиторов протеаз (Roche AG); pH 7,8. Калибровочные стандарты хранили при -20°C до использования.

Пример 2

Определение комбинации антитела, которая дает высокие соотношения сигнал/шум

hADM Иммуноанализ:

50 мкл образца (или калибровочного стандарта) раскапывали из пипетки на покрытые трубки, после добавления меченого второго антитела (200 мкл), трубки инкубировали в течение 2 часов при комнатной температуре. Несвязанное меченое вещество удаляли путем промывания 5 раз (каждый по 1 мл) промывным раствором (20 мМ PBS, pH 7,4, 0,1% Triton Х-100).

Хемилюминесценцию связанной трубки измеряли путем использования LB 953.

Все антитела использовали в сэндвич иммуноанализе как покрытую трубку и меченое антитело, и комбинировали в следующих вариациях (таблица 2):

Инкубирование выполняли, как описано в hADM-иммуноанализе. Результаты представлены в соотношении специфический сигнал (при 10 нг/мл АОМ)/фоновый (образец без ADM) сигнал.

Неожиданно, мы обнаружили, что комбинация MR-ADM и CT-ADM является комбинацией с наиболее высоким соотношением сигнал/шум.

Впоследствии, мы использовали данную комбинацию с антителом для дальнейших исследований. Мы использовали MR-ADM, как твердофазное антитело, и CT-ADM, как меченое антитело. Типичная кривая доза/сигнал показана на фиг. 1. Аналитическая чувствительность (среднее из 10 серий, образец без ADM+2SD) анализа составляла 2 пг ADM/мл.

Пример 3

Стабильность человеческого адромедуллина:

Человеческий ADM разбавляли в человеческой цитратной плазме (n=5, конечная концентрация 10 нг ADM/мл) и инкубировали при 24°С. В выбранные точки времени, аликвоты замораживали при -20°C. Непосредственно после оттаивания образцы hADM определяли количественно путем использования hADM иммуноанализ, описанный выше.

Неожиданно, используя комбинации с антителом MR-ADM и CT-ADM в сэндвич иммунном анализе, преаналитическая стабильность анализируемого образца является высокой (только 0,9%/ч среднее значение потери иммунной реактивности). В отличие от этого, используя другие способы анализа, сообщалось о периоде полувыведения из плазмы только 22 мин (Hinson 2000). Поскольку время от взятия образца до анализа в обычном больничном порядке составляет меньше чем 2 ч, используемый способ определения является приемлемым для стандартной постановки диагноза. Примечательно, что какие-либо нестандартные добавки к образцам (подобные апротинину, (20)) не нужны, чтобы достигнуть приемлемых стабильностей ADM-иммунологической реактивности.

Пример 4

Воспроизводимость препаратов калибровочного стандарта

Авторы обнаружили высокое варьирование результатов, получая калибровочные стандарты для ADM анализов (среднее CV 8,5%, смотри таблицу 4). Это может быть в результате высокой адсорбции hADM на поверхностях пластмассы и стекла (смотри также (58)). Данный эффект только слегка был уменьшен путем добавления детергентов (вплоть до 1% Triton X 100 или 1% Tween 20), белка (вплоть до 5% BSA) и раствора высокой ионной силы (вплоть до 1М NaCl) или их комбинаций. Неожиданно, если избыток анти ADM антитела (10 мкг/мл) добавляют в буфер разбавления калибровочного стандарта, то восстановление и воспроизводимость препаратов калибровочного стандарта для ADM анализа существенно улучшились до <1% среди препарата CV (таблица 4).

К счастью, присутствие N-терминальных антител не оказывало действие на генерируемый ADM-сигнал за счет комбинации MR- и C-терминальных антител (фиг. 11).

Средипрепаратное варьирование калибровочных стандартов

ADM анализ калибровочные стандарты получали, как описано выше с и без 10 мкг/мл NT-ADM-антитела. Коэффициенты варьирования представлены от 5 независимых анализов препарата. Калибровочные стандарты измеряли, используя ADM анализ, описанный выше, с/ш-с = соотношение сигнал-шум.

Для всех следующих исследований мы использовали ADM анализ, основанный на калибровочных стандартах, полученных в присутствии 10 мкг/мл NT-ADM антитела и 10 мкг/мл NT-ADM антитела, как добавление в буфер меченого вещества.

Пример 5

Чувствительность

Цель чувствительности анализа состояла в том, чтобы полностью покрыть ADM концентрации здоровых субъектов.

ADM концентрация у здоровых субъектов:

Здоровые субъекты (n=100, средний возраст 56 лет) обследовали, используя ADM анализ. Среднее значение составляло 24,7 пг/мл, наиболее низкое значение 11 пг/мл и 99-процентильный эквивалент 43 пг/мл. Поскольку чувствительность анализа составляла 2 пг/мл, 100% всех здоровых субъектов попадали в диапазон обнаружения, используя описанный ADM анализ (смотри фиг. 2).

Пример 6

Клиническое исследование

101 ED пациент, соответствующие определению сепсиса (59) были впоследствии госпитализированы (в среднем 5 дней госпитализации) и получали отвечающую протоколам лечебную терапию. ЭДТА-плазма генерировалась с 1-го дня (ED представление) и один образец каждый день на протяжении пребывания в больнице. Время, чтобы заморозить образцы для последующего ADM-измерения, составляло меньше чем 4 часа.

Характеристики пациентов просуммированы в таблице 5

26,7% из всех пациентов умерли во время пребывания в больнице, и считаются пациентами, у которых не был достигнут лечебный эффект, 73,3% из всех пациентов пережили сепсис и считаются пациентами, у которых достигнут лечебный эффект.

66% из всех присутствующих пациентов с сепсисом имели ненормальное значение ADM >43 пг/мл (99-процентильный эквивалент), показывая, что ADM не является маркером для инфекции.

Результаты клинического исследования

Начальный ADM является высокопрогностическим.

Мы привели в соответствие начальное значение ADM со смертностью в больнице и сравнили ADM с показателем сепсиса по шкале APACHE 2 (смотри (60)). ADM является высоко прогностическим для конечного результата сепсиса (смотри фиг. 3) и сравнимым с показателем по шкале APACHE 2. Если ADM и APACHE 2 объединят (Фиг. 4), то появится важная дополнительная информация.

ADM в осуществлении контроля лечения

Пациентов лечили, основываясь на отвечающей протоколам лечебной терапии (таблица 5). Среднее время госпитализации составляло 5 дней. ADM измеряли каждый день в больнице (день 1 = госпитализация) и устанавливать взаимосвязь со смертностью в больнице (таблица 6). ADM изменялся во время пребывания в больнице и изменение в течение времени улучшало прогностическое значение на 52% от начального, Хи2 от 19,2 до 29,2 на 5-й день.

Использование простой обрезанной модели при 70 пг/мл ADM показало 68% риск смерти пациентов, начиная с ADM концентраций >70 пг/мл, и оставалась все пребывание в больнице >70 пг/мл (пациенты, у которых не был достигнут лечебный эффект). Пациенты, которые имели все время значение ADM <70 пг/мл, или, у которых наблюдалось изменение от >70 пг/мл до <70 пг/мл, имели смертность только 11% (пациенты, которые хорошо поддавались лечению/терапии) и пациенты, демонстрирующие значения ADM >70 пг/мл и понижение их ADM концентрации во время стационарного лечения до значений <70 пг/мл, имели 0% смертность. Пациентов, у которых наблюдалось изменение от <70 пг/мл до >70 пг/мл во время лечения в стационаре больнице, не было. Среднее время необходимое для получения информации о пациенте, у которого был достигнут лечебный эффект/пациенте, у которого не был достигнут лечебный эффект для всех пациентов составляло приблизительно 1 день. Пациентам, у которых >70 пг/мл, реагирующим на лечение во время пребывания в стационаре больницы, понадобилось приблизительно 2 дня, чтобы показать успех лечения по ADM.

ЛИТЕРАТУРА

(1) Kitamura, K., et al., "Adrenomedullin: A Novel Hypotensive Peptide Isolated From Human Pheochromocytoma", Biochemical and Biophysical Research Communications, Vol. 192 (2), pp. 553-560(1993).

(2) Editorial, Takahashi, K., "Adrenomedullin: from a pheochromocytoma to the eyes", Peptides, Vol. 22, p. 1691 (2001).

(3) Eto, T., "A review of the biological properties and clinical implications of adrenomedullin and proadrenomedullin N-terminal 20 peptide (PAMP), hypotensive and vasodilating peptides", Peptides, Vol. 22, pp. 1693-1711 (2001).

(4) Hinson, et al., "Adrenomedullin, a Multifunctional Regulatory Peptide", Endocrine Reviews, Vol.21(2), pp. 138-167 (2000).

(5) Kitamura, K., et al., "The intermediate form of glycine-extended adrenomedullin is the major circulating molecular form in human plasma", Biochem. Biophys. Res. Commun., Vol. 244(2), pp. 551-555 (1998). Abstract Only.

(6) Pio, R., et al., "Complement Factor H is a Serum-binding Protein for Adrenomedulli, and the Resulting Complex Modulates the Bioactivities of Both Partners", The Journal of Biological Chemistry, Vol.276(15), pp.12292-12300 (2001).

(7) Kuwasako, K., et al., "Purification and characterization of PAMP-12 (PAMP-20) in porcine adrenal medulla as a major endogenous biologically active peptide", FEBS Lett, Vol. 414(1), pp. 105-110 (1997). Abstract Only.

(8) Kuwasaki, K., et al., "Increased plasma proadrenomedullin N-terminal 20 peptide in patients with essential hypertension", Ann. Clin. Biochem., Vol. 36 (Pt. 5), pp. 622-628 (1999). Abstract Only.

(9) Tsuruda, T., et al., "Secretion of proadrenomedullin N-terminal20 peptide from cultured neonatal rat cardiac cells", Life Sci., Vol. 69(2), pp. 239-245 (2001). Abstract Only.

(10) EP 0622458 A2

(11) Hirata, et al., "Increased Circulating Adrenomedullin, a Novel Vasodilatory Peptide, in Sepsis", Journal of Clinical Endocrinology and Metabolism, Vol.81(4), pp. 1449-1453 (1996).

(12) Ehlenz, K., et al., "High levels of circulating adrenomedullin in severe illness: Correlation with C-reactive protein and evidence against the adrenal medulla as site of origin", Exp Clin Endocrinol Diabetes, Vol. 105, pp. 156-162 (1997).

(13) Tomoda, Y., et al., "Regulation of adrenomedullin secretion from cultured cells", Peptides, Vol. 22, pp.1783-1794 (2001).

(14) Ueda, S., et al., "Increased Plasma Levels of Adrenomedullin in Patients with Systemic Inflammatory Response Syndrome", Am. J. Respir. Crit. Care Med., Vol. 160, pp. 132-136 (1999).

(15) Wang, P., "Andrenomedullin and cardiovascular responses in sepsis", Peptides, Vol. 22, pp. 1835-1840 (2001).

(16) Wang 1998

(17) Wang 1998 Arch Surg, Itoh, 2007

(18) Parlapiano, С, et al.; "Adrenomedulin assay and its clinical significance", European Review for Medical and Pharmacological Sciences, 1999; 3:53-61

(19) Hirata 2007

(20) Ohta 1999

(21) Kitamura 1994

(22) Lorenz et al." Functional Antibodies Targeting IsaA of Staphylococcus aureus Augment Host Immune Response and Open New Perspectives for Antibacterial Therapy"; Antimicrob Agents Chemother. 2011 January; 55(1): 165-173.

(23) The Immunoassay Handbook, Ed. David Wild, Elsevier LTD, Oxford; 3rd ed. (May 2005), ISBN-13: 978-0080445267; Hultschig С et al., Curr Opin Chem Biol. 2006 Feb; 10(1): 4-10. PMID: 16376134

(24) Kirk-Othmer, Encyclopedia of chemical technology, 4th ed., executive editor, J.I. Kroschwitz; editor, M. Howe-Grant, John Wiley & Sons, 1993, vol. 15, p. 518-562, incorporated herein by reference, including citations on pages 551-562.

(25) Schuetz P, et al. PCT follow up measurement for monitoring antibiotic treatment success; 8 Cochrane Database Syst Rev. 2012 Sep 12;9: CD007498. Procalcitonin to initiate or discontinue antibiotics in acute respiratory tract infections.

(26) Christ-Crain M, et al. "Procalcitonin guidance of antibiotic therapy in community-acquired pneumonia: a randomized trial" Am J Respir Crit Care Med. 2006 Jul 1;174(1): 84-93. Epub 2006 Apr 7.

(27) Lanzavecchia et al., Eur. J. Immunol. 17:105, 1987;

(28) Huston et al., Proc. Natl. Acad. Sci. U.S.A., 85: 5879-5883, 1988;

(29) Bird et al., Science 242:423-426, 1988;

(30) Hood et al., Immunology, Benjamin, Ν.Y., 2nd ed., 1984;

(31) Hunkapiller and Hood, Nature 323:15-16,1986);

(32) E. Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1983

(33) U.S. Patent No. 5,807,715.

(34) U.S. Patent No. 5,585,089

(35) Dower et al., PCT Publication No. WO 91/17271;

(36) McCafferty et al., PCT Publication No. WO 92/001047;

(37) Winter, PCT Publication No. WO 92/20791

(38) Lonberg et al., PCT Publication No. WO 93/12227; and

(39) Kucherlapati, PCT Publication No. WO 91/10741,

(40) US 2010/0028995

(41) EP 1266 025;

(42) WO 2011/154420

(43) WO 2011/073214

(44) US 2004/0023334

(45) EP 2231860

(46) WO 2010/060748

(47) EP 2314308

(48) WO 2011/023685

(49) WO 2005/040229

(50) ЕР 1941867

(51) Lane, R.D. (1985). A short-duration polyethylene glycol fixsiontechnique for increasing production of monoclonal antibody-secreting hybridomas. J. Immunol. Meth. 81: 223-228;

(52) Ziegler, B. et al. (1996) Glutamate decarboxylase (GAD) is not detectable on the surface of rat islet cells examined by cytofluorometry and complement-dependent antibody-mediated cytotoxicity of monoclonal GAD antibodies, Horm. Metab. Res. 28: 11-15);

(53) Hust, M., et al. 2011. A human scFv antibody generation pipeline for proteome research. Journal of Biotechnology 152, 159-170;

(54) Schütte, M., et al. 2009. Identification of a putative Crf splice variant and generation of recombinant antibodies for the specific detection of Aspergillus fumigatus. PLoS One 4, e6625);

(55) Almagro JC, Fransson J., 2008. Humanization of antibodies. Front Biosci. 2008 Jan 1;13: 1619-33;

(56) Marx et al., Monoclonal Antibody Prodcution, ATLA 25,121,1997;

(57) EP 0353971;

(58) Lewis, L., et al., "Adrenomedullin (1-52) measured in human plasma by radioimmunoassay: plasma concentration, adsorption, and storage", Clinical Chemistry, Vol. 44(3), pp.571-577 (1998);

(59) Crit Care Med. 2008 Jan; 36(1): 296-327;

(60) Knaus et al., 1985, 2001.ОПИСАНИЕ ФИГУР

Фигура 1 показывает типичную кривую hADM доза/ответ, используя MR-ADM, как твердофазное антитело, и CT-ADM как меченое антитело.

Фигура 2: Здоровых субъектов (n=100, средний возраст 56 лет) оценивали, используя ADM анализ. Среднее значение составляло 24,7 пг/мл, наиболее низкое значение 11 пг/мл и 99-процентильный эквивалент 43 пг/мл. Поскольку чувствительность анализа составляла 2 пг/мл, 100% всех здоровых субъектов попадали в диапазон обнаружения, используя описанный ADM анализ.

Фигура 3: Прогнозирование смертности в стационаре больницы - Результаты по логистической регрессии.

Фигура 4: Прогнозирование смертности в стационаре больницы - ADM является независимым от Apache и обеспечивает дополнительную прогностическую информацию.

Фигуры с 5 по 10: ADM-кинетики конкретного пациента.

Фигура 5 и Фигура 6: Выжившие субъекты, ADM составляет <70 пг/мл при ED поступлении (1-й день) и во время пребывания в стационаре больницы. ADM показывает пациента, хорошо поддающегося лечению.

Фигура 7 и Фигура 8: Выжившие субъекты, ADM составляет выше 70 пг/мл при ED поступлении (1-й день) и снижается во время получения лечения в стационаре больницы до значений ниже 70 пг/мл (пациенты, у которых достигнут лечебный эффект).

Фигура 9 и Фигура 10: Умершие пациенты, ADM составляет выше 70 пг/мл при ED поступлении (1-й день) и не снижается до значений ниже 70 пг/мл во время получения лечения в стационаре больницы (пациенты, у которых не был достигнут лечебный эффект).

Фигура 11: ADM анализ в присутствии и при отсутствии N-терминального антитела.

ADM анализ выполняли, как описано выше. А) эталонная кривая В) в присутствии NT-ADM-антитела (10 мкг/мл, 3,33 мкг/испытание). Добавление NT-ADM-антитела не влияет на ADM анализ.

ПОСЛЕДОВАТЕЛЬНОСТИ

SEQ ID No. 1: ADM 21-52

CTVQKLAHQIYQFTDKDICDNVAPRSKISPQGY-CONH2

SEQ ID No. 2: ADM 21-52-Gly CTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYG

SEQ ID No. 3: PreProADM

MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCWQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

SEQ ID No. 4: ADM 1-52

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-CONH2

SEQ ID No. 5: ADM 1-S2-Gly

YRQSMNNFQGLRSFGCRFGTCWQKLAHQIYQFTDKDKDNVAPRSKISPQGYG

SEQ ID No. 6: ADM 21-32 CTVQKLAHQIYQ

SEQ ID No. 7: ADM 42-52 APRSKISPQGY

SEQ ID No. 8: ADM 1-16-Gly (аминокислота)

YRQSMNNFQGLRSFGC

1. Способ in vitro контроля терапии у пациентов, у которых подозревают наличие сепсиса, в котором концентрацию зрелого адромедуллина (ADM) 1-52 амида и/или зрелого ADM 1-52-Gly в образце биологической жидкости указанного пациента с сепсисом определяют, используя иммунологический анализ с применением комбинации двух связующих, которые выбраны из группы, состоящей из антитела к ADM и/или фрагмента антитела к ADM, и которые связывают две различные области в пределах области зрелого ADM 1-52 амида и/или ADM 1-52-Gly, которая представляет собой аминокислотный 21-52-амид (SEQ ID No. 1) или аминокислотный 21-52-Gly (SEQ ID No. 2) соответственно, где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот, при этом контролируют терапию путем сравнения определенной концентрации зрелого ADM 1-52 амида и/или зрелого ADM 1-52-Gly с пороговым значением, где значения концентрации зрелого ADM 1-52 амида и/или зрелого ADM 1-52-Gly выше порогового значения определяют пациента, который не поддается или плохо поддается терапии, а значения ниже порогового значения определяют пациента, который поддается терапии.

2. Способ in vitro контроля терапии у пациентов с сепсисом по п. 1, в котором одно из указанных связующих связывается с областью, содержащейся в следующей последовательности зрелого ADM 1-52 амида и/или зрелого ADM 1-52-Gly (SEQ ID No. 4), и в котором указанное второе из данных связующих связывается с областью, содержащейся в следующей последовательности зрелого ADM 1-52 амида и/или зрелого ADM 1-52-Gly (SEQ ID No. 5).

3. Способ in vitro контроля терапии у пациентов с сепсисом по п. 1 или 2, где чувствительность иммунологического анализа является достаточной, чтобы количественно определить ADM у здоровых субъектов, которая составляет <10 пг/мл, предпочтительно <40 пг/мл и более предпочтительно <70 пг/мл.

4. Способ in vitro контроля терапии у пациентов с сепсисом по п. 1 или 2, в котором указанное связующее демонстрирует аффинность связывания со зрелым ADM 1-52 амидом и/или зрелым ADM 1-52-Gly по меньшей мере 107 М-1.

5. Способ in vitro контроля терапии у пациентов с сепсисом по п. 1 или 2, в котором такой иммунологический анализ представляет собой сэндвич анализ, предпочтительно полностью автоматизированный анализ.

6. Способ in vitro контроля терапии у пациентов с сепсисом по п. 1 или 2, в котором по меньшей мере одно из указанных двух связующих метят, для того чтобы детектировать.

7. Способ in vitro контроля терапии у пациентов с сепсисом по п. 1 или 2, в котором по меньшей мере одно из указанных двух связующих является связанным с твердой фазой.

8. Способ in vitro контроля терапии у пациентов с сепсисом по п. 6, в котором указанную метку выбирают из группы, включающей хемилюминесцентную метку, ферментную метку, флуоресцентную метку, метку с радиоактивным йодом.

9. Способ in vitro контроля терапии у пациентов с сепсисом по любому из пп. 1, 2, 8, в котором концентрация зрелого ADM 1-52 амида и/или зрелого ADM 1-52-Gly, измеренная в образце, находится в диапазоне 10-500 пг/мл.

10. Способ in vitro контроля терапии у пациентов с сепсисом по любому из пп. 1, 2, 8, в котором применяют пороговую чувствительность от 60 до 80 пг/мл, предпочтительно 70 пг/мл.

11. Способ in vitro для контроля терапии у пациентов с сепсисом по любому из пп. 1, 2, 8, в котором указанный образец выбирают из группы, включающей человеческую цитратную плазму, гепаринизированную плазму, ЭДТА плазму, цельную кровь.

12. Способ in vitro для контроля терапии у пациентов с сепсисом по п. 11, в котором указанный взятый образец измеряют непосредственно без какой-либо дополнительной подготовки образца.

13. Способ in vitro контроля терапии у пациентов с сепсисом по любому из пп. 1, 2, 8, 12, в котором указанный способ выполняют на полностью автоматизированном устройстве.

14. Способ in vitro контроля терапии у пациентов с сепсисом по любому из пп. 1, 2, 8, 12, в котором зрелый ADM 1-52 амид и/или зрелый ADM 1-52-Gly определяют по меньшей мере в двух образцах, где указанные образцы отбирают в различных точках времени у указанных пациентов с сепсисом.

15. Способ in vitro контроля терапии у пациентов с сепсисом по любому из пп. 1, 2, 8, 12, в котором объем измеряемого образца составляет меньше или равен 50 мкл.

16. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце, которые выбраны из группы, включающей антитело к ADM и/или фрагмент антитела к ADM, и которые связываются с двумя различными областями в пределах области зрелого ADM 1-52 амида и/или ADM 1-52-Gly, которая представляет собой аминокислотный 21-52-амид (SEQ ID No. 1) или аминокислотный 21-52-Gly зрелого адромедуллина (SEQ ID No. 2) соответственно, где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот, и где иммунологический анализ не является сэндвич анализом, выполняемым вручную с трубкой, покрытой сложным эфиром акридиния.

17. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце, которые выбраны из группы, включающей антитело к ADM и/или фрагмент антитела к ADM, и которые связываются с двумя различными областями в пределах области зрелого ADM 1-52 амида и/или ADM 1-52-Gly, которая представляет собой аминокислотный 21-52-амид (SEQ ID No. 1) или аминокислотный 21-52-Gly зрелого адромедуллина (SEQ ID No. 2) соответственно, где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот, и где для указанного определения используют сэндвич анализ, выполняемый вручную с трубкой, покрытой сложным эфиром акридиния, и где одно из указанных связующих представляет собой антитело, связывающееся с SEQ ID No. 6 CTVQKLAHQIYQ, и где второе из указанных связующих представляет собой антитело, связывающееся с SEQ ID No. 7 APRSKISPQGY, в которой карбоксильная кислота заменена амидной группой (APRSKISPQGY-CO-NH2).

18. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце по п. 17, в котором одно из указанных связующих связывается с областью, содержащейся в следующей последовательности зрелого ADM 1-52-Gly (SEQ ID No. 4), и где указанное второе из данных связующих связывается с областью, содержащейся в следующей последовательности зрелого ADM 1-52 амида и/или зрелого ADM 1-52-Gly (SEQ ID No. 5).

19. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце по п. 17 или 18, где чувствительность указанного иммунологического анализа является достаточной, чтобы количественно определить ADM у здоровых субъектов, и составляет <10 пг/мл, предпочтительно <40 пг/мл и более предпочтительно <70 пг/мл.

20. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце по п. 17 или 18, в котором указанное связующее демонстрирует аффинность связывания с ADM по меньшей мере, 107 М-1.

21. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце по п. 17 или 18, в котором для указанного определения используют иммунологический анализ, который представляет собой сэндвич анализ, предпочтительно полностью автоматизированный анализ.

22. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце по п. 17 или 18, в котором по меньшей мере один из указанных двух связующих метят для того, чтобы детектировать.

23. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце по п. 17 или 18, в котором по меньшей мере одно из указанных двух связующих является связанным с твердой фазой.

24. Комбинация двух связующих для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце по п. 23, в котором указанную метку выбирают из группы, включающей хемилюминесцентную метку, ферментную метку, флуоресцентную метку, метку с радиоактивным йодом.

25. Набор для определения зрелого ADM 1-52 амида и/или ADM 1-52-Gly в образце, содержащий комбинацию двух связующих по любому из пп. 16-24.



 

Похожие патенты:

Изобретение относится к медицине, а именно к отоларингологии, иммунологии, нейрофизиологии, медицине труда, и может быть использовано для диагностики нейросенсорной тугоухости у работающих в условиях воздействия шума.

Изобретение относится к области медицины, в частности к молекулярно-генетической диагностике, и раскрывает способ выявления нарушений физиологической иммуносупрессии у детей в первом поколении по мужской линии с отягощенной наследственностью в условиях избыточной экспозиции алюминием.

Изобретение относится к области медицины и представляет собой способ прогнозирования риска развития сердечно-сосудистой патологии у особи женского пола, который включает: определение уровня про-нейротензина 1-117 в сыворотке крови, плазме крови или цельной крови, корреляцию уровня про-нейротензина 1-117 с риском развития сердечно-сосудистой патологии, где повышенный уровень является прогностическим для повышенного риска и где указанная сердечно-сосудистая патология представляет собой инфаркт миокарда, инсульт, острую сердечную недостаточность и смерть, связанную с инфарктом миокарда, инсультом или острой сердечной недостаточностью, и где уровень про-нейротензина 1-117 определен натощак.

Изобретение относится к биоорганической химии и может быть использовано для определения аминокислотной последовательности пептидов и их фрагментов методом масс-спектрометрии.

Изобретение относится к биоорганической химии и может быть использовано для определения аминокислотной последовательности пептидов и их фрагментов методом масс-спектрометрии.
Изобретение относится к области медицины, а именно эндокринологии и гинекологии, и раскрывает способ диагностики ановуляции. Способ заключается в том, что определяют уровень тестостерона и мелатонина в крови и при величине тестостерона более 2,1 нмоль/л и мелатонина более 12 пг/мл диагностируют ановуляцию.

Представленные изобретения касаются варианта исходного антитела против TNF-α или исходного связывающего фрагмента антитела против TNF-α, молекулы нуклеиновой кислоты, клетки-хозяина, фармацевтической композиции и способа лечения.

Группа изобретений относится к медицине, а именно к иммунологии, и может быть использована для измерения активности клеточно-опосредованного иммунного ответа у субъекта.

Изобретение относится к области медицины, в частности к онкологии и молекулярной биологии, и может быть использовано для дифференциальной диагностики рака предстательной железы (РПЖ) и доброкачественной гиперплазии предстательной железы (ДГПЖ).

Изобретение относится к области медицины, в частности к акушерству, гинекологии, репродуктологии и иммунологии, и предназначено для прогнозирования результативности программы экстракорпорального оплодотворения (ЭКО).
Изобретение относится к медицине, в частности к акушерству и гинекологии, патологической анатомии, и может быть использовано врачами-акушерами-гинекологами, патологоанатомами для диагностики этиологического фактора хронического эндометрита и стадии воспалительного процесса.
Изобретение относится к медицине и может быть использовано в качестве способа прогнозирования задержки формирования плаценты и развития эмбриона при обострении цитомегаловирусной инфекции, подавляющей активность сосудисто-эндотелиального фактора и развитие эмбриона.

Изобретение относится к медицине, в частности к терапии, иммунологии, профпатологии, и может быть использовано для диагностики хронического необструктивного бронхита (ХНБ).

Изобретение относится к медицине, а именно к онкологии, и может быть использовано для прогнозирования риска озлокачествления узловых образований у больных с эндокринологическими заболеваниями.
Изобретение относится к медицине, а именно к кардиологии, и может быть использовано для прогнозирования уровня сердечно-лодыжечного сосудистого индекса у больных диабетом 2 типа в сочетании с артериальной гипертензией и ишемической болезнью сердца.

Настоящее изобретение относится к области иммунологии. Предложено антитело против альфа-энолазы (ENO1), а также его scFv- и Fab-фрагмент.

Изобретение относится к медицине и касается способа получения комплекса технеция-99м с модифицированными специфичными мини-антителами DARPin для диагностики онкологических заболеваний с гиперэкспрессией HER2/neu, включающего связывание технеция-99м с мини-антителами DARPin, где на первом этапе проводят модификацию мини-антител DARPin сукцинимид-1-ил 6-(бис(пиридин-2-илметил)амино)гексаноатом, очистку модифицированных мини-антител проводят гель-фильтрацией.

Изобретение относится к медицине, а именно к акушерству, и может быть использовано для диагностики присоединения преэклампсии у беременных женщин с хронической артериальной гипертензией в сроки гестации 24-37 недель.

Изобретение относится к области клинических диагностических приспособлений. Система кассеты для тестирования содержит кожух кассеты, включающий по меньшей мере одно впускное отверстие для образца, множество камер для хранения, множество камер для реакций и сеть для текучей среды, соединяющую по меньшей мере одно впускное отверстие для образца, по меньшей мере часть множества камер для хранения и по меньшей мере часть множества камер для реакций с первым множеством проходов, расположенных на внутренней поверхности кожуха кассеты.

Изобретение относится к области медицины и представляет собой способ прогнозирования риска развития сердечно-сосудистой патологии у особи женского пола, который включает: определение уровня про-нейротензина 1-117 в сыворотке крови, плазме крови или цельной крови, корреляцию уровня про-нейротензина 1-117 с риском развития сердечно-сосудистой патологии, где повышенный уровень является прогностическим для повышенного риска и где указанная сердечно-сосудистая патология представляет собой инфаркт миокарда, инсульт, острую сердечную недостаточность и смерть, связанную с инфарктом миокарда, инсультом или острой сердечной недостаточностью, и где уровень про-нейротензина 1-117 определен натощак.

Изобретение относится к медицине, а именно к педиатрии, и может быть использовано при обследовании и ведении детей с дистрофической формой буллезного эпидермолиза для своевременной диагностики пищевой аллергии. Комплексное обследование детей дополнительно включает аллергологическое обследование и определение концентрации sIgE в сыворотке крови к вероятным причинно-значимым аллергенам, проводят оценку наследственности по аллергическим болезням, проводят оценку диетологического анамнеза, включающую информацию о видах вскармливания, сроках введения продуктов и блюд прикорма с оценкой реакции на эти продукты, особенности питания матери во время беременности и лактации, особенности рациона питания ребенка, проводят оценку физического развития детей при помощи пакета прикладных программ ВОЗ, учитывая величины Z-scores: масса тела для возраста (WAZ), длина тела (рост) для возраста (HAZ), индекс массы тела для возраста (BAZ), и при наличии сенсибилизации к вероятно-значимым пищевым белкам и/или при наличии четкой причинно-следственной связи появления клинических проявлений пищевой аллергии с употреблением продукта/продуктов и при положительном эффекте от диагностической элиминационной диеты у пациента диагностируют пищевую аллергию и с учетом данных о наличии сенсибилизации формируют оптимальный рацион с элиминацией причинно-значимых белков. Изобретение позволяет своевременно диагностировать ПА у детей с дистрофической формой врожденного буллезного эпидермолиза и, соответственно, сформировать рацион с исключением необходимых причинно-значимых белков, способствующий снижению проявлений ПА и улучшению нутритивного статуса. 2 табл., 1 пр.

Изобретение касается способа in vitro контроля терапии у пациентов, у которых подозревают наличие сепсиса. Сущность способа: концентрацию зрелого адромедуллина 1-52 амида иили зрелого ADM 1-52-Gly в образце биологической жидкости указанного пациента с сепсисом определяют, используя иммунологический анализ с применением комбинации двух связующих, которые выбраны из группы, состоящей из антитела к ADM иили фрагмента антитела к ADM, и которые связывают две различные области в пределах области зрелого ADM 1-52 амида иили ADM 1-52-Gly, которая представляет собой аминокислотный 21-52-амид или аминокислотный 21-52-Gly соответственно. Каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот, при этом контролируют терапию путем сравнения определенной концентрации зрелого ADM 1-52 амида иили зрелого ADM 1-52-Gly с пороговым значением, где значения концентрации зрелого ADM 1-52 амида иили зрелого ADM 1-52-Gly выше порогового значения определяют пациента, который не поддается или плохо поддается терапии, а значения ниже порогового значения определяют пациента, который поддается терапии. Изобретение касается комбинации двух связующих для определения зрелого ADM 1-52 амида иили ADM 1-52-Gly в образце, которые связываются с двумя различными областями в пределах области зрелого ADM 1-52 амида иили ADM 1-52-Gly, которая представляет собой аминокислотный 21-52-амид или аминокислотный 21-52-Gly зрелого адромедуллина соответственно, где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот, и где иммунологический анализ не является сэндвич анализом, выполняемым вручную с трубкой, покрытой сложным эфиром акридиния. Также изобретение касается набора для определения зрелого ADM 1-52 амида иили ADM 1-52-Gly в образце, содержащего комбинацию двух указанных связующих. 4 н. и 21 з.п. ф-лы, 6 пр., 6 табл., 11 ил.

Наверх