Бензоимидазолы как ингибиторы пролилгидроксилазы



Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы
Бензоимидазолы как ингибиторы пролилгидроксилазы

 


Владельцы патента RU 2531354:

ЯНССЕН ФАРМАЦЕВТИКА НВ (BE)

Изобретение относится к области органической химии, а именно к производным бензоимидазола формулы (I), а также к их энантиомерам, диастереоизомерам, рацематам и фармацевтически приемлемым солям, где n равно от 2 до 4, каждый из заместителей R1 независимо выбирают из Н, галогена, -С1-4алкила, -С1-4пергалоалкила, трифтор-С1-4алкокси, -NO2, -CN, СО2Н, -ОС1-4алкила, -SC1-4алкила, -S(С1-4алкил)-Rc, -S(O)21-4алкил)-Rc, -S(О)-С1-4алкила, -SO21-4алкила, -S-Rc, -S(O)-Rc, -SO2-Rc, -SO2-NH-Rc, -O-Rc, -CH2-O-Rc, -С(O)NH-Rc, -NRaRb, бензилокси, фенила, необязательно замещенного одним-двумя Rd, цианобифенил-4-илметилсульфанила, цианобифенил-4-илметансульфонила, или -S-(СН2)2-морфолина и две смежные группы R1 могут соединяться с образованием ароматического 5-6-членного кольца, необязательно замещенного одной метильной группой или двумя атомами галогена, необязательно содержащего один или два S или N; Ra и Rb каждый независимо представляет собой Н, С1-4алкил, -C(O)C1-4алкил, -С(O)-Rc, -C(O)CH2-Re, C1-4алкил-Re, -SO2-Rc, -SO2-C1-4алкил, фенил, бензил; или же Ra и Rb вместе с атомом азота, с которым они соединены, образуют моноциклическое 5-6-членное гетероциклоалкильное кольцо, необязательно содержащее один гетероатом, выбранный из О; Rc представляет собой -C3-8циклоалкил, фенил, необязательно замещенный одним-двумя Rd, бензил, необязательно замещенный одним-тремя Rd; морфолин; Rd независимо представляет собой галоген, -OH, -C1-4алкил или -C1-4пергалогеналкил, трифтор C1-4алкокси, -OC1-4алкил, или -O-бензил, необязательно замещенный галогеном; Re представляет собой -C6гетероциклоалкил, необязательно содержащий один или два атомов O или N, необязательно замещенный метильной группой; R2 и R3 оба представляют собой H, -CF3 или C1-3алкил; каждый из Z представляет собой атом C или атом N, при условии что одновременно не более двух Z представляют собой N. Также изобретение относится к конкретным соединениям, фармацевтической композиции на основе соединения формулы (I) или конкретного указанного соединения, способу лечения заболеваний, опосредованных активностью пропилгидроксилазы. Технический результат: получены новые производные бензимидазола, обладающие ингибиторной активностью в отношении PHD. 6 н. и 5 з.п. ф-лы, 1 табл., 186 пр.

 

Область изобретения

Настоящее изобретение относится к определенным соединениям бензоимидазола, содержащим их фармацевтическим композициям и способам их применения для лечения заболеваний, расстройств и состояний, опосредованных активностью пролилгидроксилазы.

Предпосылки создания изобретения

Клетки отвечают на гипоксию активацией считывания информации генов, участвующих в выживании клетки, доставке и использовании кислорода, развитии кровеносных сосудов, клеточном метаболизме, регулировании кровяного давления, гематопоэзе и сохранении ткани. Факторы HIF (факторы, индуцируемые гипоксией) являются основными транскрипционными регуляторами этих генов (Semenza et al., 1992, Mol Cell Biol., 12(12):5447-54; Wang et al., 1993, J Biol Chem., 268(29):21513-18; Wang et al., 1993, Proc Natl Acad Sci., 90:4304-08; Wang et al., 1995, J Biol Chem., 270(3):1230-37). Описаны три формы HIF-α: HIF-1α, HIF-2α и HIF-3α (Scheuermann et al., 2007, Methods Enzymol., 435:3-24). Конъюгация субъединицы HIFα с HIF-1β образует функциональный гетеродимерный протеин, который, в свою очередь, вовлекает другие транскрипционные факторы, такие как p300 и CBP (Semenza, 2001, Trends Mol Med., 7(8):345-50).

Семейство высококонсервативных кислород-, железо- и 2-оксоглутарат-зависимых энзимов пролилгидроксилазы (PHD) являются промежуточным звеном реакции клеток на гипоксию посредством посттрансляционной модификации HIF (Ivan et al., 2001, Science, 292:464-68; Jaakkola et al., 2001, Science, 292:468-72). В условиях нормального снабжения кислородом PHD катализирует гидроксилирование двух консервативных групп пролина в HIF. Протеин фон Гиппеля-Линдау (VHL) избирательно связывается с гидроксилированным HIF. Связывание VHL превращает HIF в мишень для полиубиквитинилирования комплексом E3 убиквитин-лигазы и его последующего разложения протеосомой 26S (Ke et al., 2006, Mol Pharmacol. 70(5):1469-80; Semenza, Sci STKE., 2007, 407(cm8):1-3). Так как сродство PHD к кислороду находится в физиологическом диапазоне кислорода, а кислород является необходимым сопутствующим фактором реакции, PHD инактивируется при снижении давления кислорода. Таким образом, HIF быстро распадается при нормальных условиях снабжения кислородом, но аккумулируется в клетках при гипоксических условиях или ингибировании PHD.

Описаны четыре изотопа PHD: PHD1, PHD2, PHD3 и PHD4 (Epstein et al., 2001, Cell, 107:43-54; Kaelin, 2005, Annu Rev Biochem., 74:115-28; Schmid et al., 2004, J Cell Mol Med., 8:423-31). Различные изотопы находятся повсюду, но регулируются различным образом и играют особые физиологические роли в реакции клеток на гипоксию. Очевидно, что эти различные изотопы имеют разную селективность по отношению к трем разным подтипам HIF (Epstein et al., см. выше). С точки зрения внутриклеточной локализации, PHD1 относится, главным образом, к ядру, PHD2 - к цитоплазме, а PHD3, по-видимому, относится как к ядру, так и к цитоплазме (Metzen E, et al. 2003, J Cell Sci., 116(7):1319-26). PHD2, по-видимому, является доминирующей HIFα пролилгидроксилазой при нормальных условиях снабжения кислородом (Ivan et al., 2002. Proc Natl Acad Sci. USA, 99(21):13459-64; Berra et al., 2003, EMBO J., 22:4082-90). Три изотопа имеют высокую степень аминокислотной гомологии, а активный центр энзима является высококонсервативным.

Продукты целевого для HIF гена участвуют в ряде физиологических и патофизиологических процессов, включая, помимо прочего, следующие: эритро(цито)поэз, развитие кровеносных сосудов, регулирование энергетического обмена, вазомоторная деятельность и апоптоз/разрастание клеток. Первым описанным как целевой для HIF геном был ген, кодирующий эритропоэтин (ЭПО) (Wang et al., 1993, см. выше). Было показано, что снижение кислородопереносной функции крови воспринимается почками и что почки и печень отвечают на это выработкой большего количества ЭПО - гормона, который стимулирует разрастание и созревание эритроцитов. ЭПО оказывает разностороннее воздействие на некроветворные типы клеток и выступает в роли основного органопротективного цитокина (Arcasoy, 2008, Br J Haematol., 141:14-31). Следовательно, ЭПО участвует в процессах заживления ран и развития кровеносных сосудов, а также в реакции тканей на ишемический инсульт. Большинство энзимов, вовлеченных в анаэробный гликолиз, кодированы целевыми генами HIF, в результате чего гликолиз усиливается в гипоксических тканях (Shaw, 2006, Curr Opin Cell Biol., 18(6):598-608). Известные продукты целевого для HIF гена в этом пути метаболизма включают, помимо прочего, следующие: переносчики глюкозы, такие как GLUT-1 (Ebert et al., 1995, J Biol Chem., 270(49):29083-89), энзимы, участвующие в превращении глюкозы в пируват, такие как гексокиназа и фосфоглицераткиназа 1 (Firth et al., 1994, Proc Natl Acad Sci. USA, 91:6496-6500), а также лактатдегидрогеназа (Firth et al., см. выше). Продукты целевого гена HIF также участвуют в регулировании клеточного метаболизма. Например, киназа пируватдегидрогеназы-1 является продуктом целевого гена HIF и регулирует поступление пирувата в Цикл Кребса, снижая активность пируватдегидрогеназы путем фосфорилирования (Kim et al., 2006, Cell Metab., 3:177-85; Papandreou et al., 2006, Cell Metab., 3:187-197). Продукты целевого гена HIF также участвуют в процессе развития кровеносных сосудов. Например, сосудистый эндотелиальный фактор роста (VEGF) (Liu et al., 1995, Circ Res., 77(3):638-43) - это известный регулятор процесса развития кровеносных сосудов, а также образования и развития сосудов (васкулогенез). Продукты целевого гена HIF также выполняют определенные функции в регулировании сосудистого тонуса и включают гемоксигеназу-1 (Lee et al., 1997, J Biol Chem., 272(9):5375-81). Ряд регулируемых HIF генных продуктов, таких как тромбоцитарный (PDGF) (Yoshida et al., 2006, J Neurooncol., 76(1):13-21), сосудистый эндотелиальный фактор роста (Breen, 2007, J Cell Biochem., 102(6):1358-67) и ЭПО (Arcasoy, см. выше), также участвуют в согласованной реакции при заживлении раны.

Намеченное нарушение активности энзима пролилгидроксилазы (PHD) с помощью маленьких молекул потенциально полезно для лечения расстройств восприятия и распределения кислорода. Примеры включают, помимо прочего, следующее: анемию; менискоцитарную анемию; болезнь периферических сосудов; ишемическую болезнь сердца; сердечную недостаточность; защиту тканей от ишемии в таких условиях, как ишемия миокарда, инфаркт миокарда и инсульт; консервацию органов для трансплантации; лечение ишемии тканей посредством регулирования и (или) восстановления тока крови, доставки кислорода и (или) использования энергии; ускорение процесса заживления ран, в частности, у пожилых пациентов и пациентов, страдающих диабетом; лечение ожогов; лечение инфекционных заболеваний; срастание переломов и рост костей. Кроме того, предполагается, что намеченное нарушение PHD будет полезно для лечения таких нарушений обмена веществ, как диабет, ожирение, неспецифический язвенный колит, воспалительное заболевание кишечника, и родственных заболеваний, таких как болезнь Крона. (Recent Patents on Inflammation & Allergy Drug Discovery, 2009, 3, 1-16).

Показано, что HIF является основным транскрипционным фактором, который приводит к повышению продуцирования эритропоэтина в условиях гипоксии (Wang et al., 1993, см. выше). Несмотря на то, что применение рекомбинантного человеческого эритропоэтина показало себя эффективным при лечении анемии, можно ожидать, что ингибирование PHD малыми молекулами будет иметь некоторые преимущества в сравнении с лечением эритропоэтином. В частности, функция других продуктов гена HIF необходима для гемопоэза, а регулирование этих факторов повышает эффективность гемопоэза. Примеры продуктов целевого гена HIF, критичных для гемопоэза, включают: трансферрин (Rolfs et al., 1997, J Biol Chem., 272(32):20055-62), трансферриновый рецептор (Lok et al., 1999, J Biol Chem., 274(34):24147-52; Tacchini et al., 1999, J Biol Chem., 274(34):24142-46) и церулоплазмин (Mukhopadhyay et al., 2000, J Biol Chem., 275(28):21048-54). Экспрессия гепсидина также подавляется HIF (Peyssonnaux et al., 2007, J Clin Invest., 117(7):1926-32), а ингибиторы PHD с малыми молекулами, как было показано, уменьшают выработку гепсидина (Braliou et al., 2008, J Hepatol., 48:801-10). Гепсидин является отрицательным фактором регулирования доступности железа, необходимого для гемопоэза, поэтому ожидается, что уменьшение выработки гепсидина будет благотворно сказываться на лечении анемии. Ингибирование PHD также может быть полезным в сочетании с другим лечением анемии, включая пополнение железа и (или) экзогенный эритропоэтин. Исследования естественных мутаций гена PHD2 у человеческой популяции дают еще одно основание для использования ингибиторов PHD при лечении анемии. В двух последних работах показано, что у пациентов с дисфункциональными мутациями в гене PHD2 наблюдается повышенный эритроцитоз и повышенный уровень гемоглобина в крови (Percy et al., 2007, PNAS, 103(3):654-59; Al-Sheikh et al., 2008, Blood Cells Mol Dis., 40:160-65). Кроме того, ингибитор PHD с малым размером молекулы был испытан на здоровых добровольцах и на пациентах с хроническими заболеваниями почек (Патентная заявка США US2006/0276477, 7 декабря 2006 г.). Содержание эритропоэтина в плазме увеличивалось в зависимости от дозы, а у пациентов с хроническими заболеваниями почек повышалось содержание гемоглобина в крови.

Ишемия представляет опасность для метаболической адаптации и защиты тканей. Ингибиторы PHD повышают экспрессию генов, что приводит к изменениям в процессе обмена веществ, благотворным в ишемических условиях (Semenza, 2007, Biochem J., 405:1-9). Многие из кодируемых генами энзимов, участвующих в анаэробном гликолизе, регулируются HIF, и гликолиз увеличивается путем ингибирования PHD (Shaw, см. выше). Известные целевые гены HIF на этом пути метаболизма включают, помимо прочего, следующие: GLUT-1 (Ebert et al., см. выше), гексокиназу, фосфоглицераткиназу 1, лактатдегидрогеназу (Firth et al., см. выше), киназу пируватдегидрогеназы-1 (Kim et al., см. выше; Papandreou et al., см. выше). Киназа пируватдегидрогеназы-1 подавляет вхождение пируватов в цикл Кребса. HIF выступает в роли посредника в переключении экспрессии цитохромов, участвующих в процессе переноса электрона в митохондрии (Fukuda et al., 2007, Cell, 129(1):111-22). Это изменение строения цитохрома оптимизирует эффективность производства АТФ (аденозинтрифосфат) в условиях гипоксии и снижает производство таких вредных побочных продуктов окислительного фосфорилирования, как перекись водорода и надперекиси. При продолжительном воздействии гипоксии HIF стимулирует аутофагию митохондрий, в результате чего их количество уменьшается (Zhang H et al., 2008, J Biol Chem. 283: 10892-10903). Эта адаптация к хронической гипоксии снижает производство перекиси водорода и надперекиси, тогда как производство энергии клеткой основывается на гликолизе. Еще одна адаптивная реакция, вызванная повышением HIF, заключается в активации факторов выживаемости клеток. К этим факторам относятся следующие: инсулиноподобный фактор роста (IGF) 2, белки, связывающие IGF 2 и 3 (Feldser et al., 1999, Cancer Res. 59:3915-18). Общее аккумулирование HIF в условиях гипоксии управляет адаптивной активацией гликолиза, снижением окислительного фосфорилирования, что приводит к уменьшению производства перекиси водорода и надперекиси, оптимизации окислительного фосфорилирования, защищая клетки от ишемического поражения. Таким образом, предполагается, что ингибиторы PHD будут полезны для консервации органов и тканей для трансплантации (Bernhardt et al., 2007, Methods Enzymol., 435:221-45). Несмотря на то что положительный эффект может быть получен путем назначения ингибиторов PHD до забора органов для трансплантации, введение ингибитора в орган или ткань после забора, при хранении (например, кардиоплегический раствор) или после трансплантации, может также иметь терапевтический эффект.

Предполагается, что ингибиторы PHD будут эффективны для защиты тканей от распространенной ишемии и (или) гипоксии. В том числе от ишемии или гипоксии, связанных, помимо прочего, со следующим: ангиной, ишемией миокарда, инсультом, ишемией скелетной мышцы. Существует целый ряд экспериментальных доказательств того, что ингибирование PHD и последующее повышение HIF является целесообразным способом консервации ишемической ткани. Недавно было показано, что ишемическое прекондиционирование - это явление, зависящее от HIF (Cai et al., 2008, Cardiovasc Res., 77(3):463-70). Ишемическое прекондиционирование - это известное явление, в соответствии с которым короткие периоды гипоксии и (или) ишемии защищают ткань от последующих более продолжительных периодов ишемии (Murry et al., 1986, Circulation, 1986 74(5):1124-36; Das et al., 2008, IUBMB Life, 60(4):199-203). Известно, что ишемическое прекондиционирование наблюдается у людей, а также у экспериментальных животных (Darling et al., 2007, Basic Res Cardiol., 102(3):274-8; Kojima I et al., 2007, J Am Soc Nephrol., 18:1218-26). Несмотря на то, что концепция прекондиционирования более всего известна благодаря своим защитным воздействиям в сердце, она также применимо и к другим тканям, включая, помимо прочего, следующие: печень, скелетную мышцу, легкое, почку, кишечник и мозг (Pasupathy et al., 2005, Eur J Vasc Endovasc Surg., 29:106-15; Mallick et al., 2004, Dig Dis Sci., 49(9):1359-77). Экспериментальное подтверждение тканепротективных эффектов ингибирования PHD и повышения HIF получено на ряде животных моделей, включая: нокаутирование зародышевой линии PHD1, которая обеспечивала защиту скелетной мышцы от ишемического инсульта (Aragonés et al., 2008, Nat Genet., 40(2):170-80), выключение PHD2 путем применения siRNA (короткая интерферирующая РНК), которая защищала сердце от ишемического инсульта (Natarajan et al., 2006, Circ Res., 98(1):133-40), ингибирование PHD путем введения окиси углерода, которая защищала миокард от ишемического поражения (Chin et al., 2007, Proc Natl Acad Sci. U.S.A., 104(12):5109-14), гипоксию в мозге, которая повышала устойчивость к ишемии (Bernaudin et al., 2002, J Cereb Blood Flow Metab., 22(4):393-403). Кроме того, ингибиторы PHD с малым размером молекулы защищают мозг в экспериментальных моделях инсульта (Siddiq et al., 2005, J Biol Chem., 280(50):41732-43). Более того, было показано, что активация HIF защищает сердце мыши, страдающей диабетом, где последствия обычно хуже (Natarajan et al., 2008, J Cardiovasc Pharmacol., 51(2):178-187). Тканепротективные эффекты можно также наблюдать при облитерирующем тромбангиите (болезнь Бюргера), симметричной гангрене (болезнь Рейно) и акроцианозе.

Пониженная зависимость от аэробного метаболизма с помощью цикла Кребса в митохондрии и повышенная зависимость от анаэробного гликолиза, вызванного ингибированием PHD, может оказывать благоприятное влияние на ткани с нормальным снабжением кислородом. Важно отметить, что ингибирование PHD, как было показано, повышает HIF в условиях нормального снабжения кислородом. Таким образом, ингибирование PHD вызывает псевдогипоксию, обусловленную гипоксическим откликом, инициированным через HIF, но насыщение тканей кислородом остается нормальным. Можно также ожидать, что перестройка метаболизма, вызванная ингибированием PHD, позволит реализовать способ лечения диабета, ожирения и связанных с ними расстройств, включая сопутствующие заболевания.

В целом, совокупность изменений экспрессии гена, вызванных ингибированием PHD, снижает количество энергии, производимой на единицу глюкозы, и будет стимулировать организм на сжигание большего количества жира для поддержания энергетического баланса. Механизмы интенсификации гликолиза рассматриваются выше. Другие исследования связывают гипоксический отклик с теми эффектами, которые, как ожидается, являются благотворными при лечении диабета и ожирения. Так, хорошо известно, что для уменьшения количества жира в организме применяются тренировки в условиях высокогорья (Armellini et al., 1997, Horm Metab Res., 29(9):458-61). Показано, что гипоксия и имитирующие гипоксию вещества, такие как десферриоксамин, предотвращают выделение адипоцита (Lin et al., 2006, J Biol Chem., 281(41):30678-83; Carrière et al., 2004, J Biol Chem., 279(39):40462-69). Этот эффект является обратимым по возвращении к нормальным условиям снабжения кислородом. Ингибирование активности PHD на начальных стадиях липогенеза подавляет образование новых адипоцитов (Floyd et al., 2007, J Cell Biochem., 101:1545-57). Гипоксия, хлорид кобальта и десферриоксамин повышают HIF и ингибируют транскрипцию ядерных гамма 2-PPAR (рецепторы, активирующие пролиферацию пероксисом) рецепторов гормона (Yun et al., 2002, Dev Cell., 2:331-41). Так как гамма 2-PPAR - это важный сигнал для выделения адипоцита, то следует ожидать, что ингибирование PHD будет подавлять выделение адипоцита. Было показано, что эти эффекты должны иметь место при участии HIF-регулируемого гена DEC1/Stra13 (Yun et al., см. выше).

Ингибиторы PHD с малым размером молекулы демонстрируют лечебное воздействие в животных моделях диабета и ожирения (Международная патентная заявка WO2004/052284, 24 июня 2004 г.; WO2004/052285, 24 июня 2004 г.). Эффекты, показанные для ингибиторов PHD на мышах с алиментарным ожирением, мышах db/db и крысах линии Zucker fa/fa, включали понижение следующего: концентрации глюкозы в крови, массы жира как в абдоминальном, так и в висцеральном скоплении жировой ткани, гемоглобина A1c, триглицеридов плазмы, массы тела, а также изменения биомаркеров установленного заболевания, таких как повышение уровней адреномедуллина и лептина. Лептин известен как продукт целевого гена HIF (Grosfeld et al., 2002, J Biol Chem., 277(45):42953-57). Продукты генов, участвующие в метаболизме жировых клеток, как было показано, должны регулироваться ингибированием PHD в зависимости от HIF (Международная патентная заявка WO2004/052285, см. выше). К таким продуктам относятся: аполипопротеин A-IV, ацил CoA тиоэстераза, карнитин ацетил трансфераза и инсулиноподобный фактор роста связывающего белка (IGFBP)-1.

Предполагается, что ингибиторы PHD должны быть терапевтически эффективны как стимуляторы васкулогенеза, развития кровеносных сосудов и артериогенеза. Эти процессы создают или восстанавливают ток крови к тканям и их насыщение кислородом в условиях ишемии и (или) гипоксии (Semenza et al., 2007, J Cell Biochem., 102:840-47; Semenza, 2007, Exp Physiol., 92(6):988-91). Было показано, что физические упражнения повышают HIF-1 и сосудистый эндотелиальный фактор роста в экспериментальных животных моделях и у людей (Gustafsson et al. 2001, Front Biosci., 6:D75-89) и, соответственно, количество кровеносных сосудов в скелетной мышце. VEGF (фактор роста васкулярного эндотелия) - хорошо известный продукт целевого гена HIF, являющимся основным фактором развития кровеносных сосудов (Liu et al., supra). Несмотря на то, что назначение различных форм активаторов рецептора VEGF является сильнодействующим стимулом для развития кровеносных сосудов, кровеносные сосуды, появляющиеся в результате этого потенциального способа лечения, являются неплотными. Считается, что это ограничивает возможность использования VEGF для лечения расстройств доставки кислорода. Повышенная экспрессия одного ангиогенного фактора может быть недостаточной для функциональной васкуляризации (новообразование кровеносных сосудов) (Semenza, 2007, см. выше). Потенциальные преимущества ингибирования PHD в сравнении с другими подобными способами ангиогенной терапии состоят в том, что это стимулирует контролируемую экспрессию множества ангиогенных факторов роста в зависимости от HIF, включая, помимо прочего, следующие: плацентный фактор роста (PLGF), ангиопоэтин-1 (ANGPT1), ангиопоэтин-2 (ANGPT2), бета-фактор роста тромбоцитарный (PDGFB) (Carmeliet, 2004, J Intern Med., 255:538-61; Kelly et al., 2003, Circ Res., 93:1074-81) и фактор роста стромальных клеток-1 (SDF-1) (Ceradini et al., 2004, Nat Med., 10(8):858-64). Экспрессия ангиопоэтина-1 в процессе развития кровеносных сосудов приводит к образованию плотных кровеносных сосудов, в отличие от кровеносных сосудов, образующихся при назначении только VEGF (Thurston et al., 1999, Science, 286:2511-14; Thurston et al., 2000, Nat Med., 6(4):460-3; Elson et al., 2001, Genes Dev., 15(19):2520-32). Было показано, что фактор роста стромальных клеток 1 (SDF-1) чрезвычайно важен для процесса притока предшественников эндотелиальных клеток к местам повреждения ткани. Экспрессия SDF-1 повышает адгезию, миграцию и хоминг циркулирующих CXCR4-позитивных клеток-предшественников к ишемической ткани. Более того, ингибирование SDF-1 в ишемической ткани или блокада CXCR4 на клетках, циркулирующих в периферической крови, предотвращает привлечение клеток-предшественников к местам повреждения (Ceradini et al., 2004, см. выше; Ceradini et al., 2005, Trends Cardiovasc Med., 15(2):57-63). Важно, что привлечение предшественников эндотелиальных клеток к местам повреждения у взрослых мышей снижается, и это компенсируется вмешательствами, которые повышают HIF на месте раны (Chang et al., 2007, Circulation, 116(24):2818-29). Ингибирование PHD дает преимущества не только за счет увеличения экспрессии ряда ангиогенных факторов, но также за счет координации их экспрессии в течение всего процесса развития кровеносных сосудов и привлечения предшественников эндотелиальных клеток к ишемической ткани.

Доказательство применимости ингибиторов PHD в проангиогенной терапии представлено в следующих исследованиях. Сверхсинтез HIF при участии аденовируса, как было показано, вызывает развитие кровеносных сосудов в неишемической ткани взрослого животного (Kelly et al., 2003, Circ Res., 93(11):1074-81) и свидетельствует о том, что лечение, повышающее HIF, например ингибирование PHD, будет вызывать развитие кровеносных сосудов. Было показано, что плацентный фактор роста (PLGF), также целевой ген HIF, играет важную роль в развитии кровеносных сосудов в ишемической ткани (Carmeliet, 2004, J Intern Med., 255(5):538-61; Luttun et al., 2002, Ann N Y Acad Sci., 979:80-93). Были продемонстрированы действенные проангиогенные эффекты лечения, которое повышает HIF, посредством сверхсинтеза HIF, в скелетной мышце (Pajusola et al., 2005, FASEB J., 19(10):1365-7; Vincent et al., 2000, Circulation, 102:2255-61) и в миокарде (Shyu et al., 2002, Cardiovasc Res., 54:576-83). Было также показано привлечение предшественников эндотелиальных клеток к ишемическому миокарду целевым геном HIF SDF-1 (Abbott et al., 2004, Circulation, 110(21):3300-05). Эти результаты подтверждают общую концепцию, суть которой состоит в том, что ингибиторы PHD будут эффективными для стимулирования развития кровеносных сосудов в регулировании ишемии тканей, в частности ишемии мышц. Предполагается, что терапевтическое развитие кровеносных сосудов, вызванное ингибиторами PHD, будет полезно для восстановления тока крови к тканям и, следовательно, для лечения заболеваний, включая, помимо прочего, следующие: стенокардию, ишемию и инфаркт миокарда, периферическую ишемическую болезнь, перемежающуюся хромоту, язву желудка и двенадцатиперстной кишки, неспецифический язвенный колит и воспалительное заболевание кишечника.

PHD и HIF играют главную роль в заживлении и регенерации тканей, в том числе в заживлении ран и язв. Последние исследования показали повышенную экспрессию всех трех PHD на местах ран у взрослых мышей и, как результат, уменьшение аккумулирования HIF (Chang et al., supra). Таким образом, повышение HIF у взрослых мышей путем назначения десферриоксамина повышает степень залечивания ран до уровня, наблюдаемого у молодых мышей. Аналогично, у мышей, страдающих диабетом, повышение HIF было ослаблено в сравнении с мышами того же помета без диабета (Mace et al., 2007, Wound Repair Regen., 15(5):636-45). Местное применение хлорида кобальта, имитатора гипоксии или сверхсинтез мышиного HIF, который ограничивает область разложения, зависящего от кислорода, и, таким образом, обеспечивает постоянно активную форму HIF, приводит к повышению HIF на месте раны, повышению экспрессии целевых генов HIF, таких как VEGF, Nos2 и Hmox1, и к ускорению заживления раны. Недавно было показано, что благоприятный эффект ингибирования PHD не ограничивается кожей и что ингибиторы PHD с малым размером молекулы дают положительный результат на моделях мышей с колитом (Robinson et al., 2008, Gastroenterology, 134(1):145-55).

Предполагается, что ингибирование PHD, приводящее к аккумулированию HIF, имеет по меньшей мере четыре механизма действия, каждый из которых вносит свой вклад в ускоренное и более полное заживление ран и язв: 1) защита ткани, подверженной опасности гипоксии и (или) ишемии, 2) стимулирование развития кровеносных сосудов для создания или восстановления надлежащего тока крови к месту поражения, 3) привлечение предшественников эндотелиальных клеток к местам поражения, 4) стимулирование выработки тех факторов роста, которые специфически стимулируют заживление и регенерацию.

Рекомбинантный человеческий фактор роста тромбоцитарный (PDGF) присутствует на рынке в виде бекаплермина (торговое название Regranex™) и одобрен Управлением по санитарному надзору за качеством пищевых продуктов и медикаментов США для «Лечения диабетических невропатических язв нижних конечностей, которые выходят в подкожную основу или далее и снабжаются кровью в достаточной степени». Было показано, что бекаплермин эффективно ускоряет заживление ран у пациентов, страдающих диабетом (Steed, 2006, Plast Reconstr Surg., 117(7 Suppl):143S-149S; Nagai et al., 2002, Expert Opin Biol Ther., 2(2):211-8). Так как PDGF является целевым геном HIF (Schultz et al., 2006, Am J Physiol Heart Circ Physiol., 290(6):H2528-34; Yoshida et al., 2006, J Neurooncol., 76(1):13-21), то предполагается, что ингибирование PHD повысит выработку эндогенного PDGF и будет оказывать аналогичный или более благоприятный эффект на те, которые вырабатываются только с бекаплермином. Исследования на животных показали, что местное применение PDGF приводит к повышению количества ДНК, протеина и гидроксипролина, формированию более толстого слоя грануляционной и эпидермальной ткани, повышенному клеточному вторичному заселению мест повреждения. PDGF приводит в действие локальный эффект интенсификации образования новой соединительной ткани. Предполагается, что эффективность ингибирования PHD будет выше, чем эффективность ингибирования, вызванная бекаплермином из-за дополнительного тканепротективного и проангиогенного эффектов, опосредованных HIF.

Ожидается, что благоприятное воздействие ингибирования PHD распространится не только на ускорение заживления раны в коже и толстой кишке, но также на заживление других повреждений ткани, включая, помимо прочего, следующее: желудочно-кишечные язвы, реплантации трансплантата, ожоги, хронические язвы и обморожение.

Стволовые клетки и клетки-предшественники обнаружены в гипоксических нишах внутри тела, и гипоксия регулирует их дифференциацию и метаболический путь клетки (Simon et al., 2008, Nat Rev Mol Cell Biol., 9:285-96). Таким образом, ингибиторы PHD могут быть пригодны для поддержания стволовых клеток и клеток-предшественников в плюрипотентном состоянии и стимулирования дифференциации в направлении желательного типа клеток. Стволовые клетки могут быть полезны для культивирования и роста популяций стволовых клеток и могут удерживать клетки в плюрипотентном состоянии, в то время как гормоны и другие факторы вводятся в клетки для того, чтобы повлиять на дифференциацию и метаболический путь клетки.

Дальнейшее использование ингибиторов PHD в области лечения стволовыми клетками и клетками-предшественниками связано с использованием ингибиторов PHD для кондиционирования этих клеток, с тем чтобы они выдерживали процесс имплантации в организм и с тем чтобы генерировать соответствующий отклик организма, в результате чего имплантация стволовой клетки и клетки-предшественника станет практически осуществимой (Hu et al., 2008, J Thorac Cardiovasc Surg., 135(4):799-808). Точнее говоря, ингибиторы PHD могут способствовать интеграции стволовых клеток и привлечению соответствующего кровотока для поддержки стволовых клеток после их встраивания. Это образование кровеносного сосуда будет также выполнять функцию переноса гормонов и других факторов, высвобожденных этими клетками для остального организма.

Ингибиторы PHD также могут быть полезны при лечении инфекции (Peyssonnaux et al., 2005, J Invest Dermatol., 115(7):1806-15; Peyssonnaux et al., 2008 J Invest Dermatol., август 2008 г.; 128(8):1964-8). Было показано, что повышение HIF усиливает врожденную иммунную реакцию на инфекцию в фагоцитах и кератиноцитах. Фагоциты с увеличенным HIF демонстрируют повышенную бактерицидную активность, повышенное выделение окиси азота и повышенное производство антибактериального пептида кателицидин. Эти эффекты могут быть также полезны для лечения ожоговых инфекций.

Было также показано, что HIF участвует в процессе роста кости и срастания перелома (Pfander D et al., 2003 J Cell Sci., 116(Pt 9):1819-26., Wang et al., 2007 J Clin Invest., 17(6):1616-26.) и, следовательно, может использоваться для лечения или профилактики переломов. HIF стимулирует гликолиз, обеспечивающий энергией синтез внеклеточного матрикса эпифизарных хондроцитов в условиях гипоксии. HIF также играет важную роль в стимуляции выделения VEGF и развитии кровеносных сосудов в процессе срастания перелома. Рост кровеносных сосудов в растущую или срастающуюся кость может быть фактором, ограничивающим скорость процесса.

В литературе описаны некоторые молекулы малого размера c антагонистической активностью в отношении пролилгидроксилазы. К таким молекулам относятся помимо прочих некоторые имидазо[1,2-a]пиридин производные (Warshakoon et al., 2006, Bioorg Med Chem Lett., 16(21):5598-601), замещенные пиридин-производные (Warshakoon et al., 2006, Bioorg Med Chem Lett., 16(21):5616-20), некоторые пиразолопиридины (Warshakoon et al., 2006, Bioorg Med Chem Lett., 16(21):5687-90), некоторые бициклические гетероароматические N-замещенные производные глицина (Международная патентная заявка WO2007/103905, 13 сентября 2007 г.), соединения на основе хинолина (Международная патентная заявка WO2007/070359, 21 июня 2007 г.), некоторые барбитурат-N-замещенные производные глицина (Международная патентная заявка WO2007/150011, 27 декабря 2007 г.) и замещенные арил- и гетероарил-амидные (США, патентная заявка № US 2007/0299086, 27 декабря 2007 г.).

Некоторые производные бензоимидазола описаны в литературе. Например, LeCount et al., Journal of the Chemical Society, Perkin Transactions 1: Organic and Bio-Organic Chemistry (1972-1999) (1974), (2):297-301, Senga et al., Journal of Heterocyclic Chemistry (1975), 12(5):899-901, Kandeel et al., Polish Journal of Chemistry (1983), 57(1-3), 327-31, Povstyanoi et al., Ukrainskii Khimicheskii Zhurnal (Russian Edition) (1990), 56(10):1089-92, Singh et al., Indian Journal of Chemistry, Section B: Organic Chemistry Including Medicinal Chemistry, (1993) 32B(2):262-5, Lipunova et al., Mendeleev Communications (1996), (1):15-17, Lipunova et al., Russian Journal of Organic Chemistry (Translation of Zhurnal Organicheskoi, Khimii) (1997), 33(10):1476-86, бензоимидазол-пиразолы как промежуточные соединения для ингибиторов NHE-1 (WO9943663), N-гетероарилимидазолы как лекарственные препараты, действующие на психику (DE3824658). Кроме этого, 1-(1H-бензоимидазол-2-ил)-5-метил-1H-пиразол-4-карбоновая кислота (CAS № 1017666-26-0), этиловый эфир 1-(1H-бензоимидазол-2-ил)-5-гидрокси-1H-пиразол-4-карбоновой кислоты (CAS № 1006582-96-2), 1-(1H-бензоимидазол-2-ил-5-пиррол-1-ил-1H-пиразол-4-карбоновая кислота (CAS № 1017666-37-3) и 1-(1H-бензоимидазол-2-ил)-5-(2,5-диметилпиррол-1-ил)-1H-пиразол-4-карбоновая кислота (CAS № 1017666-50-0) имеются на рынке.

Тем не менее, до сих пор остается необходимость в сильнодействующих модуляторах пролилгидроксилазы с желательными фармацевтическими свойствами. Несмотря на изложенное выше, настоящее изобретение имеет целью новые производные бензоимидазола, пригодные для этой цели.

Краткое описание изобретения

Целью настоящего изобретения, в общем, являются соединения, представляющие собой ингибиторы PHD формулы (I),

где

n равно от 2 до 4

R1 независимо выбран из H, галогена, -C1-4алкила, -C3-8циклоалкил-C1-4пергалоалкила, трифтор-C1-4алкокси -OH, -NO2, -CN, CO2H, -OC1-4алкила, -SC1-4алкила, -S(C1-4алкил)-Rc, -S(O)2(C1-4алкил)-Rc, -S(O)-C1-4алкила, -SO2-C1-4алкила, -S-Rc, -S(O)-Rc, -SO2-Rc, -SO2-NH-Rd, -O-Rc, -CH2-O-Rc, -C(O)NH-Rc, -NRaRb, бензилокси, необязательно замещенного Rd, фенила или моноциклического гетероарила, необязательно замещенного Rd, -C3-8циклоалкила, необязательно содержащего O, S или N, причем упомянутый -C3-8циклоалкил необязательно замещен Rd, и две смежные R1 группы могут соединяться с образованием необязательно замещенного 3-8-членного кольца, необязательно содержащего один или несколько атомов O, S или N;

Ra и Rb каждый независимо представляет собой H, C1-4алкил, -C(O)C1-4алкил, -C(O)-Rc, -C(O)CH2-Re, C1-4алкил-Re, -SO2-Rc, -SO2-C1-4алкил, фенил, необязательно замещенный Rd, бензил, необязательно замещенный Rd, или моноциклическое гетероарильное кольцо, необязательно замещенное Rd; или же Ra и Rb вместе с атомом азота, с которым они соединены, могут образовывать необязательно замещенное моноциклическое гетероциклоалкильное кольцо, необязательно содержащее один или более атомов O, S или N;

Rc представляет собой -C3-8циклоалкил, фенил, необязательно замещенный Rd, бензил, необязательно замещенный Rd, или моноциклическое гетероарильное кольцо, необязательно замещенное Rd;

Rd независимо представляет собой -H, галоген, -OH, -C1-4алкил или -C1-4пергалогеналкил, трифтор C1-4алкокси, -OC1-4алкил, -O-фенил или -O-бензил;

Re представляет собой -C3-8гетероциклоалкил, необязательно содержащий один или более атомов O, S или N;

R2 и R3 оба представляют собой H, -CF3, или -CH3; и

каждый из Z представляет собой атом C или N, при условии, что не более чем два Z одновременно могут быть N; и

энантомеры, диастереомеры, рацематы этих соединений, или фармацевтически приемлемые соли этих соединений.

Настоящее изобретение включает изомерные формы соединений формулы (I) и их фармацевтически приемлемые соли, и ссылка здесь на одну из таких изомерных форм означает ссылку по меньшей мере на одну из таких изомерных форм. Специалист в данной области признает, что соединения в соответствии с данным изобретением могут существовать, например, в единственной изомерной форме, в то время как другие соединения могут существовать в форме региоизомерной смеси.

Настоящее изобретение также относится к фармацевтически приемлемым солям, фармацевтически приемлемым пролекарствам и фармацевтически активным метаболитам соединений формулы (I). В определенных предпочтительных вариантах осуществления соединение формулы (I) представляет собой соединение, выбираемое из разновидностей, описанных или проиллюстрированных в приведенном ниже подробном описании.

В следующем общем аспекте изобретение относится к лекарственным препаратам, каждый из которых включает: (a) эффективное количество соединения формулы (I) или фармацевтически приемлемую соль, фармацевтически приемлемое пролекарство или его фармацевтически активный метаболит; и (b) фармацевтически приемлемый наполнитель.

В другом общем аспекте изобретение направлено на способ лечения субъекта с имеющимся или диагностированным заболеванием, расстройством, или нарушением здоровья, обусловленными активностью энзима пролилгидроксилазы. Способ состоит в назначении пациенту, нуждающемуся в таком лечении, эффективного количества соединения формулы (I) или фармацевтически приемлемой соли, фармацевтически приемлемого пролекарства или его фармацевтически активного метаболита.

В определенных предпочтительных вариантах применения способа изобретения, заболевание, расстройство или нарушение здоровья выбирается из следующего: анемия, сосудистые расстройства, нарушения обмена веществ и заживление раны.

Дополнительные варианты реализации, особенности и достоинства изобретения будут очевидны из следующего подробного описания и практического осуществления изобретения.

Подробное описание

Настоящее изобретение может быть более полно оценено из нижеследующего описания, включающего глоссарий терминов и заключительные примеры. Для краткости цитируемые публикации, включая патенты, включены в настоящее описание посредством ссылки.

Термины «включающий», «содержащий», «состоящий из» используются в настоящем документе в их открытом, неограниченном значении.

Термин «алкил» относится к алкильной группе с прямой или разветвленной цепью, содержащей от 1 до 12 атомов углерода. Примеры алкильных групп включают метил (Me, который также может быть структурно обозначен символом, «/»), этил (Et), н-пропил, изопропил, бутил, изобутил, втор-бутил, трет-бутил (tBu), фенил, изофенил, трет-фенил, гексил, изогексил, и группы, которые в свете общепринятых знаний и учений, представленных здесь, будут считаться эквивалентными одному из вышеприведенных примеров.

Термин «пергалоалкил» относится к алкильной группе с прямой или разветвленной цепью, имеющей от 1 до 12 атомов в цепочке и атомы водорода, необязательно замещенные на атомы галогенов. Примеры пергалоалкильных групп включают трифторметил (CF3), дифторметил (CF2H), монофторметил (CH2F), пентафторэтил (CF2CF3), тетрафторэтил (CHFCF3), трифторэтил (CH2CF3) и группы, которые в свете общепринятых знаний и сведений, представленных в настоящем документе, могут считаться эквивалентными одному из вышеприведенных примеров.

Используемый в настоящей заявке термин «циклоалкил» означает насыщенный или частично насыщенный моноциклический, конденсированный полициклический или спиро-полициклический карбоцикл, содержащий от 3 до 12 кольцевых атомов на карбоцикл. Пояснительные примеры циклоалкильных групп включают следующие объекты, в форме соответствующим образом связанных составляющих:

«Гетероциклоалкил» означает насыщенную или частично насыщенную моноциклическую кольцевую структуру, содержащую от 4 до 7 атомов в структуре кольца, выбранных из атомов углерода, и до двух гетероатомов, выбранных из азота, кислорода и серы. Структура кольца может необязательно содержать до двух оксогрупп, присоединенных к гетероатомам серы. Иллюстративные объекты в форме соответствующим образом связанных составляющих включают:

Используемый в настоящей заявке термин «гетероарил» означает моноциклический, конденсированный бициклический или конденсированный полициклический ароматический гетероцикл (кольцевую структуру, имеющую в кольце атомы, выбираемые из атомов углерода и до четырех гетероатомов, выбираемых из азота, кислорода и серы), содержащий от 3 до 12 кольцевых атомов на гетероцикл. Иллюстративные примеры гетероарильных групп включают следующие объекты в форме соответствующим образом связанных составляющих:

Специалисты определят, что перечисленные или проиллюстрированные выше примеры циклоалкильных, гетероциклоалкильных и гетероарильных групп не являются исчерпывающими и что в рамках определенных условий настоящего изобретения могут быть выбраны и иные группы указанных типов.

Термином «галоген» обозначается хлор, фтор, бром или йод. Термин «гало» означает хлор, фтор, бром или йод.

Термин «замещенный» означает, что указанная функциональная группа или составляющая имеет один или несколько заместителей. Термин «незамещенный» означает, что указанная группа не имеет заместителей. Используемый в настоящей заявке термин «возможно замещенный» означает, что указанная группа либо не имеет заместителей, либо несет один или более заместителей. Если термин «замещенный» используется для описания структурной системы, это значит, что замещение происходит на любой позиции системы, где это допускается валентностью. В тех случаях, когда для определенной составляющей или группы явно не указано, что она является необязательно замещенной или замещенной любым определенным заместителем, предполагается, что такая составляющая или группа является незамещенной.

Каждая из приведенных в настоящей заявке формул представляет как соединения со структурами, иллюстрируемыми данной структурной формулой, так и некоторые вариации или формы подобных структур. В частности, соединения любой приведенной в настоящем документе формулы могут иметь асимметричные центры и, следовательно, существовать в различных энантиомерных формах. Все оптические изомеры и стереоизомеры соединений общей формулы, а также смеси таковых, рассматриваются в рамках данной формулы. Таким образом, любая приведенная здесь формула предназначена для обозначения рацемата, одной или более энантиомерных форм, одной или более диастереомерных форм, одной или более атропизомерных форм и смесей упомянутого. Кроме того, некоторые структуры могут существовать в форме геометрических изомеров (например, цис- и транс-изомеры), в форме таутомеров или в форме атропизомеров. Кроме того, любая приведенная здесь формула включает гидраты, сольваты и полиморфы таких соединений, а также смеси указанного.

Кроме того, каждая приведенная в настоящей заявке формула, помимо собственно соединений, также включает их гидраты, сольваты и полиморфы, а также их смеси, даже если такие формы не указаны явно. Некоторые соединения формулы (I) или фармацевтически приемлемые соли соединений формулы (I) могут быть получены в виде сольватов. Сольваты включают формы, образуемые в результате взаимодействия или комплексообразования соединений, составляющих предмет настоящего изобретения, с одним или более растворителем, и получаемые либо в виде раствора, либо в виде твердой или кристаллической формы. В ряде вариантов осуществления упомянутый растворитель представляет собой воду, а сольваты являются гидратами. Кроме того, некоторые кристаллические формы соединений формулы (I) или фармацевтически приемлемых солей соединений формулы (I) могут быть получены в виде со-кристаллов. В некоторых вариантах осуществления настоящего изобретения соединения формулы (I) были получены в кристаллической форме. В других вариантах осуществления кристаллические формы соединений формулы (I) были кубическими по своей природе. В других вариантах осуществления фармацевтически приемлемые соли соединений формулы (I) были получены в кристаллической форме. В других вариантах осуществления соединения формулы (I) были получены в виде одной из нескольких полиморфных форм, в виде смеси кристаллических форм, в виде полиморфной формы или в аморфном виде. В других вариантах осуществления соединения формулы (I) в растворе переходят из одной кристаллической и (или) полиморфной формы в другую и обратно.

Для большей сжатости описания ряд приводимых в настоящей заявке количественных выражений дается без модификатора «приблизительно». Подразумевается, что независимо от того, указывается ли модификатор «приблизительно» явным образом или нет, каждое приводимое в настоящей заявке численное значение относится к конкретному приведенному значению, а также к приближению к данному приведенному значению, которое может быть разумным образом оценено любым специалистом, включая эквиваленты и приближения, связанные с условиями проведения эксперимента и (или) измерения для подобного приведенного значения. При указании выхода соединения в процентах приводимый выход относится к массе структурной единицы, для которой указывается выход, по отношению к максимально достижимому количеству данной структурной единицы в конкретных стехиометрических условиях. Если не указано иное, приводимые в процентах концентрации относятся к массовым соотношениям.

Упоминание химической структурной единицы в настоящей заявке означает отсылку к любому из следующего: (а) буквально указанной форме данной химической структурной единицы; и (б) любой форме упомянутой химической структурной единицы в той среде, где данное соединение находится на момент упоминания. Например, упоминание в настоящей заявке такого соединения, как R-COOH, включает отсылку к любой из, например, следующих форм: R-COOH(s), R-COOH(sol) и R-COO-(sol). В приведенном примере, R-COOH(s) относится к твердому соединению, например, в виде таблетки или иной твердой фармацевтической форме или композиции; R-COOH(sol) относится к недиссоциированной форме соединения в растворителе; и R-COO-(sol) относится к диссоциированной форме соединения в растворителе, такой как диссоциированная форма соединения в водной среде, независимо от того, получена ли данная диссоциированная форма из R-COOH, из его соли или из любой другой структурной единицы, которые дают R-COO- при диссоциации в рассматриваемой среде. В другом примере такое выражение, как «действие на структурную единицу соединением по формуле R-COOH» означает действие на упомянутую структурную единицу формой или формами соединения R-COOH, которая существует или которые существуют в той среде, где осуществляется описываемое воздействие. В еще одном примере такое выражение, как «введение структурной единицы в реакцию с соединением по формуле R-COOH», относится к реакции (а) подобной структурной единицы в соответствующей химической форме или формах, которая существует или которые существуют в той среде, где осуществляется описываемая реакция, с (б) соответствующей химической формой или формами соединения R-COOH, которая существует или которые существуют в той среде, где осуществляется описываемая реакция. В этой связи, если подобная структурная единица находится, например, в водной среде, подразумевается, что упомянутое соединение R-COOH находится в той же среде, и поэтому на упомянутую структурную единицу действуют такие реагенты, как R-COOH(aq) и (или) R-COO-(aq), где нижний индекс «(aq)» означает «водный» в соответствии с его общепринятым значением в химии и биохимии. В описанных примерах используемой номенклатуры применяется карбоксильная функциональная группа, однако этот выбор ни в коей мере не является ограничением и был сделан только для иллюстрации. Подразумевается, что аналогичные примеры могут быть приведены и для иных функциональных групп, включая, помимо прочего, такие группы, как гидроксильная группа, азотная основная группа, например, в аминах, а также любые другие группы, которые известным образом взаимодействуют или перестраиваются в содержащей данное соединение среде. Подобные взаимодействия и перестройки включают в себя, помимо прочего, диссоциацию, ассоциацию, таутомеризм, сольволиз, включая гидролиз, сольватацию, включая гидратацию, протонирование и депротонирование.

В другом примере цвиттерионное соединение в настоящей заявке включается путем отсылки к соединению, которое может образовывать цвиттерион, даже если оно явно не упоминается в своей цвиттерионной форме. Термины «цвиттерион», «цвиттерионы», а также их синонимы «цвиттерионное соединение» и «цвиттерионные соединения» являются стандартными рекомендованными IUPAC терминами, которые хорошо известны и входят в стандартный набор определенных научных терминов. В этой связи термину «цвиттерион» присвоен уникальный идентификатор CHEBI:27369 в Словаре химических объектов биологического интереса (ChEBI). Как в целом хорошо известно, цвиттерион или цвиттерионное соединение представляет собой в целом нейтральное соединение, имеющее формальные единичные заряды противоположных знаков. Иногда к подобным соединениям также применяется термин «внутренние соли». В ряде источников такие соединения называются «диполярными ионами», хотя в других источниках последний термин считается неправильным. В качестве конкретного примера, аминоэтановая кислота (аминокислота глицин) имеет формулу H2NCH2COOH и в ряде сред (в данном случае в нейтральной среде) существует в форме цвиттериона +H3NCH2COO-. Цвиттерионы, цвиттерионные соединения, внутренние соли и диполярные ионы в известных и хорошо обоснованных значениях перечисленных терминов относятся к сфере действия настоящего изобретения, как без труда определят специалисты. Поскольку нет необходимости называть каждый отдельный вариант осуществления настоящего изобретения, который может определить специалист, в настоящей заявке не приводятся явно структуры цвиттерионных соединений, родственных соединениям, составляющим предмет настоящего изобретения. Тем не менее, все такие структуры являются частью вариантов осуществления настоящего изобретения. В настоящей заявке не приводятся дальнейшие примеры в этой связи, поскольку возможные взаимодействия и перестройки в каждой конкретной среде, приводящие к различным формам каждого конкретного соединения, хорошо известны специалистам.

Каждая из приведенных в настоящей заявке формул также представляет как немеченные, так и изотопно-меченые формы соответствующих соединений. Изотопно-меченые соединения имеют структуры, соответствующие представленным в настоящей заявке формулам, за исключением того, что один или более атомов в них заменены атомом, имеющим определенную атомную массу или массовое число. Примеры изотопов, которые могут быть внедрены в соединения изобретения, включают изотопы водорода, углерода, азота, кислорода, фосфора, фтора, хлора и йода, такие как 2H, 3H, 11C, 13C, 14C, 15N, 18O, 17O, 31P, 32P, 35S, 18F, 36Cl, 125I, соответственно. Такие меченные изотопами соединения пригодны для исследований метаболизма (предпочтительно с 14C), исследований кинетики реакций (например, с 2H или 3H), в методиках обнаружения или получения изображений [таких как томография, основанная на методе позитронной эмиссии (PET), или однофотонная эмиссионная компьютерная томография (SPECT)], включая количественные анализы лекарства или субстрата тканей, или при радиационной терапии пациентов. В частности, соединения, меченые 18F или 11C, могут оказаться особенно предпочтительны для исследований способами PET или SPECT. Кроме того, замещение более тяжелыми изотопами, такими как дейтерий (т.е. 2H), может дать определенные терапевтические преимущества как следствие большей метаболической стабильности соединений, например, повышенный период полувыведения in vivo или снижение необходимой дозировки. Соединения настоящего изобретения, меченные изотопами, и пролекарства таковых могут, в целом, быть приготовлены путем осуществления процедур согласно схемам или примерам и способам приготовления, описанным ниже, путем замены реагента, не содержащего меченых атомов, на легкодоступный реагент с мечеными атомами.

При обсуждении любой приведенной в настоящей заявке формулы выбор конкретного фрагмента из списка возможных вариантов для конкретной химической переменной не означает фиксирование такого выбора фрагмента для данной переменной в других формулах. Другими словами, если некоторая химическая переменная присутствует в формуле более чем в одном месте, выбор варианта для нее из списка возможных в одном месте не зависит от выбора варианта для той же переменной в другом месте формулы, если не указано иное.

В качестве первого примера по используемой для обозначения заместителей терминологии, если заместитель S1пример представляет собой один из S1 и S2, и заместитель S2пример представляет собой один из S3 и S4, то указанные варианты обозначения заместителей включают варианты осуществления настоящего изобретения в соответствии со следующими наборами: S1пример представляет собой S1 и S2пример представляет собой S3; S1пример представляет собой S1 и S2пример представляет собой S4; S1пример представляет собой S2 и S2пример представляет собой S3; S1пример представляет собой S2 и S2пример представляет собой S4; а также эквивалентны каждому из перечисленных наборов заместителей. Поэтому для краткости изложения без ограничения общности в настоящей заявке используется сокращенная терминология: «S1пример представляет собой один из S1 и S2, а S2пример представляет собой один из S3 и S4». Приведенный выше первый пример по используемой для обозначения заместителей терминологии, данный в общих терминах, иллюстрирует различные варианты обозначения заместителей, описанные в настоящей заявке. Упомянутое выше условие о заместителях распространяется, где применимо, на такие группы, как R1, R2, R3, A, X4, X5, X6, X7, Ra, Rb, Rc, Rd и Re, а также на любые другие общие символические обозначения заместителей, используемые в настоящем документе.

Кроме того, если для любого участника химической структуры или заместителя приводится более чем один вариант, варианты осуществления настоящего изобретения включают различные независимые сочетания вариантов из списков возможных заместителей, а также их эквиваленты. В качестве второго примера по используемой для обозначения заместителей терминологии, если в настоящей заявке указано, что заместитель Sпример представляет собой один из S1, S2 и S3, данный перечень включает варианты осуществления настоящего изобретения, в которых Sпример представляет собой S1; Sпример представляет собой S2; Sпример представляет собой S3; Sпример представляет собой один из S1 и S2; Sпример представляет собой один из S1 и S3; Sпример представляет собой один из S2 и S3; Sпример представляет собой один из S1, S2 и S3; и Sпример представляет собой любой эквивалент каждого из перечисленных вариантов. Поэтому для краткости изложения без ограничения общности в настоящей заявке используется сокращенная терминология: «Sпример представляет собой один из S1, S2 и S3». Приведенный выше второй пример по используемой для обозначения заместителей терминологии, данный в общих терминах, иллюстрирует различные варианты обозначения заместителей, описанные в настоящей заявке. Упомянутое выше условие о заместителях распространяется, где применимо, на такие группы, как R1, R2, R3, A, X4, X5, X6, X7, Ra, Rb, Rc, Rd и Re, а также на любые другие общие символические обозначения заместителей, используемые в настоящем документе.

Номенклатура «Ci-j», где j>i, используемая в настоящей заявке для обозначения класса заместителей, включает варианты осуществления настоящего изобретения, для которых индивидуально реализовано каждое и все возможные количества атомов углерода, от i до j, включая i и j. В качестве примера, термин C1-3 относится независимо к вариантам осуществления, в которых имеется один атом углерода (C1), вариантам осуществления, в которых имеются два атома углерода (C2), и вариантам осуществления, в которых имеются три атома углерода (C3).

Используемый в настоящей заявке термин Cn-mалкил означает линейную или разветвленную алифатическую цепь с полным количеством N углеродных центров в цепи, удовлетворяющей условию n≤N≤m, где m>n.

Любое упоминание в настоящей заявке дивалентного заместителя включает различные варианты присоединения упомянутого заместителя, если имеется более одной такой возможности. Например, упоминание дивалентного заместителя -A-B-, где A≠B, в настоящей заявке относится к таким дивалентным заместителям -A-B-, где фрагмент A присоединяется к первому замещаемому центру и фрагмент B присоединяется ко второму замещаемому центру, а также к таким дивалентным заместителям -A-B-, где фрагмент A присоединяется ко второму замещаемому центру и фрагмент B присоединяется к первому замещаемому центру.

В соответствии с приведенными выше соображениями по обозначению заместителей и используемой номенклатуре подразумевается, что в настоящей заявке явное упоминание некоторого набора возможностей означает, при наличии химического смысла и если не указано иное, независимую отсылку ко всем возможным вариантам осуществления данного набора, а также отсылку ко всем и каждому возможному варианту осуществления подмножеств явно указанного набора возможных вариантов.

Изображения химических структур предназначены для детального представления тех частей соединений, которые содержат описанные здесь ориентации.

Целью настоящего изобретения, в общем, являются соединения формулы (I),

применение соединений формулы (I) и фармацевтических композиций, содержащих такие соединения формулы, для лечения пациентов (людей или иных млекопитающих), имеющих заболевания, связанные с модуляцией энзима пролилгидроксилазы. Текущее изобретение также включает способы изготовления такого соединения, фармацевтической композиции, фармацевтически приемлемой соли, фармацевтически приемлемого пролекарства и его фармацевтически активных метаболитов.

В одном предпочтительном варианте осуществления для формулы (I), каждый из R2 и R3 представляют собой H.

В другом варианте осуществления формулы (I), Z представляет собой C.

В родственных вариантах осуществления для формулы (I) n представляет собой 4, и каждый R1 представляет собой независимо: H, галоген, гидроксил, алкил, алкокси, тиоалкил, алкил сульфоксид, алкил сульфон, необязательно замещенное 3-8-членное алифатическое или ароматическое или гетероциклическое кольцо, амино, алкиламино, алкилсульфонамид, арилсульфонамид, нитро, циано, замещенный фенокси, бензилокси, замещенный арилсульфон, замещенный арилсульфоксид, замещенный арилсульфонил, замещенный бензилсульфон, замещенный бензилсульфоксид, замещенный бензилсульфонил или замещенный фенилсульфамоил.

R1 может также независимо представлять собой H, галоген, C1-4алкил с прямой или разветвленной цепью, C1-4трифторалкоксил с прямой или разветвленной цепью, C1-4пергалоалкил с прямой или разветвленной цепью или моноциклическое C3-8углеродное кольцо, насыщенное или частично насыщенное.

В другом предпочтительном варианте осуществления две соседних группы R1 могут быть соединены с образованием необязательно замещенного 3-8-членного насыщенного или ненасыщенного карбоциклического или гетероциклического кольца.

В другом предпочтительном варианте осуществления для формулы (I) каждый R1 независимо выбран из группы, состоящей из H, -Cl, -F, -Br, -I, -C1-4алкила, -CF3, -C3-8циклоалкила, -SC1-4алкила, -S(O)C1-4алкила, -S(O)2C1-4алкила, -OCF3, -OC1-4алкила, -CN, -NO2, -NH2, -NH-C1-4алкил-, пирролидин-, пиперидин-, морфолин-, -CO2H, -NHS(O)2C1-4алкил- и -NH-C(O)C1-4алкил-, фенил-, бензил-, фенокси- и бензилокси-.

В предпочтительных вариантах осуществления формулы (I) R1 представляет собой H, 5,6-дихлор, 5-трифторметил, 5-хлор-6-фтор, 5,6-диметил, 5-бром, 5-метокси, 4-хлор-6-трифторметил, 5,6-диметокси, 4,5-диметил, 5-трифторметокси, 5-бром, 5,6-дихлор, 5-бром, 5,6-дихлор, 5-хлор, 5-бром-6,7-диметил, 4-хлор, 5-хлор-7-трифторметил, 7-бром-5-трифторметокси, 6-хлор-5-трифторметил, 4,5,6-трифтор, 4-бром-5,6-дифтор, 6-хлор-4-метил, 4,6-дихлор, 4-бром-6-трифторметил, 5,6-дифтор, 4-бром-6-хлор, 6-метансульфонил, 5-хлор-6-циано, 6-хлор-5-нитро, 5-амино-6-хлор, 5-фтор, 6-хлор-5-пирролидин-1-ил, 6-хлор-5-пиперидин-1-ил, 6-хлор-5-морфолин-4-ил, 6-хлор-5-метокси, 4-карбокси, 5-бром-7-фтор, 5-бром-7-метил, 6-метилсульфанил-5-трифторметил, 6-пропилсульфанил-5-трифторметил, 6-изопропилсульфанил-5-трифторметил, 5-фтор-6-метилсульфанил, 5-хлор-6-метилсульфанил, 5-хлор-6-этилсульфанил, 5-хлор-6-изопропилсульфанил, 5-хлор-6-пропилсульфанил, 6-метилсульфанил-5-трифторметокси, 6-изопропилсульфанил-5-трифторметокси, 6-пропилсульфанил-5-трифторметокси, 5-хлор-6-этансульфинил, 5-хлор-6-этансульфонил, 6-метансульфонил-5-трифторметил, 5-фтор-6-метансульфонил, 5-хлор-6-метансульфонил, 6-метансульфонил-5-трифторметокси, 5-хлор-6-(пропан-2-сульфонил), 5-хлор-6-(пропан-1-сульфонил), 6-(пропан-2-сульфонил)-5-трифторметил, 6-(пропан-1-сульфонил)-5-трифторметил, 6-[(1-этилэтил)сульфонил]-5-(трифторметокси, 6-(пропан-2-сульфонил)-5-трифторметокси, 6-(метилсульфинил)-5-(трифторметил, 6-бром-5-фтор, 4-фтор, 4,5-дифтор, 4,6-дифтор, 6-хлор-5-трифторметокси, 5-фтор-4-метил, 5-пиперидин-1-ил-6-(трифторметокси, 5-фтор-6-пиперидин-1-ил, 6-этокси-5-фтор, 4-бром-6-фтор, 5,6-бис-трифторметил, 4,5,6-трихлор, 4-бром-5,6-дихлор-, 6-фтор-5-трифторметил, 6-хлор-5-этиламино, 6-хлор-5-пропиламин, 6-хлор-5-циклопропансульфониламин, 6-хлор-5-метансульфониламин, 6-хлор-5-этансульфониламин, 5-ацетиламино-6-хлор, 6-хлор-5-пропиониламин, 5-этилсульфанил-6-трифторметил, 5-этилсульфанил-6-трифторметокси, 5-этилсульфанил-6-фтор, 6-фтор-5-пропилсульфанил, 6-фтор-5-изопропилсульфанил, 5-этилсульфонил-6-трифторметил, 5-этилсульфонил-6-трифторметокси, 5-этилсульфонил-6-фтор, 6-фтор-5-пропилсульфонил и 6-фтор-5-изопропилсульфонил.

В предпочтительных вариантах осуществления формулы (I), где каждый R1 независимо выбран из группы, состоящей из H, 3-(3-хлорбензилокси)-фенила, 3-(2-хлорбензилокси)-фенила, 3-(4-хлорбензилокси)-фенила, 3-бензилоксифенила, 4-бензилоксифенила, 3-трифторметилфенила, 3,4-дихлорфенила, 4-гидроксифенила, 3-гидроксифенила, 3,4-дихлорфенокси)-6-трифторметила, 6-хлор-5-(4-хлорфенокси), (4-хлорфенокси)-6-трифторметокси, 5-фенокси-6-трифторметокси, 4-фторфенокси)-6-трифторметила, (4-хлорфенокси)-6-трифторметила, 5-фенокси-6-трифторметила, 6-хлор-5-фенокси, 5-бензилокси-6-хлора, 6-хлор-5-м-толилсульфанила, 6-хлор-5-(4-хлорфенилсульфанила, 6-хлор-5-фенилсульфанила, 6-хлор-5-(3,4-дихлорфенилсульфанила, 6-хлор-5-(3-метоксифенилсульфанила, 6-хлор-5-(4-метоксифенилсульфанила), 5-бензилсульфанил-6-хлора, 4-трет-бутилбензилсульфанил)-6-хлора, 6-хлор-5-(4-фторбензилсульфанила, 6-хлор-5-(2-хлор-бензилсульфанила, 6-хлор-5-фенэтилсульфанила, 6-хлор-5-(толуол-3-сульфонила, 5-бензолсульфонил-6-хлора, 6-хлор-5-(4-метоксибензолсульфонила, 6-хлор-5-(4-хлорбензолсульфонила, 6-хлор-5-(4-трифторметоксибензолсульфонила, 6-хлор-5-(3,4-дихлорбензолсульфонила, 6-хлор-5-(3-метоксибензолсульфонила, 6-хлор-5-фенилметансульфонила, 6-хлор-5-(2,4,6-триметилфенилметансульфонила, 6-хлор-5-(4-метоксифенилметансульфонила, хлор-5-(4-фторфенилметансульфонила, 6-хлор-5-(2-хлорфенилметансульфонила, 6-хлор-5-(2-фенилэтансульфонила, 5-бензолсульфинил-6-хлора, 5-фенилкарбамоила, 5-бензилкарбамоила, 5-(морфолин-4-ил-карбамоила), 5-бензилоксиметила, 5-бензиламина, 6-хлор-5-фениламина, 6-хлор-5-(2-морфолин-4-ил-этиламина), 5-бензолсульфониламино-6-хлора, 5-бензоиламино-6-хлора, 6-хлор-5-(2-морфолин-4-ил-ацетиламина), 6-хлор-5-(2-пиперидин-1-ил-ацетиламина), 6-хлор-5-[2-(4-метилпиперазин-1-ил, 6-хлор-5-(4-метоксифенокси), 6-хлор-5-(4-хлор-2-фторфенокси), 6-хлор-5-(4-трифторметоксифенокси), 6-хлор-5-(3-хлор-4-фторфенокси), 5-фенилсульфанил-6-трифторметила, 5-(4-метоксифенилсульфанил)-6-трифторметила, 5-бензолсульфонил-6-трифторметила, 5-(4-метоксибензолсульфонил)-6-трифторметила, 6-хлор-5-(4-хлор-бензилсульфанила, 6-хлор-5-(3-хлорбензилсульфанила), 6-хлор-5-циклогексилметилсульфанила, 6-хлор-5-(2-морфолин-4-ил-этилсульфанила), хлор-5-(3,4-дихлорбензилсульфанила, 6-хлор-5-(2,6-дихлорбензилсульфанила), 6-хлор-5-(4-метилбензилсульфанила), 6-хлор-5-(4-трифторметилбензилсульфанила), 5-(2,4-бис-трифторметилбензилсульфанила)-6-хлор, 6-хлор-5-(2'-цианобифенил-4-ил-метилсульфанила), 6-хлор-5-(4-хлорфенилметансульфонила), 6-хлор-5-(3-хлорфенилметансульфонила), хлор-5-циклогексилметансульфонила, 6-хлор-5-(3,4-дихлорфенилметансульфонила), 6-хлор-5-(2,6-дихлорфенилметансульфонила), хлор-5-п-толилметансульфонила, 6-хлор-5-(4-трифторметилфенилметансульфонила), 5-(2,4-бис-трифторметилбензилсульфанила), хлор-5-(2'-цианобифенил-4-ил-метансульфонила и 6-хлор-5-фенилсульфамоила.

Примеры соединений настоящего изобретения представлены в таблице ниже.

Пример Химическое название Энзим pIC50 Клеточный % стимуляции ЭПО
1 1-(1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,1 7,1
2 1-(5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 151,91
3 1-(5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,6 109,74
4 1-(5-хлор-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,7 132,79
5 1-(5,6-диметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,1 2,1
6 1-(5-бром-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 9,91
7 1-(5-метокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 16,8
8 1-(4-хлор-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота; 6,8 20,97
9 1-(5,6-диметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 4,26
10 1-(4,5-диметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 5,1 10,7
11 1-(5-трифторметокси -1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,5 123,68
12 1-{5-[3-(3-хлорбензилокси)фенил]-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновая кислота 7,5 8,76
13 1-{5-[3-(2-хлорбензилокси)фенил]-1H-бензоимидазол-2-ил}-1H-пиразол-4- 7,6 18
карбоновая кислота
14 1-{5-[3-(4-хлорбензилокси)фенил]-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновая кислота 7,4 20,15
15 1-[5-(3-бензилоксифенил) -1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,3 10,77
16 1-[5-(4-бензилоксифенил) -1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,7 6,97
17 1-[5-(3-трифторметилфенил) -1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,1 5,8
18 1-[5-(3,4-дихлорфенил) -1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,1 15,3
19 1-(5-бром-1H-бензоимидазол-2-ил)-3-трифторметил-1H-пиразол-4-карбоновая кислота <4 20,52
20 1-(5,6-дихлор-1H-бензоимидазол-2-ил)-3-трифторметил-1H-пиразол-4-карбоновая кислота <4 18,81
21 1-(5-бром-1H-бензоимидазол-2-ил)-3,5-диметил-1H-пиразол-4-карбоновая кислота 4,2 7,24
22 1-(5,6-дихлор-1H-бензоимидазол-2-ил)-3,5-диметил-1H-пиразол-4-карбоновая кислота <4 0,47
23 1-[5-(4-гидроксифенил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,6 6,49
24 1-[5-(3-гидроксифенил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,5 11,15
25 1-(5-хлор-1H-бензоимидазол-2-ил)-1H- 6,3 71,87
пиразол-4-карбоновая кислота
26 1-(5-бром-6,7-диметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 11,9
27 1-(4-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,1 19,12
28 1-(5-хлор-7-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 16,6
29 1-(7-бром-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,8 57,55
30 1-(6-хлор-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,14 128,94
31 1-(4,5,6-трифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7 18,2
32 1-(4-бром-5,6-дифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,7 33
33 1-(6-хлор-4-метил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6 13,4
34 1-(4,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,5 56,3
35 1-(4-бром-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,8 29,7
36 1-(5,6-дифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,6 79,4
37 1-(4-бром-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,6 34,03
38 1-(6-метансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,1 40,93
39 1-(6-хлор-5-циано-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,4 29,93
40 1-(6-хлор-5-нитро-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,5 93,44
41 1-(5-амино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 30
42 1-(5-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,3 33,76
43 1-(6-хлор-5-пирролидин-1-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,7 177,5
44 1-(6-хлор-5-пиперидин-1-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,7 138,8
45 1-(6-хлор-5-морфолин-4-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,6 30,85
46 1-(6-хлор-5-метокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,5 76
47 2-(4-карбоксипиразол-1-ил)-1H-бензоимидазол-5-карбоновая кислота 6,6 11
48 1-(5-бром-7-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,3 44
49 1-(5-бром-7-метил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,1 24
50 1-[5-(3,4-дихлорфенокси)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,4 17,98
51 1-[6-хлор-5-(4-хлорфенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4- 7,4 150,4
карбоновая кислота
52 1-[5-(4-хлорфенокси)-6-трифторметокси-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,4 21,55
53 1-(5-фенокси-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,2 137,71
54 1-[5-(4-фторфенокси)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,3 75,52
55 1-[5-(4-хлорфенокси)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 44,23
56 1-(5-фенокси-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,2 142,55
57 1-(6-хлор-5-фенокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 55
58 1-(5-бром-7-метил-1H-имидазо[4,5-f]хинолин-2-ил)-1H-пиразол-4-карбоновая кислота 7,2 50
59 1-(5-бензилокси-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 55,9
60 1-(6-хлор-5-м-толилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 42,30
61 1-[6-хлор-5-(4-хлорфенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,07 101,2
62 1-(6-хлор-5-фенилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,75 45,84
63 1-[6-хлор-5-(3,4-дихлорфенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,18 26,54
64 1-[6-хлор-5-(3-метоксифенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,9 38,26
65 1-[6-хлор-5-(4-метоксифенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,6 56,3
66 1-(5-бензилсульфанил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,7 41,64
67 1-[5-(4-трет-бутилбензилсульфанил)-6-хлор-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,2 11,72
68 1-[6-хлор-5-(4-фторбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,8 58,37
69 1-[6-хлор-5-(2-хлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,8 85,3
70 1-(6-хлор-5-фенэтилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,7 74,24
71 1-(6-метилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,1 113,95
72 1-(6-пропилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,1 н/и
73 1-(6-изопропилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,2 н/и
74 1-(5-фтор-6-метилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 77,795
75 1-(5-хлор-6-метилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7 106,17
76 1-(5-хлор-6-этилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 211,75
77 1-(5-хлор-6-изопропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,8 152,89
78 1-(5-хлор-6-пропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7 125,21
79 1-(6-метилсульфанил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,1 83,83
80 1-(6-изопропилсульфанил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7 н/и
81 1-(6-пропилсульфанил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7 н/и
82 1-[6-хлор-5-(толуол-3-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,4 85,32
83 1-(5-бензолсульфонил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,57 96,65
84 1-[6-хлор-5-(4-метоксибензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,3 42,71
85 1-[6-хлор-5-(4-хлорбензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,3 51,64
86 1-[6-хлор-5-(4-трифторметоксибензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,3 48,9
87 1-[6-хлор-5-(3,4-дихлорбензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,68 32,39
88 1-[6-хлор-5-(3-метоксибензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,4 69,43
89 1-(6-хлор-5-фенилметансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,5 28,45
90 1-[6-хлор-5-(2,4,6-триметилфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,3 8,25
91 1-[6-хлор-5-(4-метоксифенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,7 22,01
92 1-[6-хлор-5-(4-фторфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 61,2
93 1-[6-хлор-5-(2-хлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 78,5
94 1-[6-хлор-5-(2-фенилэтансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,4 65,1
95 1-(5-хлор-6-этансульфинил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,2 46,3
96 1-(5-хлор-6-этансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,4 67
97 1-(6-метансульфонил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,6 75,88
98 1-(5-фтор-6-метансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,3 41,37
99 1-(5-хлор-6-метансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,4 34,85
100 1-(6-метансульфонил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,5 50,16
101 1-[5-хлор-6-(пропан-2-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,3 62,2
102 1-[5-хлор-6-(пропан-1-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 54,94
103 1-[6-(пропан-2-сульфонил)-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,4 н/и
104 1-[6-(пропан-1-сульфонил)-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 н/и
105 1-[6-(пропан-2-сульфонил)-5-трифторметокси-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,4 н/и
106 1-[6-(пропан-1-сульфонил)-5-трифторметокси-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 123,7
107 1-(5-бензолсульфинил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,2 47,57
108 1-(6-метансульфинил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,3 20,41
109 1-(6-бром-5-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,7 99
110 1-(4-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,2 45,87
111 1-(4,5-дифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,6 32,58
112 1-(4,6-дифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,8 31,96
113 1-(6-хлор-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,98 109,33
114 1-(1H-нафто[2,3-d]имидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,3 144,2
115 1-(3H-нафто[1,2-d]имидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,1 50
116 1-(5-фтор-4-метил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 5,8 18,3
117 1-(5-пиперидин-1-ил-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,5 80
118 1-(5-фтор-6-пиперидин-1-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,8 152
119 1-(6-этокси-5-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,5 69
120 1-(5-фенилкарбамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 21,15
121 1-(5-бензилкарбамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,1 18,5
122 1-[5-(морфолин-4-илкарбамоил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,6 5,4
123 1-(5-бензилоксиметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,3 61,15
124 1-(4-бром-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,3 2,4
125 1-(8H-имидазо[4',5':3,4]бензо[2,1-d]триазол-7-ил)-1H-пиразол-4-карбоновая кислота 6 46,75
126 1-(5,6-бис-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,4 82,65
127 1-(4,5,6-трихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 70,6
128 1-(4-бром-5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,1 24,1
129 1-(6-фтор-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7 70,8
130 1-(6-хлор-5-этиламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,2 48
131 1-(6-хлор-5-пропиламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,5 89
132 1-(5-бензиламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,2 52,6
133 1-(6-хлор-5-фениламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 77
134 1-[6-хлор-5-(2-морфолин-4-ил-этиламино-)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,3 56,5
135 1-(6-хлор-5-циклопропансульфониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,8 17
136 1-(6-хлор-5-метансульфониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,8 9
137 1-(6-хлор-5-этансульфониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,6 11
138 1-(5-бензолсульфониламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,8 19
139 1-(5-ацетиламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,3 24
140 1-(6-хлор-5-пропиониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 10
141 1-(5-бензоиламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,6 33
142 1-[6-хлор-5-(2-морфолин-4-ил-ацетиламино-)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,4 17
143 1-[6-хлор-5-(2-пиперидин-1-ил-ацетиламино)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,2 20
144 1-{6-хлор-5-[2-(4-метилпиперазин-1-ил)-ацетиламино]-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновая кислота 6,4 16
145 1-[6-хлор-5-(4-метоксифенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,1 13,92
146 1-[6-хлор-5-(4-хлор-2-фторфенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,2 49,85
147 1-[6-хлор-5-(4-трифторметоксифенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,4 45,85
148 1-[6-хлор-5-(3-хлор-2-фторфенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,1 38,12
149 1-(5-этилсульфанил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,3 57,8
150 1-(5-этилсульфанил-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,2 47,2
151 1-(5-этилсульфанил-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 106,61
152 1-(6-фтор-5-пропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 91,38
153 1-(6-фтор-5-изопропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 н/и
154 1-(5-этилсульфонил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,6 53,82
155 1-(5-этилсульфонил-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,6 47,21
156 1-(5-этилсульфонил-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,4 51,9
157 1-(6-фтор-5-пропилсульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,4 н/и
158 1-(6-фтор-5-изопропилсульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,3 н/и
159 1-(5-фенилсульфанил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,4 11,01
160 1-[5-(4-метоксифенилсульфанил)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 36,1
161 1-(5-бензолсульфонил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,6 98,15
162 1-[5-(4-метоксибензолсульфонил)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,6 45,8
163 1-[6-хлор-5-(4-хлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,5 36,98
164 1-[6-хлор-5-(3-хлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,6 27,4
165 1-(6-хлор-5-циклогексилметилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 6,9 27,3
166 1-[6-хлор-5-(2-морфолин-4-ил-этилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7 15,1
167 1-[6-хлор-5-(3,4-дихлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,4 25,8
168 1-[6-хлор-5-(2,6-дихлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,3 50,14
169 1-[6-хлор-5-(4-метилбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,7 н/и
170 1-[6-хлор-5-(4-трифторметилбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,7 н/и
171 1-[5-(2,4-бис-трифторметилбензилсульфанил)-6-хлор-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 6,7 н/и
172 1-[6-хлор-5-(2'-цианобифенил-4-илметилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 н/и
173 1-[6-хлор-5-(4-хлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,8 60,41
174 1-[6-хлор-5-(3-хлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,6 40,9
175 1-(6-хлор-5-циклогексилметансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,7 48,7
176 1-[6-хлор-5-(3,4-дихлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,6 44,23
177 1-[6-хлор-5-(2,6-дихлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,5 66,6
178 1-(6-хлор-5-п-толилметансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,7 н/и
179 1-[6-хлор-5-(4-трифторметил-фенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,7 н/и
180 1-[5-(2,4-бис-трифторметил-фенилметансульфонил)-6-хлор-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,6 н/и
181 1-[6-хлор-5-(2'-циано-бифенил-4-илметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота 7,7 н/и
182 1-(1H-имидазо[4,5-b]хиноксалин-2-ил)-1H-пиразол-4-карбоновая кислота 5,5 13,4
183 1-(6,7-дихлор-1H-имидазо[4,5-b]хиноксалин-2-ил)-1H-пиразол-4-карбоновая кислота 6,4 3,3
184 1-(1H-имидазо[4,5-b]пиразин-2-ил)-1H-пиразол-4-карбоновая кислота 5,9 8,3
185 1-(6-хлор-9H-пурин-8-ил)-1H-пиразол-4-карбоновая кислота 5,3 11,7
186 1-(6-хлор-5-фенилсульфамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота 7,4 39,1

Настоящее изобретение также включает фармацевтически приемлемые соли соединений формулы (I), предпочтительно из тех, которые описаны выше, и из тех указанных соединений, примеры которых здесь приведены, а также способы лечения с использованием таких солей.

Термин «фармацевтически приемлемая соль» означает соль свободной кислоты или основание соединения, представленного формулой (I), которая является нетоксичной, биологически переносимой или иным образом биологически допустимой для назначения пациенту. См., в основном, G.S. Paulekuhn, et al., «Trends in Active Pharmaceutical Ingredient Salt Selection based on Analysis of the Orange Book Database», J. Med. Chem., 2007, 50:6665-72, S.M. Berge, et al., «Pharmaceutical Salts», J Pharm Sci., 1977, 66:1-19, и Справочник фармацевтических солей, свойства, выбор и применение, Stahl and Wermuth, Eds., Wiley-VCH and VHCA, Zurich, 2002. Примерами фармацевтически приемлемых солей являются те, которые имеют фармакологический эффект и допустимы для контакта с тканями пациентов без чрезмерной раздражающей, токсической или аллергической реакции. Соединение формулы (I) может иметь в достаточной степени кислую группу, в достаточной степени основную группу или оба типа функциональных групп и вступать в соответствующие реакции с рядом неорганических или органических оснований, а также неорганических или органических кислот с образованием фармацевтически приемлемых солей. Примеры фармацевтически приемлемых солей включают следующие соли: сульфаты, пиросульфаты, бисульфаты, сульфиты, бисульфиты, фосфаты, моногидрофосфаты, дигидрофосфаты, метафосфаты, пирофосфаты, хлориды, бромиды, йодиды, ацетаты, пропионаты, деканоаты, каприлаты, акрилаты, форматы, изобутираты, капроаты, гептаноаты, пропиолаты, оксалаты, малонаты, сукцинаты, субераты, себакаты, фумараты, малеаты, бутин-1,4-диоаты, гексин-1,6-диоаты, бензоаты, хлорбензоаты, метилбензоаты, динитробензоаты, гидроксибензоаты, метоксибензоаты, фталаты, сульфонаты, ксиленсульфонаты, фенилацетаты, фенилпропионаты, фенилбутираты, цитраты, лактаты, γ-гидроксибутираты, гликоляты, тартраты, метансульфонаты, пропансульфонаты, нафталин-1-сульфонаты, нафталин-2-сульфонаты и манделаты.

Когда соединение формулы (I) содержит азотистое основание, желательная фармацевтически приемлемая соль может быть приготовлена по любой допустимой известной методике, например обработка свободного основания неорганической кислотой, такой как хлористоводородная кислота, бромистоводородная кислота, серная кислота, сульфаминовая кислота, азотная кислота, борная кислота, фосфорная кислота, и тому подобное, или органической кислотой, такой как уксусная кислота, фенилуксусная кислота, пропионовая кислота, стеариновая кислота, молочная кислота, аскорбиновая кислота, малеиновая кислота, гидроксималеиновая кислота, изэтионовая кислота, янтарная кислота, валериановая кислота, фумаровая кислота, малоновая кислота, пировиноградная кислота, щавелевая кислота, гликолевая кислота, салициловая кислота, олеиновая кислота, пальмитиновая кислота, лауриновая кислота, пираносидиловая кислота, такая как глюкуроновая кислота или галактуроновая кислота, альфа-гидрокси кислота, такая как миндальная кислота, лимонная кислота, или тартратная кислота, аминокислота, такая как аспарагиновая кислота, глутаровая кислота или глутаминовая кислота, ароматическая кислота, такая как бензойная кислота, 2-ацетоксибензойная кислота, нафтойная кислота, или коричная кислота, сульфоновая кислота, такая как лаурилсульфоновая кислота, пара-толуолсульфоновая кислота, метансульфоновая кислота, этансульфоновая кислота, любая совместимая смесь кислот, например тех, которые приведены здесь в качестве примеров, и любая другая кислота или смесь таковых, которые рассматриваются как эквивалентные или приемлемые заменители в свете обычного уровня знаний в данной технологии.

Когда соединение формулы (I) является кислотой, такой как карбоновая кислота или сульфоновая кислота, желательная фармацевтически приемлемая соль может быть приготовлена по любой допустимой методике, например обработка свободной кислоты неорганическим или органическим основанием, таким как амин (первичный, вторичный или третичный), гидроксид щелочного металла, гидроксид щелочноземельного металла, любая совместимая смесь оснований, таких как приведенные здесь в примерах, и любого иного основания и смеси таковых, которые рассматриваются как эквивалентные или приемлемые заменители в свете обычного уровня знаний в данной технологии. Иллюстративные примеры допустимых солей включают органические соли, полученные из аминокислот, таких как N-метил-D-глюкамин, лизин, холин, глицин и аргинин, аммониевые соли, карбонаты, бикарбонаты, первичные, вторичные и третичные амины, и циклические амины, такие как трометамин, бензиламины, пирролидины, пиперидин, морфолин и пиперазин, и неорганические соли, производные натрия, кальция, калия, магния, марганца, железа, меди, цинка, алюминия и лития.

Изобретение также относится к фармацевтически приемлемым пролекарствам формулы (I) и способам лечения с применением таких фармацевтически приемлемых пролекарств. Термин «пролекарство» означает предшественник определенного соединения, который после назначения пациенту дает соединение in vivo посредством химического или физиологического процесса, такого как сольволиз или ферментативное расщепление, или при физиологических условиях (например, пролекарство, приведенное к определенному физиологическому значению pH, превращается в соединение формулы (I)). «Фармацевтически приемлемое пролекарство» означает пролекарство, которое является нетоксичным, биологически переносимым и иным образом биологически допустимым для назначения пациенту. Иллюстративные процедуры выбора и приготовления допустимых производных пролекарств описаны, например, в «Design of Prodrugs», ed. H. Bundgaard, Elsevier, 1985.

Примеры пролекарств включают соединения, имеющие аминокислотный остаток, или полипептидную цепочку из двух или более (например, два, три или четыре) аминокислотных остатков, ковалентно связанных по амидной или эфирной связи со свободной амино-, гидрокси-, или карбоксигруппой соединения формулы (I). Примеры аминокислотных остатков включают двадцать существующих в природе аминокислот, которые обычно обозначаются тремя буквами, а также 4-гидроксипролин, гидроксилизин, демозин, изодемозин, 3-метилгистидин, норвалин, бета-аланин, гамма-аминомасляная кислота, цитруллин гомоцистеин, гомосерин, орнитин и метионинсульфон.

Дополнительные типы пролекарств могут быть получены, например, при использовании свободных карбоксильных групп структур формулы (I) для получения амидных или алкилэфирных производных. Примеры амидов включают производные аммония, первичных C1-6алкиламинов и вторичных ди(C1-6алкил)аминов. Вторичные амины включают 5- или 6-членные составляющие гетероциклоалкильного или гетероарильного кольца. Примеры амидов включают производные аммония, первичных C1-3алкиламинов и ди(C1-2алкил)аминов. Примеры эфиров изобретения включают C1-7алкил, C5-7циклоалкил, фенил и фенил(C1-6алкил) эфиры. Предпочтительные эфиры включают метиловые эфиры. Пролекарства также могут быть приготовлены путем использования свободных гидроксильных групп для получения производных с использованием групп, включая гемисукцинаты, фосфатные эфиры, диметиламиноацетаты и фосфорилоксиметилоксикарбонилы, следуя процедурам, таким как описаны в Fleisher et al., Adv. Drug Delivery Rev. 1996, 19, 115-130. Карбаматные производные гидрокси- и аминогрупп могут также давать пролекарства. Карбонатные производные, сульфонатные эфиры и сульфатные эфиры гидроксигрупп могут также давать пролекарства. Также для получения пролекарств возможно использование гидроксигрупп, таких как (ацилокси)метил- и (ацилокси)этил эфиры, где ацильная группа может быть алкилэфиром, возможно несущим в качестве заместителей одну или более эфирных, амино или карбоксильных функциональных групп, или где упомянутая ацильная группа представляет собой эфир аминокислоты, как описано выше. Пролекарства этого типа могут быть приготовлены согласно описанию в Greenwald, et al., J Med Chem. 1996, 39, 10, 1938-40. Свободные аминогруппы могут также быть использованы для получения производных амидов, сульфонамидов и фосфонамидов. Все перечисленные фрагменты пролекарств могут иметь в своей структуре дополнительные функциональные группы, такие как эфирные, амино и карбоксильные группы.

Настоящее изобретение также относится к фармацевтически активным метаболитам соединений формулы (I), которые также могут быть использованы в способах настоящего изобретения. «Фармацевтически активный метаболит» означает фармакологически активный продукт метаболизма в организме соединения формулы (I) или его соли. Пролекарства и активные метаболиты соединения могут быть определены с помощью обычных способов, известных и доступных специалистам в данной области. См., например, Bertolini, et al., J Med Chem. 1997, 40, 2011-2016; Shan, et al., J Pharm Sci. 1997, 86 (7), 765-767; Bagshawe, Drug Dev Res. 1995, 34, 220-230; Bodor, Adv Drug Res. 1984, 13, 224-331; Bundgaard, Design of Prodrugs (Elsevier Press, 1985); и Larsen, Design and Application of Prodrugs, Drug Design and Development (Krogsgaard-Larsen, et al., eds., Harwood Academic Publishers, 1991).

Соединения формулы (I) и их фармацевтически приемлемые соли, фармацевтически приемлемые пролекарства и фармацевтически активные метаболиты настоящего изобретения пригодны для использования в качестве модуляторов PHD в способах изобретения. Понятие «модуляторы» включает как ингибиторы, так и активаторы, где «ингибиторы» означает соединения, которые понижают, предотвращают, дезактивируют, десенсибилизируют или регулируют экспрессию или активность PHD на понижение, а «активаторы» - соединения, которые повышают, активируют, способствуют, сенсибилизируют или регулируют экспрессию или активность PHD на повышение.

Термин «лечить» или «лечение», используемый в настоящем документе, относится к назначению активного агента или соединения настоящего изобретения пациенту с целью терапевтического или профилактического благоприятного влияния посредством модуляции активности пролилгидроксилазы. Лечение включает обращение течения, улучшение, облегчение, замедление прогрессирования, уменьшение чувствительности или предотвращение заболевания, расстройства или состояния, или одного или более симптомов такого заболевания, расстройства или состояния, обусловленного модуляцией активности PHD. Термин «пациент» относится к млекопитающему пациенту, нуждающемуся в таком лечении, например, к человеку.

Соответственно, изобретение относится к способам использования соединений, описанных здесь, для лечения тех пациентов, у которых диагностировано заболевание, расстройство или состояние, обусловленное пролилгидроксилазой, такие как анемия, сосудистые расстройства, нарушения обмена веществ и заживление раны. Симптомы болезненных состояний должны быть включены в объем понятия «медицинские условия, расстройства или болезни».

Термин «гипоксия» или «гипоксическое расстройство», используемый в настоящем документе, относится к состоянию, при котором существует недостаточный уровень кислорода в крови или недостаточный уровень снабжения тканей или органов кислородом. В основе гипоксических расстройств могут лежать различные механизмы, включая недостаточную способность крови к переносу кислорода (т.е. анемия), неадекватный ток крови к ткани и (или) органу, причиной которого является либо сердечная недостаточность, либо блокада кровеносных сосудов и (или) артерий (т.е. ишемия), пониженное барометрическое давление (т.е. «горная болезнь» на больших высотах), или случаи, когда недееспособные клетки не способны использовать кислород должным образом (т.е. гистотоксические состояния). Соответственно, специалист в данной области сразу поймет, что настоящее изобретение будет полезным при лечении различных гипоксических состояний, включая анемию, сердечную недостаточность, ишемическую болезнь сердца, тромбоэмболию, инсульт, ангину и тому подобное.

В предпочтительном варианте осуществления молекулы настоящего изобретения пригодны для лечения или профилактики анемии, включая лечение анемических состояний, связанных с такими заболеваниями, как хроническое заболевание почек, поликистозное заболевание почек, гипопластическая анемия, аутоиммунная анемия, анемия трансплантации костного мозга, гранулематозный аллергический ангиит, врожденная гипопластическая анемия, синдром Фанкони, синдром Фелти, реакция «трансплантат против хозяина», трансплантация кроветворных стволовых клеток, гемолитический уремический синдром, миелодиспластический синдром, ночная пароксизмальная гемоглобинурия, остеомиелофиброз, панцитопения, истинная эритроцитарная аплазия, болезнь Шенлейна-Геноха, рефрактерная анемия с избытком бластов, ревматоидный артрит, синдром Швачмана, серповидно-клеточная анемия, большая талассемия, малая талассемия, тромбоцитопенический акроангиотромбоз, анемичные или неанимичные пациенты, проходящие хирургическое лечение, анемия, связанная с или являющаяся последствием травмы, сидеробластная анемия, анемия, являющаяся следствием иного лечения, в том числе: ингибиторы ревертазы для лечения ВИЧ, кортикостероидные гормоны, циклическая химиотерапия циспатин-содержащими или циспанитнесодержащими препаратами, алкалоиды барвинка, ингибиторы митоза, ингибиторы топоизомеразы II, антрациклины, алкилирующие агенты, в частности, анемия, являющаяся следствием воспаления, старения и (или) хронических заболеваний. Ингибирование PHD также может быть применимо для лечения симптомов анемии, включая хроническое утомление, бледность и головокружение.

В другом предпочтительном варианте осуществления молекулы настоящего изобретения применимы для лечения или профилактики заболеваний нарушения обмена веществ, включая, помимо прочего, диабет и ожирение. В другом предпочтительном варианте осуществления молекулы настоящего изобретения применимы для лечения или профилактики сосудистых расстройств. Эти расстройства включают, помимо прочего, следующее: заболевания, связанные с гипоксией или заживлением раны, для которых требуются проангиогенные посредники для образования и развития сосудов, развития кровеносных сосудов и артериогенеза

В способах лечения, в соответствии с данным изобретением, эффективное количество фармацевтического агента в соответствии с изобретением назначается пациенту с имеющимся или диагностированным заболеванием, расстройством или состоянием. «Эффективное количество» означает количество или дозировку, достаточную для достижения в общем желательного терапевтического или профилактического эффекта для пациента, нуждающегося в таком лечении при указанном заболевании, расстройстве или состоянии. Эффективные количества или дозы соединений настоящего изобретения могут быть оценены обычными способами, такими как моделирование, исследования с увеличением дозы или клинические исследования, а также с учетом обычных факторов, таких как режим или способ применения или доставки лекарства, фармакокинетика соединения, тяжесть и течение заболевания, расстройства или состояния, предыдущее или текущее лечение пациента, состояние здоровья и ответная реакция организма пациента на лекарство, а также оценка лечащего терапевта. Пример дозы находится в интервале от около 0,001 до около 200 мг соединения на 1 кг массы тела пациента в сутки, предпочтительно от около 0,05 до 100 мг/кг/сут, или от около 1 до 35 мг/кг/сут, единичной или дробной дозы (например, два раза в день, три раза в день, четыре раза в сутки). Для человека с массой тела 70 кг иллюстративный интервал допустимой дозировки составляет от около 0,05 до около 7 г/сут, или от около 0,2 до около 2,5 г/сут.

После улучшения состояния пациента, облегчения симптомов заболевания или расстройства дозировка может быть скорректирована для профилактического или поддерживающего лечения. Например, дозировка, частота введения или и то и другое могут быть снижены в зависимости от симптомов до уровня, при котором поддерживается желательный терапевтический или профилактический эффект от приема препарата. Разумеется, если симптомы облегчены до приемлемого уровня, лечение можно прекратить. Однако при наличии рецидивов симптомов пациенту может потребоваться долговременное периодическое лечение.

Кроме того, агенты изобретения могут быть использованы в комбинации с дополнительными активными ингредиентами для лечения вышеупомянутых состояний. Дополнительные соединения могут назначаться совместно, отдельно от агента формулы (I) или включая такой агент как дополнительный активный ингредиент в фармацевтическую композицию в соответствии с изобретением. В примере варианта осуществления дополнительными активными ингредиентами являются те, о которых известно, что они эффективны для лечения состояний, расстройств или заболеваний, опосредованных энзимом PHD, или те, которые активны против других целей, связанных с особым состоянием, расстройством или заболеванием, такие как альтернативный модулятор PHD. Комбинация может служить для повышения эффективности (например, путем включения в комбинацию соединения, повышающего действенность или эффективность соединения в соответствии с изобретением), уменьшения одного или нескольких побочных эффектов или снижения требуемой дозы соединения в соответствии с изобретением.

Соединения изобретения применимы сами по себе или в комбинации с одним или более другими активными ингредиентами для формулирования фармацевтических композиций настоящего изобретения. Фармацевтическая композиция изобретения состоит из: (a) эффективного количества соединения формулы (I) или фармацевтически приемлемой соли, фармацевтически приемлемого пролекарства или фармацевтически активного метаболита указанного; и (b) фармацевтически приемлемого наполнителя.

Термин «фармацевтически приемлемый наполнитель» означает нетоксичное, биологически переносимое и по остальным параметрам биологически допустимое для введения пациенту вещество, такое как инертное вещество, добавляемое в фармакологическую композицию или иным образом используемое в качестве средства доставки, носителя или разбавителя для облегчения введения агента и совместимое с последним. Примеры наполнителей включают карбонат кальция, фосфат кальция, различные сахара и типы крахмалов, производные целлюлозы, желатин, растительные масла и полиэтиленгликоли. Соответствующие наполнители могут также включать антиоксиданты. Такие антиоксиданты могут использоваться в составе фармацевтической композиции или среды для хранения для повышения сохраняемости фармацевтического препарата.

Формы доставки фармацевтических композиций, содержащих одну или более единиц дозирования соединения изобретения, могут быть приготовлены с использованием соответствующих фармацевтических наполнителей и способов составления, известных сейчас или в будущем или доступных специалисту в данной области. В способах изобретения композиции могут быть назначены путем местного применения, окулярно, орально, парентерально, ректально и путем ингаляции.

Препарат может быть в форме таблеток, капсул, саше, драже, порошков, гранул, пастилок, порошков для восстановления, жидких препаратов или суппозиториев. Предпочтительно композиции сформулированы для внутривенного вливания, местного применения или перорального введения. Предпочтительным способом использования изобретения является местное применение ингибиторов PHD, в частности, в тех местах, где ткань стала ишемической или была приведена в ишемическое состояние. Это может быть выполнено специальным катетером, баллончиком для ангиопластики или баллончиком, расположенным на стенте.

Для перорального введения соединения изобретения могут быть представлены в форме таблеток или капсул, либо в виде раствора, эмульсии или суспензии. Для приготовления композиций для перорального введения соединения могут быть сформулированы так, чтобы давать определенную дозу, например от около 0,05 до около 100 мг/кг в сутки, или от около 0,05 до около 35 мг/кг в сутки, или от около 0,1 до около 10 мг/кг в сутки.

Таблетки для перорального введения могут включать соединение в соответствии с изобретением, смешанные с фармацевтически приемлемыми наполнителями, такими как инертные разбавители, вещества для улучшения распадаемости таблеток, связывающие агенты, смазывающие вещества, подсластители, вкусовые добавки, красители и консерванты. Соответствующие инертные наполнители включают карбонаты натрия и кальция, фосфаты натрия и кальция, лактозу, крахмал, сахар, глюкозу, метилцеллюлозу, стеарат магния, маннитол, сорбитол и т.п. Примеры жидких наполнителей для орального введения включают этанол, глицерин, воду и т.п. Крахмал, поливинилпирролидон (PVP), натрия гликолят крахмала, микрокристаллическая целлюлоза и альгиновая кислота являются допустимыми веществами для улучшения распадаемости таблеток. Связывающие агенты могут включать крахмал и желатин. Смазывающим агентом, при его наличии, может быть стеарат магния, стеариновая кислота или тальк. При необходимости таблетки могут быть покрыты таким материалом, как глицерилмоностеарат или глицерилдистеарат, для замедления всасывания в желудочно-кишечном тракте, или могут иметь энтеросолюбельную оболочку.

Капсулы для орального применения могут быть твердыми и мягкими желатиновыми. Для приготовления твердых желатиновых капсул соединения изобретения могут быть смешаны с твердым, полужидким или жидким разбавителем. Мягкие желатиновые капсулы могут быть приготовлены путем смешивания соединения изобретения с водой или маслом, таким как арахисовое масло или оливковое масло, с жидким парафином, смесью моно- и диглицеридов жирных кислот с короткой цепью, полиэтиленгликолем 400 или пропиленгликолем.

Жидкости для орального применения могут быть в форме суспензий, растворов, эмульсий или сиропов, или могут быть представлены в виде сухого продукта для восстановления водой или иным допустимым носителем перед применением. В состав подобных жидких композиций могут входить следующие компоненты: фармацевтически приемлемые наполнители, такие как суспендирующие агенты (например, сорбитол, метилцеллюлоза, альгинат натрия, желатин, гидроксиэтилцеллюлоза, карбоксиметилцеллюлоза, гелеобразный стеарат алюминия и т.д.); неводные носители, например масла (например, миндальное масло или фракционированное кокосовое масло), пропиленгликоль, этиловый спирт или вода; консерванты (например, метил- или пропил-п-гидроксибензоат или сорбиновая кислота); смачивающие агенты, такие как лецитин; а также, при необходимости, ароматизаторы или красители.

Активные агенты, составляющие предмет настоящего изобретения, могут также вводиться пациенту непероральными путями. Например, соединения могут быть сформулированы для ректального применения в виде суппозиториев. Для парентерального введения, включая внутривенное, внутримышечное, внутрибрюшинное или подкожное, соединения изобретения могут быть представлены в виде стерильных водных растворов или суспензий, буферных с адекватным рН и изотоничностью или в парентерально приемлемом масле. Соответствующие жидкие носители включают раствор Рингера и изотонический раствор хлорида натрия. Такие формы будут представлены в форме стандартной дозировки, такой как ампулы или одноразовые приспособления для инъекций, в форме нескольких доз, таких как колбы, из которых может быть отобрана адекватная доза, или в твердой форме или в форме первичного концентрата, который может быть использован для приготовления составов, пригодных для введения. Иллюстративные дозировки для вливания могут варьировать от около 1 до 1000 мкг/кг/мин соединения, перемешанного с фармакологическим носителем за время от нескольких минут до нескольких суток

Для местного введения соединения могут быть смешаны с фармацевтическим носителем в концентрации от около 0,1% до около 10% лекарства в носителе. В другом способе введения соединения настоящего изобретения могут использоваться в виде пластыря для трансдермальной доставки.

Соединения изобретения могут альтернативно вводиться в способах настоящего изобретения путем ингаляции, через нос или рот, например, в виде спрея, содержащего также допустимый носитель.

Аббревиатуры и акронимы, используемые в настоящем документе, включают следующие:

Термин Акроним
Диизопропилэтиламин DIEA
Тетрагидрофуран THF
Дихлорметан DCM
Диметилсульфоксид DMSO
2-метоксиэтоксиметилхлорид MEMCl или MEM-хлорид
N,N-диметилформамид DMF
Этанол EtOH
Ацетонитрил ACN
Этилацетат EtOAc
N-(3-диметиламинопропил)-N-этилкарбодиимид EDCI
1,8-диазобицикло[5.4.0]ундек-7-ен DBU
Дихлорэтан DCE
1,2,3,4,5-пентафенил-1'-(ди-t-бутилфосфино)ферроцен Q-Phos®
N-хлорсукцинимид NCS
N-бромсукцинимид NBS

Ниже описаны примеры соединений, пригодных для применения в способах настоящего изобретения путем ссылок на иллюстративные схемы синтеза для их общего приготовления, а также с последующими конкретными примерами. Как станет ясно специалистам, для получения различных соединений исходные материалы могут быть выбраны соответствующим образом, так чтобы желаемые заместители сохранялись в соответствии со схемой реакции при наличии или отсутствии защиты, в зависимости от ситуации, и давали желаемый продукт. В качестве альтернативы может быть необходимо или желательно ввести вместо желаемого заместителя соответствующую группу, которая может быть проведена через схему реакции и затем заменена соответствующим образом на требуемый заместитель. Если не указано иное, переменные соответствуют определениям выше в отношении формулы (I). Реакции могут проводиться в промежутке между температурой плавления и температурой флегмы растворителя и предпочтительно между 0°C и температурой флегмы растворителя. Реакции также могут проводиться в герметичном сосуде под давлением выше температуры флегмы растворителя.

В каждой из представленных здесь схем цифры для каждой формулы приведены только для удобства. Несмотря на то что приведенные ссылки, как правило, относятся к конкретной схеме, тем не менее, эти ссылки не должны рассматриваться как ограничивающие, и каждая схема, включая все ее элементы, широко применима для различных вариантов реализации настоящего изобретения.

Схема A

Со ссылкой на Схему A, защита 2-хлор-1H-бензоимидазолов (II) достигается с использованием реагента с соответствующей защитной группой, такого как 2-метоксиэтоксиметилхлорид (MEMCl) или 2-(триметилсилил)-этоксиметилхлорид (SEMCl) в присутствии основания, такого как NaH или DIPEA в растворителе, таком как THF, что дает соединения формулы (III). Замещение 2-хлорзаместителя с использованием имеющихся на рынке пиразол-4-карбоксилатов формулы (IV), где R2 и R3 представляют собой оба H, CF3 или CH3, выполняется в полярном апротонном растворителе, таком как DMF, N,N-диметилацетамид (DMA), или THF, или в их смеси, в присутствии соответствующего основания, такого как Cs2CO3, K2CO3, Na2CO3, NaH или их смеси, при повышенных температурах, как правило, в интервале от 80°C до 120°C. Последующее снятие защиты с защищенной группы с использованием кислоты, такой как HCl, в подходящем растворителе, таком как EtOH, дает промежуточные соединения формулы (VIII). Омыление допустимым основанием, таким как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или его смесь в растворителе, таком как THF, дает соединения формулы (I).

Схема B

Ариловый эфир и ариловый тиоэфир, промежуточные соединения формулы (VIII), приготавливают по Схеме B, где каждый R1 может быть H, -Cl, -F, -CF3 или -OCF3, при условии, что по меньшей мере один R1 представляет собой -Cl или -F. Имеющиеся на рынке замещенные галогеннитрофениламины (VII) вступают в реакцию с замещенными фенолами, тиофенолами и замещенными фенил-алкилфенолами в присутствии основания, такого как K2CO3, в растворителе, таком как DMF и тому подобное, при температурах от комнатной температуры до температуры флегмы растворителя, с образованием промежуточных соединений с нитрогруппами формулы (VIII), где Re представляет собой арил, -C1-4алкиларил или гетероарильное кольцо. Алкиловый эфир и тиоалкиловый эфир, промежуточные соединения формулы (VIII), где Re представляет собой C1-6алкил (с прямой или разветвленной цепью), приготавливают по реакции необязательно замещенных галоген-нитрофениламинов со спиртами и алкилтиолами в присутствии основания, такого как метоксид натрия, трет-бутоксид натрия и тому подобное, в растворителе, таком как MeOH, при температурах от комнатной температуры до температуры флегмы растворителя. Реакции могут также проводиться в герметично закрытой трубке при температурах выше температуры флегмы растворителя. Тиоалкилы, промежуточные соединения формулы (VIII), также синтезируют по реакции необязательно замещенных галогеннитрофениламинов формулы (VII) с тиометоксидом натрия, тиоэтоксидом натрия, тиоизопропоксидом натрия и тому подобное, в растворителе, таком как DMF, при температурах от 80°C до 100°C.

Промежуточные соединения с аминогруппами формулы (X) приготавливают в соответствии со Схемой B, где R1 представляет собой H, -Cl, -F, -CF3 или -OCF3. Замещенные галоген-нитро-фениламины (IX) и циклоалкил- и гетероциклоалкиламины нагревают в герметично закрытой трубке при температурах от 80°C до 100°C, что дает промежуточные соединения с нитрогруппами формулы (X).

Схема C

2-нитрофениламины (XIV) приготавливают по Схеме C. Амины общей формулы (XI), где один или более R1s представляют собой H, -Cl -CN, -F и -CF3, вступают в реакцию с уксусным ангидридом в растворителе, таком как толуол, в присутствии основания, такого как DMAP, при температурах от комнатной температуры до температуры кипения растворителя, в результате чего получают ацетилированные промежуточные соединения формулы (XII). Последующее нитрование проводят по реакции промежуточных соединений формулы (XII) с нитрующим реагентом, таким как KNO3, и кислотой, такой как серная кислота, при температуре 0°C, в результате чего получают нитрованные промежуточные соединения формулы (XIII). Последующее снятие защиты с ацетильной группы с использованием водного раствора кислоты, такой как хлористоводородная кислота, при нагревании, дает нитроанилины формулы (XIV).

Схема D

В соответствии со Схемой D, 2-галогеннитроанилины формулы (XVI) приготавливают по реакции нитроанилинов формулы (XV) с хлорирующим или бромирующим реагентом, таким как NCS или NBS, при температурах от 80°C до 120°C, в растворителе, таком как DMF. Кроме того, на галогеннитробензольные промежуточные соединения формулы (XVII), где R1 представляет собой независимо -F и -Br, воздействуют раствором аммиака в MeOH (концентрация 7M) и нагревают обычным образом или в герметично закрытой трубке до температур от 50°C до 70°C, в результате чего получают галогеннитроанилины формулы (XVIII).

Схема E

2-хлор-1H-бензоимидазолы, промежуточные соединения формулы (XXV), приготавливают по трем методикам, как показано на Схеме E. Замещенные нитрофениламины (либо имеющиеся на рынке нитрофениламины, либо известные нитрофениламины, либо нитрофениламины, приготовленные в соответствии со схемами) восстанавливают по общеизвестным методикам восстановления, таким как порошок цинка, в присутствии насыщенного водного раствора NH4Cl в растворителе, таком как ацетон и т.п., при температурах от 0°C до комнатной температуры, в результате чего получают диамины, промежуточные соединения формулы (XX). Реакция диаминовых промежуточных соединений формулы (XX), либо имеющихся на рынке, либо синтезированных, с карбонилдиимидазолом, в растворителе, таком как THF и т.п., при температурах от 0°C до комнатной температуры, дает 1,3-дигидробензоимидазол-2-оны, промежуточные соединения формулы (XXI). Последующее хлорирование (XXI) по общеизвестным методикам, например, применение чистого оксихлорида фосфора (POCl3) при нагревании, дает 2-хлор-1H-бензоимидазолы формулы (XXII). Последующая защита 1H-бензоимидазолов (XXII) достигается с помощью соответствующего реагента для блокирования реакционноспособной группы, такого как диметилсульфамоилхлорид, 2-метоксиэтоксиметилхлорид (MEMCl) или 2-(триметилсилил)-этоксиметилхлорид (SEMCl), в присутствии допустимого основания в растворителе, таком как THF или DMF, что дает соединения формулы (XXV).

Кроме того, бензоимидазолы формулы (XXIII) приготавливают по однореакторному методу синтеза из ортонитроанилинов по реакции восстановительной циклизации в присутствии соответствующего восстановителя, такого как SnCl2.H2O, дитионат натрия и т.п., в присутствии альдегида или эквивалента альдегида, такого как триметилортоформиат и т.п., или кислоты, такой как уксусная кислота, муравьиная кислота и т.п., при нагреве обычным способом, нагреве в герметично закрытой трубке или нагреве микроволновым излучением, при температурах от 80°C до 130°C. Помимо реакции однореакторной восстановительной циклизации, описанной выше, 1H-бензоимидазолы формулы (XXIII) также синтезируют по реакции диаминов формулы (XX) в присутствии альдегида или эквивалента альдегида, такого как триметилортоформиат, и кислоты, такой как HCl, при температурах от 0°C до комнатной температуры. Последующая защита 1H-бензоимидазолов (XXIII) достигается с помощью допустимого реагента для блокирования реакционноспособной группы, такого как 2-метоксиэтоксиметилхлорид (MEMCl) или 2-(триметилсилил)-этоксиметилхлорид (SEMCl), в присутствии основания, такого как NaH или DIPEA, в растворителе, таком как THF, что дает соединения формулы (XXIV). Депротонирование защищенного 1H-бензоимидазола, промежуточного соединения формулы (XXIV), с использованием литийорганического основания, такого как бутиллитий или диизопропиламид лития, в растворителе, таком как THF, при температурах от -80°C до -40°C, и последующее добавление N-хлорсукцинимида и тому подобного, дает 2-хлор-1H-бензоимидазолы, промежуточные соединения формулы (XXV).

Схема F

Со ссылкой на Схему F, соединения формулы (III), где W представляет собой -CO2C1-4алкил и R1 представляет собой H, -F, -Cl, -CF3 или -OCF3, омыляют с использованием допустимого основания, такого как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь, при температурах от комнатной температуры до температуры кипения растворителя, в растворителе, таком как THF, в результате чего получают соединения формулы (XXVI). Последующее образование амидной связи по общеизвестным методикам дает бензоимидазолы, промежуточные соединения формулы (XXVII). В качестве альтернативы, бензоимидазолы, промежуточные соединения формулы (III), где W представляет собой -CO2Me, восстанавливают с использованием соответствующего восстановителя, такого как алюмогидрид лития, в растворителе, таком как THF, при температуре 0°C, для получения соответствующих спиртов, промежуточных соединений формулы (XXVIII). Алкилирование промежуточного соединения (XXVIII) с использованием основания, такого как NaH, алкилирующего реагента, такого как алкилгалогениды или арилгалогениды, в растворителе, таком как DMF, дает бензоимидазолы, промежуточные соединения формулы (XXIX).

Схема G

Со ссылкой на Схему G, бензоимидазолы, промежуточные соединения формулы (XXX) в условиях реакции перекрестного сочетания Сузуки, где W представляет собой допустимый галоген или трифлат, и каждый R1 представляет собой независимо H, -Cl, -F, -CF3 или -OCF3, реагируют с арилбороновыми кислотами или эфирами, в присутствии металлических катализаторов органического синтеза, таких как PdCl2(dppf), и допустимого основания, такого как CsF, что дает биарильные промежуточные соединения формулы (XXXI), где Y представляет собой замещенное или незамещенное арильное или гетероарильное кольцо.

Со ссылкой на Схему G, бензоимидазолы, промежуточные соединения формулы (XXX), где W представляет собой -S-C1-4алкил или -S-Ar (где Ar представляет собой соответственно замещенную фенильную группу), и каждый R1 представляет собой независимо H, -F, -Cl, -CF3 или -OCF3, окисляют по общеизвестным методикам, например, используя окислитель, такой как пероксомоносульфат калия, 3-хлорпероксибензойная кислота и т.п., в результате чего получают соответствующие сульфоновые и сульфоксидные промежуточные соединения формулы (XXXI), где Y представляет собой -S(O)-C1-4алкил, -S(O)2-C1-4алкил, -S(O)-арил или -S(O)2-арил.

Со ссылкой на Схему G, бензоимидазолы, промежуточные соединения формулы (XXX), где W представляет собой -NO2 и каждый R1 представляет собой независимо H, -Cl, -F, -CF3 или -OCF3, подвергают реакции с восстановителем по общеизвестным методикам, что дает бензоимидазолы, промежуточные соединения формулы (XXXI), где Y представляет собой --NH2 и R1 представляет собой -Cl, -CF3 или -OCF3.

Со ссылкой на Схему G, бензоимидазолы, промежуточные соединения формулы (XXX), где W представляет собой -NH2 и каждый R1 представляет собой независимо H, -Cl, -F, -CF3 или -OCF3, в условиях восстановительного аминирования по общеизвестным методикам, подвергают реакции с алкилальдегидами и замещенными арилальдегидами, что дает алкил- и бензилзамещенные аминопроизводные, промежуточные соединения формулы (XXXI), где Y представляет собой -NH-C1-4алкил или -NH-CH2-арил.

Со ссылкой на Схему G, бензоимидазолы, промежуточные соединения формулы (XXX), где W представляет собой -NH2 и каждый R1 представляет собой независимо H, -Cl, -F, -CF3 или -OCF3, подвергают реакции с алкил-, арил- и циклоалкилсульфонилхлоридами, ацил- и арилхлоридами, 2-бромацетилбромидами и т.п., что дает соответствующие замещенные сульфонамидные и амидные промежуточные соединения.

Со ссылкой на Схему G, бензоимидазолы, промежуточные соединения формулы (XXX), где W представляет собой -NH2 и каждый R1 представляет собой независимо H, -Cl, -F, -CF3 или -OCF3, подвергают реакции в условиях аминирования с арилбромидом, с металлическим катализатором органического синтеза, таким как Pd(dba)2, лигандом, таким как Q-Phos, допустимым основанием, таким как трет-бутоксид натрия, в растворителе, таком как толуол, при температурах от комнатной температуры до температуры кипения растворителя, что дает промежуточные соединения формулы (XXXI), где Y представляет собой -NHAr.

Со ссылкой на Схему G, бензоимидазолы, промежуточные соединения формулы (XXX), где W представляет собой -NC(O)CH2Br и каждый R1 представляет собой независимо H, -Cl, -F, -CF3 или -OCF3, подвергают реакции с гетероциклоалкиламинами, такими как морфолин, N-метилпиперазин, пиперидин и т.п., в растворителе, таком как дихлорметан, при температурах от 0°C до комнатной температуры, что дает замещенные ацетил-амино бензоимидазольные промежуточные соединения.

Со ссылкой на Схему G, бензоимидазолы, промежуточные соединения формулы (XXX), где W представляет собой -S-tBu и каждый R1 представляет собой независимо H, -F, -Cl, -CF3 или -OCF3, обрабатывают 2-нитробензолсульфенилхлоридом в присутствии основания, такого как K2CO3, что дает дисульфидное промежуточное соединение. Последующее восстановление дисульфида с помощью восстановителя, такого как NaBH4, в водном EtOH, при температуре 0°C дает тиоловое промежуточное соединение (в определенных условиях тиоловое промежуточное соединение может димеризоваться с образованием дисульфида в качестве побочного продукта реакции). Алкилирование тиола с использованием бензил- и алкилбромидов в присутствии основания, такого как K2CO3, дает тиоалкилированные бензоимидазолы, промежуточные соединения формулы (XXXI), где Y представляет собой -S-C1-4алкил или -S-C1-4алкил-арил. Кроме того, дисульфид, побочный продукт реакции, описанной выше, подвергают реакции с NCS и водным раствором HCl в растворителе, таком как ацетонитрил, при температуре 0°C, что дает хлорсульфонильные промежуточные соединения (A. Nishiguchi, K. Maeda, S. Miki. Synthesis, 2006, 24, 4131-4134), последующая реакция которых с соответствующим амином в растворителе, таком как пиридин, дает арилсульфамоилы, промежуточные соединения формулы (XXXI), где Y представляет собой -SO2-NH-арил.

Снятие защиты с блокированных реакционных групп промежуточных соединений (XXXI) с использованием кислоты, такой как HCl, в соответствующем растворителе, таком как EtOH, и последующее омыление карбоксигруппы на кольце пиразола с использованием допустимого основания, такого как водный раствор NaOH, водный раствор LiOH или водный раствор KOH или их смесь в растворителе, таком как THF, при температурах от комнатой температуры до температуры флегмы растворителя, дает соединения формулы (I).

Кроме того, превращение промежуточных соединений формулы (XXXI) в соединения формулы (I) достигается в одну стадию с использованием уксусной кислоты и водного раствора хлористоводородной кислоты при температурах от 80°C до 100°C.

Схема H

Бензоимидазолы формулы (VI) также можно приготовить в соответствии со Схемой H. Броманилины общей формулы (XXXII) обрабатывают бензоилизоцианатом в растворителе, таком как толуол, в присутствии основания, такого как DMAP, при комнатной температуре, что дает соответствующее производное тиомочевины формулы (XXXIII). Бензоильную группу удаляют с использованием основания, такого как метоксид натрия, в растворителе, таком как MeOH, при температуре 0°C, что дает производное тиомочевины формулы (XXXIV). Реакция тиомочевин формулы (XXXIV) с тригидратацетатом свинца (II) в присутствии основания, такого как гидроксид калия, в растворителе, таком как вода, при температурах от 80°C до 100°C, дает цианамидные промежуточные соединения формулы (XXXV). Последующая реакция цианамидных промежуточных соединений с этиловым эфиром 1H-пиразол-4-карбоновой кислоты, в присутствии безводной кислоты, такой как HCl, в растворителе, таком как диоксан, при повышенных температурах от 80°C до 100°C, дает гуандиновые промежуточные соединения формулы (XXXVI). Дальнейшая обработка гуандиновых промежуточных соединений реагентом реакции сочетания, таким как CuI, и основанием, таким как Cs2CO3, в растворителе, таком как DMF, при температурах от 60°C до 100°C, дает бензоимидазолы, промежуточные соединения формулы (VI).

Схема I

Бензоимидазолы, промежуточные соединения формулы (XXXIX), синтезируют в соответствии со Схемой I. Имеющийся на рынке этиловый эфир 1H-пиразол-4-карбоновой кислоты (IV), обрабатывают цианамидом в растворителе, таком как диоксан, в присутствии кислоты, такой как раствор 4M HCl в диоксане, при температурах от 80°C до 100°C, что дает этиловые эфиры карбамимидоил-пиразол-4-карбоновой кислоты формулы (XXXVII). Последующая реакция этиловых эфиров карбамимидоил-пиразол-4-карбоновой кислоты (XXXVII) с имеющимися на рынке 2,3-дигалоген-ароматическими промежуточными соединениями формулы (XXXVIII), где Z представляет собой один или два N (например, 2,3-дихлор-хиноксалин), и основанием, таким как Cs2CO3 (по желанию можно применять катализатор, такой как CuI и т.п.), в растворителе, таком как DMF, DMA и т.п., при температурах от комнатной температуры до температуры кипения растворителя, дает бензоимидазолы, промежуточные соединения формулы (XXXIX).

Соединения формулы (I) могут быть переведены в соответствующие соли с применением способов, известных специалистам в данной области. Например, кислоты формулы (I) могут быть обработаны K2CO3 в воде в растворителе, таком как EtOH, при температурах от комнатной температуры до температуры флегмы растворителя, что дает соответствующие формы соли.

Соединения, приготовленные в соответствии со схемами, описанными выше, могут быть получены как отдельно взятые энантиомеры, диастереомеры или региоизомеры путем энантио-, диастерео- или региоспецифичного синтеза, или путем разделения. Соединения, приготовленные в соответствии со схемами, описанными выше, альтернативно могут быть получены как рацемические (1:1) или нерацемические (не 1:1) смеси или как смеси диастереомеров или региоизомеров. В том случае, если получают рацемические и нерацемические смеси энантиомеров, отдельно взятые энантиомеры могут быть выделены с помощью традиционных способов разделения, известных специалистам в данной области, таких как хиральная хроматография, рекристаллизация, образование диастереомерной соли, превращение в диастереомерные аддукты, биотрансформация или ферментная трансформация. В том случае, если получают региоизомерные или диастереомерные смеси, отдельно взятые изомеры могут быть приготовлены традиционными способами, такими как хроматография или кристаллизация.

Если требование к исходным материалам включало определенное стереоспецифическое химическое строение аминокислот, то эти материалы приобретались в виде предпочтительных стереоспецифических энантиомеров, сохранявших свою специфичность в ходе реакций синтеза.

В следующих примерах более подробно иллюстрируется настоящее изобретение и предпочтительные варианты его осуществления.

Соединения, приготовленные в соответствии со схемами, описанными выше, могут быть получены как отдельно взятые энантиомеры, диастереомеры или региоизомеры путем энантио-, диастерео- или региоспецифичного синтеза, или путем разделения. Соединения, приготовленные в соответствии со схемами, описанными выше, альтернативно могут быть получены как рацемические (1:1) или нерацемические (не 1:1) смеси или как смеси диастереомеров или региоизомеров. В том случае, если получают рацемические и нерацемические смеси энантиомеров, отдельно взятые энантиомеры могут быть выделены с помощью традиционных способов разделения, известных специалистам в данной области, таких как хиральная хроматография, рекристаллизация, образование диастереомерной соли, превращение в диастереомерные аддукты, биотрансформация или ферментная трансформация. В том случае, если получают региоизомерные или диастереомерные смеси, отдельно взятые изомеры могут быть приготовлены традиционными способами, такими как хроматография или кристаллизация.

Если требование к исходным материалам включало определенное стереоспецифическое химическое строение аминокислот, то эти материалы приобретались в виде предпочтительных стереоспецифических энантиомеров, сохранявших свою специфичность в ходе реакций синтеза.

В следующих примерах более подробно иллюстрируется настоящее изобретение и предпочтительные варианты его осуществления.

Примеры

Химия.

Если не указано иное, для получения описанных в приведенных ниже примерах соединений и соответствующих аналитических данных использовались следующие экспериментальные и аналитические процедуры.

Если не указано иное, реакционные смеси перемешивали на магнитной мешалке при комнатной температуре (кт). Если растворы были «осушены», то, как правило, для этого использовали осушающий агент, такой как Na2SO4 или MgSO4. Если смеси, растворы и экстракты были «концентрированы», то обычно их концентрировали на роторном испарителе при пониженном давлении.

Тонкослойную хроматографию (ТСХ) выполняли на пластинах с нанесенным силикагелевым покрытием Merck silica gel 60 F254 2,5×7,5 см 250 мкм или 5,0×10,0 см 250 мкм. Препаративную тонкослойную хроматографию выполняли на пластинах с нанесенным силикагелевым покрытием EM Science silica gel 60 F254 20×20 см 0,5 мм с концентрирующей зоной 20×4 см.

Колоночную флэш-хроматографию с нормальной фазой (КФХ) выполняли на силикагелевых колонках (SiO2), элюируемых 2 M раствором NH3 в MeOH/DCM, если не указано иное. Обратнофазовую ВЭЖХ выполняли на приборе Hewlett Packard HPLC 1100 с колонкой Phenomenex Luna C18 (5 мкм, 4,6×150 мм). Детекцию вели на λ=230, 254 и 280 нм. Используемый градиент составлял от 10 до 99% ацетонитрил/вода (0,05% трифторуксусная кислота) в течение 5,0 мин при скорости протока 1 мл/мин. В качестве альтернативы, ВЭЖХ выполняли на приборе Dionex APS2000 LC/MS с колонкой Phenomenex Gemini C18 (5 мкм, 30×100 мм), используемый градиент составлял от 5 до 100% ацетонитрил/вода (20 мМ NH4OH) в течение 16,3 мин при скорости протока 30 мл/мин.

Если не указано иное, масс-спектры (МС) получали на приборе Agilent серии 1100 MSD, оснащенном многорежимным ESI/APCI-источником положительной и отрицательной ионизации.

Спектры ЯМР (NMR) получали на спектрометрах Bruker, модель DRX. Ниже приведен формат представления данных 1H ЯМР: химический сдвиг в миллионных долях в сторону слабого поля от сигнала, используемого в качестве стандарта тетраметилсилана (наблюдаемая мультиплетность, константа спин-спинового взаимодействия J в Гц, интеграл). Химические наименования генерировали с использованием программного обеспечения ChemDraw версии 6.0.2 (CambridgeSoft, Cambridge, MA) или ACD/Name версии 9 (Advanced Chemistry Development, Toronto, Ontario, Канада).

Пример 1: 1-(1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: приготовление 2-хлор-1-(2-триметилсиланилэтоксиметил)-1H-бензоимидазола. В соответствии со Схемой A, смесь NaH (60% дисперсия в масле, 0,40 г, 9,8 ммоль) и THF (10 мл) охлаждали до 0°C, затем в течение 10 мин добавляли по частям твердый 2-хлорбензоимидазол (1,0 г, 6,5 ммоль). Полученную смесь перемешивали при 0°C в течение 1 ч, после чего добавляли 2-(триметилсилил)-этоксиметилхлорид (1,5 мл, 8,5 ммоль). Реакционной смеси дали нагреться до температуры 23°C и перемешивали в течение 16 ч. Смесь аккуратно наливалась на лед (200 г), а затем экстрагировалась с помощью Et2O (3×100 мл). Объединенные органические экстракты высушили, отфильтровали и сконцентрировали. Осадок очистили (КФХ) (от 1:99 до 15:85 EtOAc/гексаны) с получением искомого соединения, которое было описано ранее (WO 2005/012296, Janssen Pharmaceutica N.V., Example 7).

Стадия B: 1-[1-(2-триметилсиланилэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты этиловый эфир. Смесь 2-хлор-1-(2-триметилсиланилэтоксиметил)-1H-бензоимидазола (0,34 г, 1,2 ммоль), этилприазол-4-карбоксилата (0,24 г, 1,7 ммоль), карбоната цезия (0,78 г, 2,4 ммоль) и безводного DMF (2,5 мл) перемешивали при 100°C в течение 5 ч. Смеси дали возможность охладиться до 23°C и развели ее EtOAc, после чего профильтровали через подушку из силикагеля. Полученный раствор сконцентрировали. Осадок очистили (КФХ) (от 5:95 до 40:60 EtOAc/гексаны) с получением искомого соединения (0,36 г, 77%). 1H ЯМР (500 МГц, CDCl3): 8,88 (с, 1H), 8,18 (с, 1H), 7,77-7,69 (м, 1H), 7,60-7,50 (м, 1H), 7,40-7,30 (м, 2H), 6,03 (с, 2H), 4,34 (к, J=7,1 Гц, 2H), 3,57-3,50 (м, 2H), 1,37 (т, J=7,1, Гц, 3H), 0,87-0,80 (м, 2H), -0,11 (с, 9H).

Стадия C: этилового эфира 1-(1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты гидрохлорид. Раствор HCl и диоксана (4M, 2 мл, 8 ммоль) добавили в смесь этилового эфира 1-[1-(2-триметилсиланилэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиррол-3-карбоновой кислоты (0,30 г, 0,78 ммоль) и EtOH (4 мл). Реакционную смесь нагревали при температуре флегмы в течение 30 мин, после чего охлаждали до 23°C. Добавили Et2O (20 мл) и смесь охладили до 0°C на срок 10 мин. Полученный осадок собрали фильтрацией и хорошо промыли Et2O с получением искомого соединения (0,18 г, 91%). Масс-спектроскопия (ESI/CI): расч. масса для C13H12N4O2, 256,3; получено m/z: 257,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,96 (с, 1H), 8.33 (с, 1H), 7,56 (с, 2H), 7,28-7,21 (м, 2H), 4,30 (к, J=7,1 Гц, 2H), 1,32 (т, J=7,1 Гц, 3H)

Стадия D: 1-(1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Раствор LiOH и H2O (1,0 M, 1,0 мл, 1,0 ммоль) добавили к смеси гидрохлорида этилового эфира 1-(1H-бензоимидазол-2-ил)-1H-пиррол-3-карбоновой кислоты (0,040 г, 0,16 ммоль) и THF (2,0 мл) и реакционную смесь перемешивали при 23°C в течение 16 ч. THF удалили под вакуумом, после чего добавили водный раствор HCl (1,0 M, 2 мл, 2 ммоль) при температуре 0°C. Полученный осадок собрали и промыли водой с получением искомого соединения (0,033 г, 90%). Масс-спектроскопия (ESI/CI): расч. масса для C11H8N4O2, 228,2; получено m/z: 229,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,32 (с, 1H), 13,00-12,86 (уш. с, 1H), 8,90 (д, J=0,6 Гц, 1H), 8,28 (д, J=0,6 Гц, 1H), 7,64 (д, J=4,6 Гц, 1H), 7,49 (д, J=5,5 Гц, 1H), 7,28-7,20 (м, 2H).

Пример 2: 1-(5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Способ A:

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2,5,6-трихлор-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H6Cl2N4O2, 297,1; получено m/z: 296,0 [M-H]-. 1H ЯМР (500 МГц, DMSO-d 6): 14,18-12,52 (уш с, 2H), 8,89 (д, J=0,5 Гц, 1H), 8,31 (д, J=0,5 Гц, 1H), 7,80 (с, 2H).

Способ B:

Стадия A: 5,6-дихлор-1,3-дигидробензоимидазол-2-он: К раствору 4,5-дихлорбензол-1,2-диамина (25 г, 0,14 моль) в безводном DMF (200 мл), добавили CDI (23 г, 0,14 моль) в виде твердого вещества. Реакционную смесь перемешивали при комнатной температуре в течение 1 ч, после чего добавили воду (500 мл). Выпавший твердый осадок собирали фильтрацией, отмывали водой и тщательно высушивали с получением искомого вещества (26,0 г, 90%). Неочищенный продукт использовали в описанной ниже реакции без дальнейшей очистки.

Стадия B: 2,5,6-трихлор-1H-бензоимидазол: тщательно высушенный 5,6-дихлор-1,3-дигидробензоимидазол-2-он (28,4 г, 0,14 моль) суспендировали в POCl3 (75 мл). Реакционный раствор нагревали при температуре флегмы в течение 3 ч и затем охлаждали до комнатной температуры. Раствор медленно, при постоянном перемешивании, заливали на смесь колотого льда и воды (1,5 л). Раствор нейтрализовали с помощью NaOH до pH=7,0. Выпавший твердый осадок собирали фильтрацией, отмывали водой и высушивали с получением искомого вещества (27,9 г, 90%). Неочищенный продукт использовали в описанной ниже реакции без дополнительной очистки.

Стадия C: 1-(5,6-дихлор-1-диметилсульфамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты этиловый эфир. 2,5,6-трихлор-1H-бензоимидазол 2 (27,6 г, 0,125 моль) растворяли в безводном DMF (200 мл), после чего добавляли K2CO3 (20,7 г, 0,15 моль) и диметилсульфамоила хлорид (17,9 г, 0,125 моль). Реакционную смесь перемешивали при комнатной температуре в течение 16 ч. Анализ методом ВЭЖХ показал образование в результате реакции диметиламида 2,5,6-трихлорбензоимидазол-1-сульфоновой кислоты. В тот же сосуд, без выделения диметиламида 2,5,6-трихлорбензоимидазол-1-сульфоновой кислоты, добавили этиловый эфир 1H-пиразол-4-карбоновой кислоты (17,5 г, 0,125 моль) и K2CO3 (20,7 г, 0,15 моль). Реакционную смесь перемешивали при 70°C в течение 4 ч, после чего, пока реакционная смесь была еще горячей, добавили воду (500 мл). Реакционный раствор охладили до комнатной температуры. Выпавшее в осадок твердое вещество отделили фильтрацией, промыли водой и высушили. Неочищенный продукт использовали в описанной ниже реакции без дополнительной очистки.

Стадия D: 1-(5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Неочищенный этиловый эфир 1-(5,6-дихлор-1-диметилсульфамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты растворили в THF (125 мл), после чего добавили раствор LiOH·H2O (21 г, 0,5 моль) в воде (250 мл). Реакционную смесь перемешивали при температуре флегмы в течение 2 ч и охлаждали до комнатной температуры. Добавили концентрированную HCl, доведя pH до 2,0. Выпавшее в осадок твердое вещество отделили фильтрацией, промыли водой и высушили. Твердое вещество растолкли в горячем EtOAc (1 л). После охлаждения до комнатной температуры и фильтрации было получено чистое соединение в виде желтовато-коричневого твердого вещества (18,5 г, 50%). Масс-спектроскопия [M+H]+ получено значение 297,0. 1H ЯМР (500 МГц, DMSO-d 6): 13,71 (с, 1H), 12,99 (с, 1H), 8,90 (с, 1H), 8,32 (с, 1H), 7,94 (с, 1H), 7,67 (с, 1H). Калиевую соль 1-(5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты получали путем суспендирования свободной кислоты (55 г, 1,7 моль) в EtOH (1,5 л) при температуре флегмы с последующим добавлением раствора K2CO3 (12,79 г, 0,85 моль) в 20 мл воды по каплям в течение 5 мин. Для обеспечения должного смешивания применяли интенсивное механическое перемешивание. Суспензию перемешивали в течение 8 ч при температуре флегмы, после чего в течение 5 ч охлаждали до комнатной температуры. Осадок твердого вещества собирали фильтрацией и промывали водой (100 мл), а затем EtOH. Калиевую соль получали в форме белого твердого вещества (38 г, 65%). Маточный раствор сконцентрировали и описанный выше процесс повторили еще раз с получением второй части калиевой соли (13 г, 22%). Масс-спектроскопия [M+H]+=297,0. 1H ЯМР (500 МГц, DMSO-d 6): 8,65 (с, 1H); 7,96 (с, 1H); 7,57 (с, 2H).

Пример 3: 1-(5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2-хлор-5-трифторметил-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H7F3N4O2, 296,2; получено m/z: 295,0 [M-H]-. 1H ЯМР (500 МГц, DMSO-d 6): 14,44-12,32 (уш с, 2H), 8,94 (д, J=0,5 Гц, 1H), 8,33 (д, J=0,5 Гц, 1H), 7,96-7,83 (уш. с, 1H), 7,75 (уш. д, 1H), 7,58 (дд, J=8,49, 1,41 Гц, 1H).

Пример 4: 1-(5-хлор-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2-хлор-6-фтор-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H6ClFN4O2, 280,7; получено m/z: 279,0 [M-H]-. 1H ЯМР (500 МГц, DMSO-d 6): 14,21-12,25 (уш. с, 2H), 8,88 (д, J=0,6 Гц, 1H), 8,30 (д, J=0,6 Гц, 1H), 7,81-7,67 (уш. с, 1H), 7,65-7,52 (уш. с, 1H).

Пример 5: 1-(5,6-диметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2-хлор-5,6-диметил-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C13H12N4O2, 256,3; получено m/z: 257,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,16-12,81 (м, 2H), 8,85 (д, J=0,6 Гц, 1H), 8,25 (д, J=0,6 Гц, 1H), 7,43-7,21 (уш. с, 2H), 2,31 (с, 6H).

Пример 6: 1-(5-бром-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 5-бром-2-хлор-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H7BrN4O2, 306,0; получено m/z: 307,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,82 (д, J=0,5 Гц, 1H), 8,22 (с, 1H), 7,67 (д, J=1,2 Гц, 1H), 7,45 (д, J=8,5 Гц, 1H), 7,32 (дд, J=8,5, 1,9 Гц, 1H).

Пример 7: 1-(5-метокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2-хлор-5-метокси-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H10N4O3, 258,2; получено m/z: 259,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6, таутомерная смесь): 13,16 (с, 1H), 12,91 (с, 1H), 8,84 (с, 1H), 8,26 (с, 1H), 6,83-7,54 (м, 3H), 3,80 (с, 3H).

Пример 8: 1-(4-хлор-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2,4-дихлор-6-трифторметил-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H6ClF3N4O2, 330,7; получено m/z: 329,0 [M-H]-. 1H ЯМР (500 МГц, DMSO-d 6): 13,90-14,50 (уш. с, 1H), 12,75-13,45 (уш. с, 1H), 8,95 (с, 1H), 8,36 (с, 1H), 7,72 (с, 1H), 7,70 (с, 1H).

Пример 9: 1-(5,6-диметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2-хлор-5,6-диметокси-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C13H12N4O4, 288,3; получено m/z: 289,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,81 (с, 1H), 8,25 (с, 1H), 7,09 (с, 2H), 3,80 (с, 6H).

Пример 10: 1-(4,5-диметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2-хлор-4,5-диметил-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C13H12N4O2, 256,3; получено m/z: 257,2 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6, таутомерная смесь): 12,60-13,30 (уш. м, 2H), 8,83-8,90 (м, 1H), 8,23-8,29 (м, 1H), 7,0-7,35 (м, 2H), 2,47 (с, 3H), 2,33 (с, 3H).

Пример 11: 1-(5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2-хлор-5-трифторметокси-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H7F3N4O3 312,0; получено m/z: 313,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,91 (с, 1H); 8,31 (с, 1H); 7,83-7,41 (м, 2H); 7,30-7,21 (м, 2H).

Пример 12: 1-{5-[3-(3-хлорбензилокси)-фенил]-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-{5-[3-(3-хлорбензилокси)-фенил]-1-(2-триметилсиланилэтоксиметил)-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновой кислоты и этиловый эфир 1-{6-[3-(3-хлорбензилокси)-фенил]-1-(2-триметилсиланилэтоксиметил)-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновой кислоты. В соответствии со Схемой B, [1,1'-бис(дифенилфосфино)ферроцен]дихлористый палладий (0,12 г, 0,16 ммоль) добавляли к смеси фторида цезия (0,33 г, 2,2 ммоль), 3-(3'-хлорбензилокси)фенилбороновой кислоты (0,37 г, 1,3 ммоль), этилового эфира 1-[5-бром-1-(2-триметилсиланилэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты и этилового эфира 1-[6-бром-1-(2-триметилсиланилэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт реакции из Примера 6). Масс-спектроскопия (ESI/CI): расч. масса для C19H25BrN4O3Si, 464,1; получено m/z: 465,1), (0,5 г, 1,1 ммоль) и DME (5 мл) в герметизированной пробирке. Реакционная смесь перемешивалась при 80°C. Через 3 ч смесь охлаждали до комнатной температуры, затем разводили EtOAc (50 мл) и фильтровали. Фильтрат концентрировали. Осадок очищали (КФХ) (15:85 EtOAc/гексаны) с получением искомых соединений в виде региоизомерной смеси (0,47 г, 72%). Масс-спектроскопия (ESI/CI): расч. масса для C32H35ClN4O4Si, 602,2; получено m/z: 603,2 [M+H]+.

Стадия B: 1-{5-[3-(3-хлорбензилокси)-фенил]-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, Стадии C-D. Масс-спектроскопия (ESI/CI): расч. масса для C24H17ClN4O3 444,1; получено m/z: 445,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,93 (д, J=0,5 Гц, 1H), 8,32 (с, 1H), 7,84-7,79 (м, 1H), 7,68-7,63 (м, 1H), 7,60-7,55 (м, 2H), 7,52-7,37 (м, 4H), 7,36-7,27 (м, 2H), 7,03 (дд, J=7,8, 2,1 Гц, 1H), 5,26 (с, 2H).

Пример 13: 1-{5-[3-(2-хлорбензилокси)-фенил]-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 12, за исключением использования 3-(2'-хлорбензилокси)фенилбороновой кислоты вместо 3-(3'-хлорбензилокси)фенилбороновой кислоты на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C24H17ClN4O3, 444,1; получено m/z: 445,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,91 (с, 1H), 8,30 (с, 1H), 7,80 (с, 1H), 7,72-7,60 (м, 2H), 7,59-7,48 (м, 2H), 7,48-7,36 (м, 3H), 7,36-7,25 (м, 2H), 7,02 (дд, J=8,1, 1,9 Гц, 1H), 5,27 (с, 2H).

Пример 14: 1-{5-[3-(4-хлорбензилокси)-фенил]-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 12, за исключением использования 3-(4'-хлорбензилокси)фенилбороновой кислоты вместо 3-(3'-хлорбензилокси)фенилбороновой кислоты на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C24H17ClN4O3, 444,1; получено m/z: 445,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,91 (с, 1H), 8,30 (с, 1H), 7,98-7,50 (м, 5H), 7,50-7,44 (м, 2H), 7,43-7,35 (м, 1H), 7,35-7,22 (м, 2H), 7,00 (с, 1H), 5,22 (с, 2H).

Пример 15: 1-[5-(3-бензилоксифенил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 12, за исключением использования 3-(бензилокси)фенилбороновой кислоты вместо 3-(3'-хлорбензилокси)фенилбороновой кислоты на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C24H18N4O3, 410,1; получено m/z:411,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,99 (с, 1H), 8,38 (с, 1H), 8,02-7,28 (м, 11H), 7,09 (дд, J=8,1, 1,9 Гц, 1H), 5,31 (с, 2H).

Пример 16: 1-[5-(4-бензилоксифенил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 12, за исключением использования 4-(бензилокси)фенилбороновой кислоты вместо 3-(3'-хлорбензилокси)фенилбороновой кислоты на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C24H18N4O3, 410,1; получено m/z: 411,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 9,00 (с, 1H), 8,39 (с, 1H), 7,81-7,39 (м, 10H), 7,20 (д, J=8,8 Гц, 2H), 5,26 (с, 2H).

Пример 17: 1-[5-(3-трифторметилфенил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 12, за исключением использования 3-трифторметилфенилбороновой кислоты вместо 3-(3'-хлорбензилокси)фенилбороновой кислоты на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C18H11F3N4O2, 372,1; получено m/z: 373,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,91 (с, 1H); 8,31 (с, 1H); 8,11-7,79 (м, 3H); 7,78-7,52 (м, 4H).

Пример 18: 1-[5-(3,4-дихлорфенил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 12, за исключением использования 3,4-дихлорфенилбороновой кислоты вместо 3-(3'-хлорбензилокси)фенилбороновой кислоты на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C17H10Cl2N4O2 372,0; получено m/z: 373,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 9,01 (с, 1H), 8,41 (с, 1H), 8,06 (с, 1H), 7,95 (с, 1H), 7,81 (д, J=1,2 Гц, 2H), 7,74 (д, J=8,4 Гц, 1H), 7,69 (дд, J=8,5, 1,7 Гц, 1H).

Пример 19: 1-(5-бром-1H-бензоимидазол-2-ил)-3-трифторметил-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 5-бром-2-хлор-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии А и этилового эфира 3-трифторметил-1H-пиразол-4-карбоновой кислоты вместо этилприазол-4-карбоксилата на Стадии B. Масс-спектроскопия (ESI/CI): расч. масса для C12H6BrF3N4O2, 374,0; получено m/z: 375,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,69 (уш. с, 1H), 9,09 (с, 1H), 7,79 (уш. с, 1H), 7,55 (уш. с, 1H), 7,43 (дд, J=8,4, 1,6 Гц, 1H).

Пример 20: 1-(5,6-дихлор-1H-бензоимидазол-2-ил)-3-трифторметил-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2,5,6-трихлор-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии А и этилового эфира 3-трифторметил-1H-пиразол-4-карбоновой кислоты вместо этилприазол-4-карбоксилата на Стадии B. Масс-спектроскопия (ESI/CI): расч. масса для C12H5Cl2F3N4O2, 365,1; получено m/z: 363,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,25-14,30 (уш с, 2H), 9,10 (с, 1H), 7,87 (уш с, 2H).

Пример 21: 1-(5-бром-1H-бензоимидазол-2-ил)-3,5-диметил-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 5-бром-2-хлор-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A и 3,5-диметил-1H-4-приазол-4-карбоксилата вместо этилприазол-4-карбоксилата на Стадии В. Масс-спектроскопия (ESI/CI): расч. масса для C13H11BrN4O2, 334,0; получено m/z: 335,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,21 (уш с, 1H), 12,77 (уш с, 1H), 7,73 (уш с, 1H), 7,51 (уш с, 1H), 7,36 (дд, J=8,4, 1,6 Гц, 1H), 2,98 (с, 3H), 2,46 (с, 3H).

Пример 22: 1-(5,6-дихлор-1H-бензоимидазол-2-ил)-3,5-диметил-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2,5,6-трихлор-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A и 3,5-диметил-1H-4-приазол-4-карбоксилата вместо этилприазол-4-карбоксилата на Стадии B, а также с очисткой методом препаративной ВЭЖХ. Масс-спектроскопия (ESI/CI): расч. масса для C13H11Cl2N4O2, 325,2; получено m/z: 327,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 7,79 (с, 2H); 2,98 (с, 3H); 2,46 (с, 3H).

Пример 23: 1-[5-(4-гидрокси-фенил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 12, за исключением использования 4-гидроксифенилбороновой кислоты вместо 3-(3'-хлорбензилокси)фенилбороновой кислоты на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C17H12N4O3, 320,3; получено m/z: 321,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 12,52-13,80 (уш с, 1H), 9,25-10,05 (уш с, 1H), 8,84 (с, 1H), 8,25 (с, 1H), 7,43-7,80 (м, 5H), 6,86 (д, J=8,6, 2H).

Пример 24: 1-[5-(3-гидроксифенил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 12, за исключением использования 3-гидроксифенилбороновой кислоты вместо 3-(3'-хлорбензилокси)фенилбороновой кислоты на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C17H12N4O3, 320,3; получено m/z: 321,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 12,50-13,56 (уш м, 2H), 9,54 (уш с, 1H), 8,91 (с, 1H), 8,30 (с, 1H), 7,45-7,88 (уш м, 3H), 7,26 (т, J=7,8 Гц, 1H), 7,04-7,14 (м, 2H), 6,75 (дд, J=8,0, 1,7 Гц, 1H).

Пример 25: 1-(5-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 2,5-дихлор-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H7ClN4O2, 262,0; получено m/z: 263,0 [M+H]+. 1H ЯМР (400 МГц, CD3OD, таутомерное уширение): 8,89 (с, 1H), 8,17 (с, 1H), 7,67-7,44 (м, 2H), 7,26 (дд, J=8,6, 1,9 Гц, 1H).

Пример 26: 1-(5-бром-6,7-диметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 1, за исключением использования 5-бром-2-хлор-6,7-диметил-1H-бензоимидазола вместо 2-хлорбензоимидазола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H7ClN4O2, 334,0; получено m/z: 335,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,51-12,68 (м, 2H), 8,88 (с, 1H), 8,29 (с, 1H), 7,80-7,40 (м, 1H), 2,56 (с, 3H), 2,40 (с, 3H).

Пример 27: 1-(4-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 3-хлорбензол-1,2-диамин. К раствору, содержащему 3-хлор-2-нитрофениламин (1,73 г, 10,0 ммоль), NH4Cl (2,68 г, 50,0 ммоль), ацетон (40 мл) и воду (10 мл), по частям добавляли порошок цинка (три одинаковых части в течение 5 мин) (3,26 г, 50,0 ммоль) при 0°C. Смесь перемешивали в течение 2 ч, после чего нагревали до 23°C. Смесь профильтровали через материал Celite®, после чего растворители были сконцентрированы при пониженном давлении. Смесь снова растворили в EtOAc/DCM, второй раз профильтровали через Celite® и удалили растворители испарением. Неочищенную смесь растворили в EtOAc (100 мл), промыли солевым раствором (40 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (10-50% EtOAc/гексаны) с получением искомого соединения (1,00 г, 70%). Масс-спектроскопия (ESI/CI): расч. масса для C6H7ClN2, 142,0; получено m/z: 143,1 [M+H]+. 1H ЯМР (500 МГц, CDCl3): 6,86-6,78 (м, 1H), 6,65-6,58 (м, 2H), 3,74 (уш с, 2H), 3,46 (уш с, 2H).

Стадия B: 4-хлор-1,3-дигидробензоимидазол-2-он. К раствору 3-хлорбензол-1,2-диамина (0,820 г, 5,75 ммоль) и THF (25 мл) добавляли карбонилдиимидазол (1,12 г, 6,90 ммоль) при 0°C. Смесь перемешивали в течение 16 ч и нагревали до 23°C. К реакционной смеси добавляли водный 1M раствор HCl (25 мл) при 0°C, затем воду (100 мл) и перемешивали смесь в течение 1 ч. Осадок твердого вещества отфильтровали и высушили под глубоким вакуумом в течение 18 ч с получением искомого соединения, которое использовалось на последующей стадии без дополнительной очистки (0,800 г, 83%). Масс-спектроскопия (ESI/CI): расч. масса для C7H5ClN2O, 168,0; получено m/z: 169,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 11,13 (с, 1H), 10,88 (с, 1H), 7,00-6,86 (м, 3H).

Стадия C: 2,4-дихлор-1H-бензоимидазол. Оксихлорид фосфора (10 мл) добавили к соединению 4-хлор-1,3-дигидробензоимидазол-2-он (0,750 г, 4,45 ммоль) и смесь нагрели при 80°C в течение 48 ч. Смесь охладили до 23°C и удалили POCl3 при пониженном давлении. Осадок охладили до 0°C и осторожно добавили холодный насыщенный водный раствор NaHCO3 (20 мл). После перемешивания при 23°C в течение 15 мин смесь подвергли ультразвуковой обработке и образованный осадок отфильтровали с получением искомого соединения (0,760 г, 92%), которое использовалось на последующей стадии без дополнительной очистки. Масс-спектроскопия (ESI/CI): расч. масса для C7H5Cl2N2, 186,0; получено m/z: 187,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,68 (с, 1H), 7,51-7,42 (м, 1H), 7,32-7,25 (м, 1H), 7,22 (м, 1H).

Стадия D: 2,4-дихлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол. К смеси 2,4-дихлор-1H-бензоимидазола (0,550 г, 2,94 ммоль) и THF (15 мл) добавили DIPEA (1,54 мл, 8,82 ммоль), а затем 1-хлорметокси-2-метоксиэтан (0,550 г, 4,41 ммоль) при 23°C. После перемешивания в течение 18 ч добавили EtOAc (100 мл). Органический слой промыли водным насыщенным раствором NaHCO3 (30 мл) и солевым раствором (30 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (10-50% EtOAc/гексаны) и получили искомое соединение в виде смеси региоизомеров (0,660 г, 82%). Масс-спектроскопия (ESI/CI): расч. масса для C11H12Cl2N2O2, 274,0; получено m/z: 275,1 [M+H]+. 1H ЯМР (500 МГц, CDCl3): 7.61 (дд, J=8,0, 1,0 Гц, 1H), 7,41 (дд, J=8,1, 0,9 Гц, 1H), 7,33 (дд, J=7,9, 1,0 Гц, 1H), 7,31-7,20 (м, 3H), 5,98 (с, 2H), 5,66 (с, 2H), 3,76-3,69 (м, 2H), 3,67-3,60 (м, 2H), 3,55-3,46 (м, 4H), 3,37 (с, 3H), 3,36 (с, 3H).

Стадия E: этиловый эфир 1-[4-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К смеси 2,4-дихлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазола (0,660 г, 2,40 ммоль) и DMF (10 мл) добавили Cs2CO3 (1,88 г, 5,76 ммоль) и этиловый эфир 1H-пиразол-4-карбоновой кислоты (0,400 г, 2,88 ммоль). Полученную смесь нагревали при 80°C в течение 2 ч. Смесь охладили до 23°C, влили в солевой раствор (40 мл) и экстрагировали с помощью EtOAc (3×40 мл). Объединенные органические слои промыли солевым раствором (40 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (10-50% EtOAc/гексаны) и получили искомое соединение в виде смеси региоизомеров (0,880 г, 97%). Масс-спектроскопия (ESI/CI): расч. масса для C17H19ClN4O4, 378,1; получено m/z: 379,1 [M+H]+. 1H ЯМР (500 МГц, CDCl3): 8,97 (с, 1H), 8,80 (с, 1H), 8,22 (с, 1H), 8,20 (с, 1H), 7,65 (с, 1H), 7,53 (с, 1H), 7,40-7,23 (м, 4H), 6,38 (с, 2H), 6,16 (с, 2H), 4,41-4,31 (м, 4H), 3,68-3,59 (м, 2H), 3,57-3,49 (м, 2H), 3,48-3,41 (м, 2H), 3,41-3,35 (м, 2H), 3,31 (с, 3H), 3,25 (с, 3H), 1,38 (тд, J=7,1, 1,2 Гц, 6H).

Стадия F: этиловый эфир 1-(4-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[4-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,370 г, 0,980 ммоль) и EtOH (2,5 мл) добавили 4M раствор HCl в диоксане (2,5 мл, 10 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Полученный белый осадок отфильтровали и промыли EtOH с получением искомого соединения (0,260 г, 93%). Масс-спектроскопия (ESI/CI): расч. масса для C13H11ClN4O2, 290,1; получено m/z: 291,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d6): 13,83 (с, 1H), 8,98 (с, 1H), 8,45-8,29 (м, 1H), 7,46 (с, 1H), 7,38-7,16 (м, 2H), 4,59-4,01 (м, 2H), 1,60-1,01 (м, 3H).

Стадия G: получение 1-(4-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-(4-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (0,180 г, 0,550 ммоль), THF (3 мл) и воды (1 мл) добавили LiOH·H2O (95,0 мг, 2,20 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Растворитель выпаривали, добавляли воду (3 мл) и смесь подкисляли с помощью водн. 1M HCl. Полученный белый осадок отфильтровывали и высушивали с получением искомого соединения (0,130 г, 90%). Масс-спектроскопия (ESI/CI): расч. масса для C11H7ClN4O2, 262,0; получено m/z: 263,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,64 (с, 1H), 12,97 (с, 1H), 8,90 (с, 1H), 8,30 (с, 1H), 7,48 (д, J=7,4 Гц, 1H), 7,32 (дд, J=7,8, 1,0 Гц, 1H), 7,25 (т, J=7,9 Гц, 1H).

Пример 28: 1-(5-хлор-7-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 4-хлор-2-нитро-6-трифторметилфениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H6ClF3N4O2, 330,0; получено m/z: 331,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 14,08 (с, 1H), 12,97 (с, 1H), 8,87 (с, 1H), 8,34 (с, 1H), 7,80 (с, 1H), 7,64-7,58 (м, 1H).

Пример 29: 1-(7-бром-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 2-бром-6-нитро-4-трифторметоксифениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H6BrF3N4O3, 390,0; получено m/z: 391,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,98 (с, 1H), 12,94 (с, 1H), 8,90 (с, 1H), 8,32 (д, J=0,4 Гц, 1H), 7,57-7,52 (м, 1H), 7,48 (с, 1H).

Пример 30: 1-(6-хлор-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 4-хлор-2-нитро-5-трифторметилфениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H6ClF3N4O2, 330,0; получено m/z: 331,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,93 (с, 1H), 8,34 (с, 1H), 7,99 (с, 1H), 7,85 (с, 1H).

Пример 31: 1-(4,5,6-трифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 2,3,4-трифтор-6-нитрофениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H5F3N4O2, 282,0; получено m/z: 283,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,95 (с, 1H), 12,96 (с, 1H), 8,92 (с, 1H), 8,31 (с, 1H), 7,42 (с, 1H).

Пример 32: 1-(4-бром-5,6-дифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии B-G, за исключением использования 3-бром-4,5-дифторбензол-1,2-диамина вместо 3-хлорбензол-1,2-диамина на Стадии B. Масс-спектроскопия (ESI/CI): расч. масса для C11H5BrF2N4O2, 342,0; получено m/z: 343,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,93 (с, 1H), 12,93 (с, 1H), 8,88 (с, 1H), 8,30 (с, 1H), 7,55 (с, 1H).

Пример 33: 1-(6-хлор-4-метил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 4-хлор-2-метил-6-нитрофениламина вместо 3-хлор-2-нитро-фениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H9ClN4O2, 276,0; получено m/z: 277,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,77-13,17 (м, 1H), 8,87 (с, 1H), 8,29 (с, 1H), 7,39 (с, 1H), 7,11 (дд, J=1,9, 0,8 Гц, 1H), 2,53 (с, 3H).

Пример 34: 1-(4,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 2,4-дихлор-6-нитрофениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H6Cl2N4O2, 296,0; получено m/z: 297,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,76-13,08 (м, 1H), 8,89 (с, 1H), 8,29 (с, 1H), 7,49 (с, 1H), 7,40 (д, J=1,7 Гц, 1H).

Пример 35: 1-(4-бром-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 2-бром-6-нитро-4-трифторметилфениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H6BrF3N4O2, 375,0; получено m/z: 376,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 14,21 (с, 1H), 13,02 (с, 1H), 8,94 (с, 1H), 8,36 (с, 1H), 7,81 (с, 1H), 7,78 (с, 1H).

Пример 36: 1-(5,6-дифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии D-G, за исключением использования 2-хлор-5,6-дифтор-1H-бензоимидазола (J. Med. Chem. 1997, 40(5), 811-818) вместо 2,4-дихлор-1H-бензоимидазола на Стадии D. Масс-спектроскопия (CI): расч. масса для C11H6F2N4O2, 264,1; получено m/z: 263,0 [M-H]-. 1H ЯМР (500 МГц, DMSO-d 6): 12,50-14,10 (уш м, 2H), 8,86 (с, 1H), 8,28 (с, 1H), 7,55-7,66 (уш с, 2H).

Пример 37: 1-(4-бром-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 2-бром-4-хлор-6-нитрофениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H6BrClN4O2, 339,9; получено m/z: 340,9 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,72 (с, 1H), 8,00 (с, 1H), 7,36 (д, J=1,8 Гц, 1H), 7,11 (д, J=1,7 Гц, 1H).

Пример 38: 1-(6-метансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 4-метансульфонил-2-нитрофениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H10N4O4S, 306,0; получено m/z: 307,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,94 (уш с, 1H), 13,02 (уш с, 1H), 8,96 (д, J=0,4 Гц, 1H), 8,35 (с, 1H), 8,29-7,60 (м, 3H), 3,24 (с, 3H).

Пример 39: 1-(6-хлор-5-циано-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: N-(4-хлор-3-цианофенил)-ацетамид. Смешали уксусный ангидрид (2,79 мл, 29,5 ммоль), 5-амино-2-хлорбензонитрил (3,00 г, 19,7 ммоль), N,N-диметиламинопиридин (0,241 г, 1,97 ммоль) и толуол (50 мл) и нагревали при температуре флегмы в течение 1,5 ч. Реакционную смесь охладили и добавили воду и EtOAc (150 мл). Оставшееся в смеси твердое вещество собрали и отложили. Водный слой экстрагировали еще один раз с помощью EtOAc и объединенные слои промыли солевым раствором. Далее сохраненный осадок растворили в EtOAc, который промывали солевым раствором. Все органические слои объединили, высушили, профильтровали и сконцентрировали. Осадок растерли с DCM/гексанами и получили искомое соединение (3,52 г, выход 92%). Для данного соединения не были получены масс-спектрометрические данные. 1H ЯМР (400 МГц, CDCl3): 7,92 (д, J=1,0 Гц, 1H), 7,57 (дд, J=2,1, 1,2 Гц, 2H), 2,17 (с, 3H).

Стадия B: N-(4-хлор-5-циано-2-нитрофенил)-ацетамид. N-(4-хлор-3-цианофенил)-ацетамид (3,00 г, 15,4 ммоль) растворили в концентрированной серной кислоте (15 мл) и охладили до 0°C. При перемешивании по каплям добавили раствор нитрата калия (3,12 г, 30,8 ммоль) в концентрированной серной кислоте (15 мл). Реакционную смесь выдерживали при температуре 0°C в течение 3,5 ч, после чего медленно залили на смесь льда и воды. Полученный осадок собрали, растворили в EtOAc, высушили, отфильтровали и сконцентрировали. Осадок очистили (КФХ) (10-80% EtOAc/гексаны) и получили искомое соединение (1,06 г, выход 29%). Для данного соединения не были получены масс-спектрометрические данные. 1H ЯМР (400 МГц, CDCl3): 10,60 (с, 1H), 9,18 (с, 1H), 8,58 (с, 1H), 2,36 (с, 3H).

Стадия C: 4-амино-2-хлор-5-нитробензонитрил. N-(4-хлор-5-циано-2-нитрофенил)-ацетамид (1,06 г, 4,415 ммоль) добавили к 2M HCl (45 мл) и нагревали при температуре флегмы в течение 2 ч, после чего выдержали при 60°C в течение 16 ч. Реакционную смесь охладили и довели pH до 9 насыщенным водным раствором бикарбоната натрия. Смесь подвергли экстрагированию с помощью EtOAc (3×50 мл), отмыли солевым раствором (1×15 мл), высушили, профильтровали и сконцентрировали, получив искомое соединение (0,868 г, 99%). Для данного соединения не были получены масс-спектрометрические данные. 1H ЯМР (400 МГц, CDCl3): 8,49 (с, 1H), 7,23 (уш с, 2H), 7,02 (с, 1H), 2,40 (с, 3H).

Стадия D: 1-(6-хлор-5-циано-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 4-амино-2-хлор-5-нитробензонитрила вместо 3-хлор-2-нитрофениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C12H6ClN5O2, 287,0; получено m/z: 288,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,51 (уш с, 1H), 8,93 (д, J=0,5 Гц, 1H), 8,33 (д, J=0,4 Гц, 1H), 8,19 (с, 1H), 7,84 (с, 1H).

Пример 40: 1-(6-хлор-5-нитро-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 5-хлор-6-нитро-1,3-дигидробензоимидазол-2-он. К раствору, содержащему 4-хлор-5-нитробензол-1,2-диамин (8,34 г, 44,4 ммоль) и THF (625 мл), был добавлен карбонил диимидазол (8,65 г, 53,3 ммоль) при 0°C. Реакционной смеси дали нагреться до 23°C и перемешивали при этой температуре в течение 20 ч. Реакционную смесь сконцентрировали до объема 300 мл и добавили 500 мл водного 1M раствора HCl, а затем воду (итоговый объем 2 л). Полученную суспензию охладили до 0°C на 2 ч, осадок собрали и высушили на фильтре. Далее осадок растерли с холодным EtOAc (20 мл) и промыли EtOAc (2×5 мл) с получением искомого соединения (7,26 г, выход 76%). Масс-спектроскопия (ESI/CI): расч. масса для C7H4ClN3O3, 213,0; получено m/z: 214,0 [M+H]+.

Стадия B: 2,6-дихлор-5-нитро-1H-бензоимидазол. К соединению 5-хлор-6-нитро-1,3-дигидробензоимидазол-2-он (5,63 г, 26,35 ммоль) добавили оксихлорид фосфора (35 мл) и нагревали реакционную смесь при 85°C в течение 36 ч. Реакционную смесь сконцентрировали и осадок растерли с холодным насыщенным водным раствором бикарбоната натрия (до pH 8, 0,8 л). Полученный осадок собрали и высушили с получением искомого соединения (5,43 г, выход 89%). Масс-спектроскопия (ESI/CI): расч. масса для C7H3Cl2N3O2, 231,0; получено m/z: 232,0 [M+H]+.

Стадия C: 2,6-дихлор-1-(2-метоксиэтоксиметил)-5-нитро-1H-бензоимидазол. К перемешанному раствору, содержащему 2,6-дихлор-5-нитро-1H-бензоимидазол (5,43 г, 23,4 ммоль), диизопропилэтиламин (12,2 мл, 70,2 ммоль) и THF (120 мл), по частям добавили 1-хлорметокси-2-метоксиэтан (3,30 мл, 28,1 ммоль). Реакционную смесь перемешивали в течение 2,5 ч и сконцентрировали. К осадку добавили воду (50 мл) и экстрагировали смесь с помощью EtOAc (3×125 мл). Объединенные органические слои промыли солевым раствором (100 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (20-55% EtOAc/гексаны) с получением искомого соединения (6,23 г, выход 83%) в виде смеси региоизомеров 1:1. Масс-спектроскопия (ESI/CI): расч. масса для C11H11Cl2N3O4, 319,0; получено m/z: 320,0 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,24 (с, 1H), 8,16 (с, 1H), 7,83 (с, 1H), 7,69 (с, 1H), 5,71 (с, 2H), 5,68 (с, 2H), 3,72-3,64 (м, 4H), 3,57-3,50 (м, 4H), 3,35 (с, 3H), 3,35 (с, 3H).

Стадия D: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-нитро-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 2,6-дихлор-1-(2-метоксиэтоксиметил)-5-нитро-1H-бензоимидазол (6,15 г, 19,2 ммоль), 1H-пиразол-4-карбоновой кислоты (2,96 г, 21,1 ммоль) и DMF (40 мл) добавили карбонат цезия (12,5 г, 38,4 ммоль) в герметизируемом сосуде, рассчитанном на работу под давлением. Сосуд продули азотом, загерметизировали и нагревали при 60°C в течение 2 ч. Реакционную смесь влили в смесь солевого раствора и воды 1:1 (80 мл) и экстрагировали с помощью EtOAc (3×125 мл). Объединенные органические слои промыли солевым раствором (3×125 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (5-45% EtOAc/гексаны) с получением искомого соединения (8,09 г, 98%) в виде смеси региоизомеров. Масс-спектроскопия (ESI/CI): расч. масса для C17H18ClN5O6, 423,1; получено m/z: 424,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,93 (д, J=0,6 Гц, 1H), 8,28 (с, 1H), 8,22 (д, J=0,6 Гц, 1H), 7,83 (с, 1H), 6,26 (с, 2H), 4,37 (кв, J=7,1 Гц, 2H), 3,73-3,67 (м, 2H), 3,49-3,44 (м, 2H), 3,29 (с, 3H), 1,39 (т, J=7,1 Гц, 3H).

Стадия E: 1-(6-хлор-5-нитро-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C11H6ClN5O4, 307,0; получено m/z: 308,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6, таутомерное уширение): 14,14 (уш с, 1H), 13,03 (уш с, 1H), 8,94 (с, 1H), 8,57-7,52 (м, 3H).

Пример 41: 1-(5-амино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

СТАДИЯ А. Этиловый эфир 1-[5-амино-6-хлор-1-(2-метокси-этоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору, содержащему этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-нитро-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт D реакции из Примера 40) (7,88 г, 18,6 ммоль), хлорид аммония (14,9 г, 0,279 моль), ацетон (75 мл) и воду (15 мл), при 0°C по частям добавляли цинковый порошок (12,2 г, 0,186 моль). Реакционную смесь извлекали из ледяной бани и через 15 мин фильтровали через Celite®/диатомитовую землю и промывали EtOAc. Фильтрат концентрировали и оставшееся вещество было разделено между EtOAc (300 мл) и насыщенным водным раствором бикарбоната натрия (55 мл). Водный слой далее экстрагировали с помощью EtOAc (2×125 мл). Объединенные органические слои промыли солевым раствором (2×40 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (5-65% EtOAc/гексаны) с получением искомого соединения (6,29 г, выход 86%) в виде смеси региоизомеров 1:1. Масс-спектроскопия (ESI/CI): расч. масса для C17H20ClN5O4, 393,1; получено m/z: 394,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,83 (д, J=0,6 Гц, 1H), 8,78 (д, J=0,6 Гц, 1H), 8,16 (дд, J=1,9, 0,6 Гц, 2H), 7,63 (с, 1H), 7,54 (с, 1H), 7,09 (с, 1H), 6,96 (с, 1H), 6,03 (с, 2H), 6,00 (с, 2H), 4,35 (кв, J=7,1 Гц, 4H), 4,18 (с, 2H), 4,07 (с, 2H), 3,66-3,60 (м, 4H), 3,49-3,42 (м, 4H), 3,32 (с, 3H), 3,31 (с, 3H), 1,37 (т, J=7,1 Гц, 6H).

Стадия B: 1-(5-амино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C11H8ClN5O2, 277,0; получено m/z: 278,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,90 (уш с, 1H), 8,81 (с, 1H), 8,25 (с, 1H), 7,47 (с, 1H), 6,98 (с, 1H).

Пример 42: 1-(5-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии B-G, за исключением использования 4-фторбензол-1,2-диамина вместо 3-хлорбензол-1,2-диамина на Стадии B. Масс-спектроскопия (ESI/CI): расч. масса для C11H7FN4O2, 246,1; получено m/z: 247,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,47 (с, 1H), 12,94 (с, 1H), 8,88 (с, 1H), 8,29 (с, 1H), 7,54 (уш с, 1H), 7,39 (уш с, 1H), 7,13-7,07 (м, 1H).

Пример 43: 1-(6-хлор-5-пирролидин-1-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-хлор-2-нитро-5-пирролидин-1-ил-фениламин. Пирролидин (6 мл) добавили к 4,5-дихлор-2-нитрофениламину (2,58 г, 12,5 ммоль) в герметизированной пробирке и нагревали смесь при 100°C в течение 6 ч. Смесь охладили до 23°C, влили в воду (100 мл) и экстрагировали с помощью EtOAc (3×100 мл). Объединенные органические слои промыли солевым раствором (50 мл), высушили, профильтровали и сконцентрировали при пониженном давлении с получением искомого соединения (3,00 г, 99%). Масс-спектроскопия (ESI/CI): расч. масса для C10H12ClN3O2, 241,1; получено m/z: 242,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,08 (с, 1H), 6,06 (с, 2H), 5,82 (с, 1H), 3,58 (ддд, J=6,6, 4,2, 2,7 Гц, 4H), 2,02-1,90 (м, 4H).

Стадия B: 6-хлор-5-пирролидин-1-ил-1H-бензоимидазол. Муравьиную кислоту (2,9 мл) добавили к смеси 4-хлор-2-нитро-5-пирролидин-1-ил-фениламина (0,240 г, 1,00 ммоль) и SnCl2·H2O (0,680 г, 3,00 ммоль), после чего смесь нагревали при 130°C в микроволновом реакторе в течение 5 мин. На одной чашке проводили шесть реакций. Объединенную неочищенную смесь профильтровали и промыли EtOAc (100 мл). Органический слой обработали водой (25 мл) и нейтрализовали водным 6M раствором NaOH. Водный слой экстрагировали с помощью EtOAc (3×30 мл). Объединенные органические слои промыли солевым раствором (50 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок растерли с EtOAc, собрали твердое вещество, получив искомое соединение (1,08 г, 70%) в виде соли муравьиной кислоты. Масс-спектроскопия (ESI/CI): расч. масса для C11H12ClN3, 221,1; получено m/z: 222,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,84-12,16 (уш с, 1H), 8,13 (с, 1H), 8,11 (с, 1H), 7,59 (с, 1H), 7,20 (с, 1H), 3,20 (т, J=6,3 Гц, 4H), 2,06-1,66 (м, 4H).

Стадия C: 5-хлор-1-(2-метоксиэтоксиметил)-6-пирролидин-1-ил-1H-бензоимидазол. К смеси 6-хлор-5-пирролидин-1-ил-1H-бензоимидазола (0,443 г, 2,00 ммоль) и THF (5 мл) добавили NaH (96,0 мг, 60% дисперсия в минеральном масле, 2,40 ммоль) при 0°C. После перемешивания реакционной смеси в течение 30 мин при 0°C к смеси добавили 1-хлорметокси-2-метоксиэтан (0,299 г, 2,40 ммоль) и перемешивали смесь в течение 18 ч. Реакционную смесь погасили водой и экстрагировали водный слой с помощью EtOAc (3×50 мл). Объединенные органические слои промыли солевым раствором (2×20 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (0-10% MeOH/DCM) и получили искомое соединение в форме смеси региоизомеров (0,240 г, 39%) с чистотой 90%. Масс-спектроскопия (ESI/CI): расч. масса для C15H20ClN3O2, 309,1; получено m/z: 310,1 [M+H]+.

Стадия D: 2,5-дихлор-1-(2-метоксиэтоксиметил)-6-пирролидин-1-ил-1H-бензоимидазол. Раствор 5-хлор-1-(2-метоксиэтоксиметил)-6-пирролидин-1-ил-1H-бензоимидазола (0,221 г, 0,714 ммоль) и THF (2,5 мл) охладили до -78°C на бане из ацетона и сухого льда. По каплям добавили диизопропиламид лития (2,0M раствор в смеси THF/гептан/этилбензол, 0,90 мл, 1,8 ммоль) и перемешивали реакционную смесь при -78°C в течение 30 мин. При -78°C добавили N-хлорсукцинимид (267 мг, 2,00 ммоль), нагрели реакционную смесь до 23°C и перемешивали в течение 2 ч. Добавили насыщенный водный раствор NH4Cl (20 мл) и экстрагировали неочищенный продукт в EtOAc (3×50 мл). Объединенные органические слои промыли солевым раствором (50 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (0-100% EtOAc/гексаны) и получили искомое соединение (0,240 г, 71%) в форме смеси региоизомеров с чистотой 70%. Масс-спектроскопия (ESI/CI): расч. масса для C15H19Cl2N3O2, 343,1; получено m/z: 344,1 [M+H]+.

Стадия E: 1-(6-хлор-5-пирролидин-1-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии E-G. Масс-спектроскопия (ESI/CI): расч. масса для C15H14ClN5O2, 331,1; получено m/z: 332,1 [M+H]+. 1H ЯМР (DMSO-d 6): 13,35 (с, 1H), 12,88 (с, 1H), 8,85 (с, 1H), 8,28 (д, J=0,6 Гц, 1H), 7,71 (с, 0,6H), 7,50 (с, 0,4H), 7,44 (с, 0,4H), 7,20 (с, 0,6H), 3,83-3,72 (м, 4H), 3,03-2,89 (м, 4H).

Пример 44: 1-(6-хлор-5-пиперидин-1-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-хлор-2-нитро-5-пиперидин-1-ил-фениламин: искомое соединение получали аналогично тому, как описано в Примере 43, за исключением использования пиперидина вместо пирролидина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H14ClN3O2, 255,1; получено m/z: 256,1 [M+H]+.

Стадия B: 1-(6-хлор-5-пиперидин-1-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота: Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27. Масс-спектроскопия (ESI/CI): расч. масса для C16H16ClN5O2, 345,1; получено m/z: 346,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,86 (с, 1H), 8,29 (с, 1H), 7,63 (с, 1H), 7,35 (с, 1H), 2,99 (с, 4H), 1,72 (с, 4H), 1,56 (с, 2H).

Пример 45: 1-(6-хлор-5-морфолин-4-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-хлор-5-морфолин-4-ил-2-нитрофениламин: искомое соединение получали аналогично тому, как описано в Примере 43, за исключением использования морфолина вместо пирролидина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C10H12ClN3O3, 257,1; получено m/z: 258,1 [M+H]+.

Стадия B: 1-(6-хлор-5-морфолин-4-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27. Масс-спектроскопия (ESI/CI): расч. масса для C15H14ClN5O3, 347,1; получено m/z: 348,1 [M+H]+. 1H ЯМР (DMSO-d 6): 13,17 (с, 1H), 12,86 (с, 1H), 8,83 (д, J=0,4 Гц, 1H), 8,26 (с, 1H), 7,62 (с, 0,7H), 7,43 (с, 0,3H), 7,31 (с, 0,3H), 7,08 (с, 0,7H), 3,23 (с, 5H), 1,90 (с, 4H).

Пример 46: 1-(6-хлор-5-метокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-хлор-5-метокси-2-нитрофениламин. К смеси 4,5-дихлор-2-нитрофениламина (1,29 г, 6,23 ммоль) и безводного MeOH (2 мл) добавили 25% по массе раствор метоксида натрия в MeOH (10 мл) и перемешивали смесь в течение 6 ч при 100°C в герметизированной пробирке. Смесь охладили до 23°C, влили в воду (50 мл) и экстрагировали с помощью EtOAc (3×50 мл). Объединенные органические слои промыли солевым раствором (25 мл), высушили, профильтровали и сконцентрировали при пониженном давлении с получением искомого соединения (0,700 г, 56%). Неочищенный материал в следующей реакции использовали без дальнейшей очистки.

Стадия B: 5-хлор-6-метокси-1H-бензоимидазол. Искомое соединение получали аналогично тому, как описано в Примере 45, Стадия B, за исключением использования 4-хлор-5-метокси-2-нитрофениламина вместо 4-хлор-2-нитро-5-пирролидин-1-ил-фениламина. Масс-спектроскопия (ESI/CI): расч. масса для C8H7ClN2O, 182,1; получено m/z: 183,1 [M+H]+.

Стадия C: 5-хлор-6-метокси-1-(2-метоксиэтоксиметил)-1H-бензоимидазол. К смеси 5-хлор-6-метокси-1H-бензоимидазола (0,320 г, 1,75 ммоль) и THF (10 мл) добавили DIPEA (0,850 мл, 4,9 ммоль), а затем 1-хлорметокси-2-метоксиэтан (0,310 г, 2,45 ммоль) при 23°C. После перемешивания в течение 18 ч добавили EtOAc (50 мл). Органический слой промыли солевым раствором (20 мл), высушили, отфильтровали и сконцентрировали при пониженном давлении, получив неочищенный материал (0,31 г), который использовался в следующей реакции без очистки.

Стадия D: 1-(6-хлор-5-метокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в Примере 43, Стадии D-E. Масс-спектроскопия (ESI/CI): расч. масса для C12H9ClN4O3, 292,0; получено m/z: 293,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,85 (д, J=0,6 Гц, 1H), 8,29 (д, J=0,6 Гц, 1H), 7,63 (с, 1H), 7,23 (с, 1H), 3,90 (с, 3H). Следует обратить внимание на то, что Стадии D-E относятся к другому примеру

Пример 47: 2-(4-карбокси-пиразол-1-ил)-1H-бензоимидазол-5-карбоновая кислота.

Стадия A: метиловый эфир 2-(4-этоксикарбонилпиразол-1-ил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии B-E, за исключением использования метилового эфира 3,4-диамино-бензойной кислоты вместо 3-хлор-бензол-1,2-диамина на Стадии B, для получения смеси региоизомеров. Масс-спектроскопия (ESI/CI): расч. масса для C19H22N4O6, 402,2; получено m/z: 403,2 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 9,02 (с, 1H), 9,01 (с, 1H), 8,40 (с, 2H), 8,39 (с, 1H), 8,29 (с, 1H), 8,03 (дд, J=8,6, 1,4 Гц, 1H), 7,98 (дд, J=8,5, 1,4 Гц, 1H), 7,91 (д, J=8,6 Гц, 1H), 7,83 (д, J=8,5 Гц, 1H), 6,08 (с, 2H), 6,01 (с, 2H), 4,31 (кв, J=7,1 Гц, 4H), 3,91 (с, 3H), 3,90 (с, 3H), 3,55-3,52 (м, 4H), 3,33-3,30 (м, 4H), 3,11 (с, 3H), 3,11 (с, 3H), 1,32 (т, J=7,1 Гц, 6H).

Стадия B: 2-(4-карбоксипиразол-1-ил)-1H-бензоимидазол-5-карбоновая кислота. К перемешанному раствору метилового эфира 2-(4-этоксикарбонилпиразол-1-ил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-карбоновой кислоты (0,150 г, 0,373 ммоль) и уксусной кислоты (4,5 мл) добавлили водный раствор соляной кислоты (6M, 4,5 мл). Реакционную смесь нагревали при температуре 100°C в течение 18 ч, а затем охлаждали до 23°C. Полученный осадок собрали, получив искомое соединение (0,30 мг, выход 30%). Масс-спектроскопия (ESI/CI): расч. масса для C12H8N4O4, 272,1; получено m/z: 273,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,94 (с, 1H), 8,32 (с, 1H), 8,14 (с, 1H), 7,87 (дд, J=8,4, 1,5 Гц, 1H), 7,63 (д, J=8,4 Гц, 1H).

Пример 48: 1-(5-бром-7-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 5-бром-3-фторбензол-1,2-диамин. К раствору, содержащему 5-бром-3-фтор-2-нитрофениламин (2 г, 8,5 ммоль), NH4Cl (6,81 г, 127,6 ммоль), ацетон (100 мл) и воду (20 мл), был по частям добавлен порошок цинка (три одинаковых части в течение 5 мин) (8,34 г, 127,6 ммоль) при 0°C. Смесь перемешивали в течение 2 ч, после чего нагревали до 23°C. Смесь профильтровали через материал Celite®, после чего растворители были сконцентрированы при пониженном давлении. Смесь снова растворили в EtOAc/DCM, второй раз профильтровали через Celite® и удалили растворители испарением. Неочищенную смесь растворили в EtOAc (200 мл), промыли солевым раствором (40 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Полученный осадок использовали в следующей реакции без дополнительной очистки.

Стадия B: 1-(5-бром-7-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 47, за исключением использования 5-бром-3-фторбензол-1,2-диамина вместо 3-хлорбензол-1,2-диамина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C11H6BrFN4O2, 324,0; получено m/z: 325,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,88 (с, 1H), 8,30 (с, 1H), 7,45 (дд, J=9,5, 2,3 Гц, 1H), 7,34 (д, J=7,6 Гц, 1H).

Пример 49: 1-(5-бром-7-метил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 47, за исключением использования 5-бром-3-метилбензол-1,2-диамина вместо 3-хлорбензол-1,2-диамина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H9BrN4O2, 320,0; получено m/z: 321,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,88 (с, 1H), 8,29 (с, 1H), 7,53 (с, 1H), 7,23 (с, 1H), 2,53 (с, 3H).

Пример 50: 1-[5-(3,4-дихлорфенокси)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: 5-(3,4-дихлорфенокси)-2-нитро-4-трифторметилфениламин. К смеси 5-хлор-2-нитро-4-трифторметилфениламина (1,00 г, 4,16 ммоль) и DMA (21 мл) добавили K2CO3 (1,15 г, 8,32 ммоль) и 3,4-дихлорфенол (1,36 г, 8,32 ммоль). Смесь нагревали при 85°C в течение 18 ч. Смесь охладили до 23°C и влили в ледяную воду. Осадок собрали, растворили в EtOAc (150 мл) и отмыли солевым раствором (2×30 мл). Органические слои соединили, высушили, профильтровали и сконцентрировали при пониженном давлении, получив искомое соединение (1,51 г, 99%). 1H ЯМР (500 МГц, CDCl3): 8,52 (с, 1H), 7,53 (д, J=8,7 Гц, 1H), 7,26 (д, J=3,2 Гц, 1H), 7,00 (дд, J=8,7, 2,7 Гц, 1H), 6,37 (с, 2H), 6,06 (с, 1H).

Стадия B: 1-[5-(3,4-дихлорфенокси)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27. Масс-спектроскопия (ESI/CI): расч. масса для C18H9Cl2F3N4O3, 456,0; получено m/z: 457,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 13,29 (с, 2H), 8,90 (д, J=0,4 Гц, 1H), 8,32 (с, 1H), 7,96 (с, 1H), 7,63 (д, J=8,9 Гц, 1H), 7,38 (с, 1H), 7,33 (д, J=2,8 Гц, 1H), 7,01 (дд, J=8,9, 2,9 Гц, 1H).

Пример 51: 1-[6-хлор-5-(4-хлорфенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования 4-хлорфенола вместо 3,4-дихлорфенола и использования 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C17H10Cl2N4O3, 388,0; получено m/z: 389,0 [M+H]+. 1H ЯМР (DMSO-d 6): 13,25 (уш с, 2H), 8,88 (с, 1H), 8,29 (с, 1H), 7,78 (с, 1H), 7,50-7,22 (м, 3H), 7,04-6,80 (м, 2H).

Пример 52: 1-[5-(4-хлорфенокси)-6-трифторметокси-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования 4-хлорфенола вместо 3,4-дихлор-фенола и использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C18H10ClF3N4O4, 438,0; получено m/z: 439,0 [M+H]+. 1H ЯМР (DMSO-d 6): 8,82 (с, 1H), 8,22 (с, 1H), 7,67 (с, 1H), 7,41 (д, J=9,0 Гц, 2H), 7,33 (с, 1H), 6,99 (д, J=9,0 Гц, 2H).

Пример 53: 1-(5-фенокси-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования фенола вместо 3,4-дихлор-фенола и использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C18H11F3N4O4, 404,1; получено m/z: 405,1 [M+H]+. 1H ЯМР (DMSO-d 6): 13,30 (с, 1H), 8,88 (с, 1H), 8,30 (с, 1H), 7,72 (с, 1H), 7,48-7,34 (м, 2H), 7,27 (с, 1H), 7,14 (т, J=7,4 Гц, 1H), 7,00 (д, J=7,9 Гц, 2H).

Пример 54: 1-[5-(4-фторфенокси)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования 4-фторфенола вместо 3,4-дихлорфенола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C18H10F4N4O3, 406,1; получено m/z: 407,1 [M+H]+. 1H ЯМР (DMSO-d 6): 13,30 (с, 2H), 8,87 (с, 1H), 8,29 (с, 1H), 7,93 (с, 1H), 7,31-7,18 (м, 2H), 7,10 (ддд, J=6,7, 5,4, 3,1 Гц, 3H).

Пример 55: 1-[5-(4-хлорфенокси)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования 4-хлорфенола вместо 3,4-дихлорфенола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C18H10ClF3N4O3, 422,0; получено m/z: 423,0 [M+H]+. 1H ЯМР (DMSO-d 6): 8,81 (с, 1H), 8,18 (с, 1H), 7,87 (с, 1H), 7,50-7,32 (м, 2H), 7,18 (с, 1H), 7,07-6,91 (м, 2H).

Пример 56: 1-(5-фенокси-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования фенола вместо 3,4-дихлорфенола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C18H11F3N4O3, 388,1; получено m/z: 389,1 [M+H]+. 1H ЯМР (DMSO-d 6): 13,32 (с, 2H), 8,87 (с, 1H), 8,28 (с, 1H), 7,93 (с, 1H), 7,41 (т, J=7,9 Гц, 2H), 7,16 (дд, J=16,1, 8,7 Гц, 2H), 7,04 (д, J=8,0 Гц, 2H).

Пример 57: 1-(6-хлор-5-фенокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 5-хлор-2-нитро-4-феноксифениламин. К раствору фенола (0,500 г, 5,31 ммоль) в безводном DMF (20 мл) был добавлен твердый трет-бутоксид натрия (0,510 г, 5,31 ммоль). Смесь нагревали при 100°C в течение 60 мин, после чего добавили 4,5-дихлор-2-нитрофениламин (1,00 г, 4,83 ммоль) и нагревали реакционную смесь при 100°C в течение 19 ч. Далее реакционной смеси дали охладиться до комнатной температуры. Реакционную смесь влили в воду и экстрагировали с помощью EtOAc. Объединенные органические слои промыли раствором 1M Na2CO3, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (гексаны:EtOAc, от 5% до 30% в течение 20 мин) и получили искомое соединение в виде твердого вещества оранжевого цвета (0,821 г, 64%). 1H ЯМР (400 МГц, CDCl3): 8,27 (с, 1H), 7,50-7,34 (м, 2H), 7,27 (д, J=8,9 Гц, 2H), 7,10 (дд, J=8,6, 1,1 Гц, 2H), 6,02 (с, 3H).

Стадия B: 6-хлор-5-фенокси-1H-бензоимидазол. К раствору 5-хлор-2-нитро-4-феноксифениламин (0,810 г, 3,06 ммоль) в DMF (12 мл) добавили триметилортоформиат (12 мл), а затем дитионит натрия (2,66 г, 15,3 ммоль) и ледяную уксусную кислоту (1,5 мл). Реакционную смесь нагревали в загерметизированной пробирке при 100°C в течение 14 ч. Добавили дополнительную порцию дитионита натрия (0,5 г) и уксусной кислоты (1 мл), после чего смесь продолжали нагревать при 120°C в течение еще 3 ч. Реакционный сосуд охладили на льду, смесь осторожно влили в полунасыщенный раствор бикарбоната натрия (300 мл) и экстрагировали с помощью EtOAc. Объединенные органические слои промыли 5% раствором NaHCO3, солевым раствором, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (гексаны:EtOAc, от 0% до 5% в течение 20 мин) и получили искомое соединение в виде аморфного твердого вещества желтого цвета (0,57 г, 76%), являющегося смесью таутомеров. Масс-спектроскопия (ESI/CI): расч. масса для C13H9ClN2O, 244; получено m/z: 245 [M+H]+. 1H ЯМР (500 МГц, CDCl3): 9,55 (с, 1H), 8,06 (с, 1H), 8,0-7,2 (м, 2H), 7,32 (т, J=7,9 Гц, 2H), 7,09 (т, J=7,3 Гц, 1H), 6,96 (д, J=8,3 Гц, 2H).

Стадия C: 6-хлор-1-(2-метоксиэтоксиметил)-5-фенокси-1H-бензоимидазол. К раствору 6-хлор-5-фенокси-1H-бензоимидазола (0,565 г, 2,31 ммоль) и диизопропилэтиламина (0,890 мл, 5,08 ммоль) в безводном DMF (10 мл) добавили MEM хлорид (0,29 мл, 2,54 ммоль) при 0°C. После выдерживания в течение 3 суток при комнатной температуре реакционная смесь была влита в насыщенный раствор NH4Cl (100 мл) и экстрагирована с помощью EtOAc. Объединенные органические слои были промыты 0,5 M лимонной кислотой, 5% NaHCO3 и солевым раствором, высушены, профильтрованы и сконцентрированы при пониженном давлении. Осадок очистили (КФХ) (DCM:MeOH, от 0% до 5% в течение 10 мин) и получили искомое соединение в виде красного масла, представляющего собой смесь региоизомеров в отношении 1:1 (0,563 г, 73%). Данный материал непосредственно использовался на следующей стадии.

Стадия D: 2,6-дихлор-1-(2-метоксиэтоксиметил)-5-фенокси-1H-бензоимидазол. К раствору диизопропиламина (260 л, 1,85 ммоль) в безводном THF (2 мл), охлажденному на бане с температурой -78°C, добавили раствор n-бутиллития в гексанах (1,16 мл раствора 1,6 M). Через 45 мин содержимое колбы через шприц ввели в охлажденный до -78°C раствор 6-хлор-1-(2-метокси-этоксиметил)-5-фенокси-1H-бензоимидазола (0,560 г, 1,68 ммоль) в безводном THF (2 мл). Через 60 мин к темному раствору добавили через шприц раствор N-хлорсукцинимида (0,247 г, 1,85 ммоль) в THF (3 мл), в результате чего цвет изменился на светло-коричневый. Реакционной смеси дали нагреться до комнатной температуры, после чего добавили ее к насыщенному водн. раствору NH4Cl и экстрагировали с помощью EtOAc. Объединенные органические слои были промыты 0,5 M раствором лимонной кислоты, 5% водн. раствором NaHCO3, солевым раствором, высушены, профильтрованы и сконцентрированы при пониженном давлении. Осадок очистили (КФХ) и получили искомое соединение в виде смеси региоизомеров (0,251 г, 41%; оранжевое масло). Масс-спектроскопия (ESI/CI): расч. масса для C17H16Cl2N2O3, 366; получено m/z: 367 [M+H]+. 1H ЯМР (400 МГц, CDCl3) δ 7,80 (с, 1H), 7,62 (с, 1H), 7,37 (с, 1H), 7,36-7,29 (м, 4H), 7,18 (с, 1H), 7,14-7,04 (м, 2H), 6,98-6,90 (м, 4H), 5,63 (с, 2H), 5,54 (с, 2H), 3,72-3,63 (м, 2H), 3,63-3,57 (м, 2H), 3,57-3,50 (м, 2H), 3,49-3,42 (м, 2H), 3,38 (с, 3H), 3,28 (с, 3H).

Стадия E: этиловый эфир 1-(6-хлор-5-фенокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К перемешанному раствору 2,6-дихлор-1-(2-метокси-этоксиметил)-5-фенокси-1H-бензоимидазола (0,251 г, 0,684 ммоль) и этилпиразол-4-карбоксилата (0,115 г, 0,820 ммоль) в безводном DMF (4 мл) добавили безводный карбонат цезия (0,535 г, 1,64 ммоль). Перемешанную суспензию нагревали на бане с температурой 80°C в герметизированной пробирке в течение 2 ч. После охлаждения до комнатной температуры реакционную смесь влили в ледяную воду (100 мл), подкислили 1N HCl (3 мл) и экстрагировали в дихлорметан. Объединенные органические слои промыли водой, солевым раствором, высушили, отфильтровали и сконцентрировали при пониженном давлении, получив искомый продукт в виде неочищенного оранжевого пастообразного вещества (0,361 г). Масс-спектроскопия (ESI/CI): расч. масса для C23H23ClN4O5, 470; получено m/z: 471 [M+H]+.

Стадия F: 1-(6-хлор-5-фенокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Этиловый эфир 1-(6-хлор-5-фенокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (0,361 г) растворили в ледяной уксусной кислоте (9 мл) и 6N HCl (9 мл) и нагревали в герметизированной пробирке при 100°C в течение 6 ч. После охлаждения на льду добавили воду (5 мл), собрали твердое вещество фильтрацией, промыли водой и высушили под вакуумом (60°C, 1,3 кПа (10 мм рт. ст.)). Полученный желтовато-коричневый порошок был перекристаллизован из смеси MeOH:вода (10 мл, 10:1), собран при помощи фильтрации и высушен при пониженном давлении с получением искомого соединения в виде желтовато-коричневого твердого вещества (115 мг, 90%). Температура плавления = 134-138°C (дек.). Масс-спектроскопия (ESI/CI): расч. масса для C17H11ClN4O3, 354; получено m/z: 355 [M+H]+, 396 [MH+MeCN]+. 1H ЯМР (смесь таутомеров) (500 МГц, DMSO-d6): 13,60 (с, 0,5H), 13,50 (с, 0,5H), 12,93 (с, 1H), 8,89 (с, 1H), 8,30 (с, 1H), 7,90 (с, 0,5H), 7,65 (с, 0,5H), 7,42 (м, 2,5H), 7,15 (м, 1,5H), 7,02-6,75 (м, 2H).

Пример 58: 1-(5-бром-7-метил-1H-имидазо[4,5-f]хинолин-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в Примере 57, Стадии B-F, за исключением использования 8-бром-2-метил-6-нитрохинолин-5-иламина вместо 5-хлор-2-нитро-4-феноксифениламина на Стадии B. Масс-спектроскопия (ESI/CI): расч. масса для C15H10BrN5O2, 371,0; получено m/z: 372,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,94 (с, 1H), 8,83 (д, J=8,3 Гц, 1H), 8,33 (с, 1H), 8,28 (с, 1H), 7,62 (д, J=8,4 Гц, 1H), 2,74 (с, 3H).

Пример 59: 1-(5-бензилокси-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: получение 5-бензилокси-4-хлор-2-нитрофениламина. Бензиловый спирт (12,5 мл, 0,121 моль), 4,5-дихлор-2-нитрофениламин (5,00 г, 24,2 ммоль), карбонат цезия (15,7 г, 48,3 ммоль) и DMA (110 мл) смешали в герметизируемом сосуде, рассчитанном на работу под давлением. Сосуд продули азотом, загерметизировали и нагревали при 80°C в течение 17 ч. Реакционую смесь влили в солевой раствор (400 мл) и охладили до 0°C. Полученный осадок собрали и растворили в EtOAc (400 мл). Органический слой промыли водой (50 мл) и солевым раствором (50 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (1-50% EtOAc/гексаны, загрузка без воды) и получили искомое соединение (2,47 г, выход 37%). Масс-спектроскопия (ESI/CI): расч. масса для C13H11ClN2O3, 278,1; получено m/z: 279,2 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,20 (с, 1H), 7,50-7,30 (м, 5H), 6,23 (с, 1H), 6,19 (уш с, 2H), 5,16 (с, 2H).

Стадия B: 1-(5-бензилокси-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27. Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O3, 368,1; получено m/z: 369,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,45-13,28 (м, 1H), 12,93 (уш с, 1H), 8,84 (с, 1H), 8,27 (с, 1H), 7,81-7,13 (м, 7H), 5,25 (с, 2H).

Пример 60: 1-(6-хлор-5-m-толилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-хлор-2-нитро-5-m-толилсульфанилфениламин. Смесь, содержащую 3-метилбензолтиол (2,30 мл, 19,3 ммоль), 4,5-дихлор-2-нитрофениламин (2,00 г, 9,66 ммоль), карбонат калия (2,67 г, 19,3 ммоль) и DMF (48 мл), нагревали при температуре 90°C в течение 16 ч. Реакционную смесь охладили до 23°C. Добавили EtOAc и органический слой промыли водным насыщенным раствором NaHCO3 (2×80 мл) и солевым раствором (1×80 мл). Водные слои экстрагировали с помощью EtOAc (3×80 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (0-100% EtOAc/гексаны) и получили искомое соединение (2,30 г, 81%). 1H ЯМР (400 МГц, CDCl3): 8,12 (с, 1H), 7,41-7,36 (м, 3H), 7,34-7,30 (м, 1H), 5,95 (с, 1H), 5,88 (уш с, 2H), 2,41 (с, 3H).

Стадия B: получение 4-хлор-5-m-толилсульфанилбензол-1,2-диамина.

К охлажденному на ледяной бане (0°C) раствору, содержащему 4-хлор-2-нитро-5-m-толилсульфанилфениламин (2,30 г, 7,80 ммоль), хлорид аммония (6,26 г, 117 ммоль), ацетон (32,5 мл) и воду (6,5 мл), был по частям добавлен порошок цинка (5,10 г, 78,0 ммоль). Реакционную смесь извлекали из ледяной бани и через 30 мин фильтровали через Celite® и промывали EtOAc. Фильтрат помещали в делительную воронку и собирали органический слой. Органические слои высушили, профильтровали и сконцентрировали при пониженном давлении. Неочищенный материал в следующей реакции использовали без дальнейшей очистки.

Стадия C: получение 6-хлор-5-m-толилсульфанил-1H-бензоимидазола. К охлажденному (0°C) раствору, содержащему 4-хлор-5-m-толилсульфанилбензол-1,2-диамин (2,07 г, 7,80 ммоль) и триметил ортоформиат (5,81 мл, 53,0 ммоль), добавили концентрированный HCl (0,722 мл, 11,5 ммоль). Реакционную смесь нагревали при 23°C в течение 16 ч, после чего концентрировали при пониженном давлении. К неочищенному продукту добавили EtOAc (100 мл) и органический слой промыли насыщенным водным раствором NaHCO3 (2×75 мл). Водный слой экстрагировали с помощью EtOAc (2×50 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Неочищенный материал использовали на следующей стадии без дополнительной очистки. Масс-спектроскопия (ESI/CI): расч. масса для C14H11ClN2S, 274,0; получено m/z: 275,1 [M+H]+.

Стадия D: 6-хлор-1-(2-метоксиэтоксиметил)-5-m-толилсульфанил-1H-бензоимидазол. К охлажденному раствору (0°C), содержащему 6-хлор-5-m-толилсульфанил-1H-бензоимидазол (2,14 г, 7,78 ммоль) и THF (39 мл), добавили DIPEA (2,71 мл, 15,6 ммоль). Далее по каплям добавили 1-хлорметокси-2-метоксиэтан (0,977 мл, 8,56 ммоль) и дали реакционной смеси нагреться до 23°C в течение 16 ч. Реакционную смесь сконцентрировали. Осадок очистили (КФХ) (0-100% EtOAc/гексаны) и получили искомое соединение (1,89 г, 67%) в виде смеси региоизомеров в отношении 1:1. Масс-спектроскопия (ESI/CI): расч. масса для C18H19ClN2O2S, 362,1; получено m/z: 363,1 [M+H]+. 1H ЯМР (500 МГц, CDCl3): 7,95 (с, 1H), 7,92 (с, 1H), 7,88 (с, 1H), 7,64 (с, 1H), 7,59 (с, 1H), 7,41 (с, 1H), 7,22-7,18 (м, 3H), 7,16-7,13 (м, 2H), 7,11-7,05 (м, 3H), 5,56 (с, 2H), 5,47 (с, 2H), 3,57-3,54 (м, 2H), 3,52-3,49 (м, 2H), 3,48-3,45 (м, 2H), 3,44-3,42 (м, 2H), 3,35 (с, 3H), 3,30 (с, 3H), 2,30 (с, 6H).

Стадия E: 2,6-дихлор-1-(2-метоксиэтоксиметил)-5-m-толилсульфанил-1H-бензоимидазол. Раствор, содержащий 6-хлор-1-(2-метоксиэтоксиметил)-5-m-толилсульфанил-1H-бензоимидазол (1,89 г, 5,21 ммоль) и THF (13 мл), охладили до -78°C на бане из ацетона и сухого льда. По каплям добавили бутиллитий (2,2M раствор в гексанах, 2,60 мл, 5,73 ммоль) и перемешивали реакционную смесь при -78°C в течение 1 ч. (В качестве основания также может использоваться диизопропиламид лития в виде 2,0M раствора в смеси THF/гептан/этилбензол). Добавили раствор N-хлорсукцинимида (765 мг, 5,73 ммоль) в THF (11,5 мл). Реакционной смеси дали нагреться до 23°C и перемешивали в течение 2 ч. Добавили насыщенный водный раствор NH4Cl (20 мл) и экстрагировали неочищенный продукт в CH2Cl2 (3×75 мл). Органические слои высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (0-100% EtOAc/гексаны) и получили искомое соединение (1,46 г, 71%) в виде смеси региоизомеров 1:1. Масс-спектроскопия (ESI/CI): расч. масса для C18H18Cl2N2O2S, 396,0; получено m/z: 397,0 [M+H]+. 1H ЯМР (500 МГц, CDCl3): 7,74 (с, 1H), 7,57 (с, 1H), 7,40 (с, 1H), 7,29 (с, 1H), 7,23-7,18 (м, 3H), 7,18-7,14 (м, 2H), 7,12-7,07 (м, 3H), 5,58 (с, 2H), 5,48 (с, 2H), 3,64-3,60 (м, 2H), 3,54-3,48 (м, 4H), 3,43-3,40 (м, 2H), 3,34 (с, 3H), 3,29 (с, 3H), 2,30 (с, 6H).

Стадия F: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-m-толилсульфанил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К смеси 2,6-дихлор-1-(2-метоксиэтоксиметил)-5-m-толилсульфанил-1H-бензоимидазола (0,500 г, 1,26 ммоль) и DMF (2,52 мл) был добавлен карбонат цезия (0,820 г, 2,52 ммоль) и этиловый эфир 1H-пиразол-4-карбоновой кислоты (0,194 г, 1,38 ммоль). Смесь нагревали при 80°C в течение 2 ч в герметичной пробирке. Смесь охладили до 23°C, влили в солевой раствор (40 мл) и экстрагировали с помощью EtOAc (3×50 мл). Органические слои промыли солевым раствором (40 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (0-50% EtOAc/гексаны) с получением искомого соединения (0,387 г, 61%) в виде смеси региоизомеров 1:1. 1H ЯМР (500 МГц, CDCl3): 8,84 (с, 1H), 8,79 (с, 1H), 8,14 (с, 2H), 7,77 (с, 1H), 7,68 (с, 1H), 7,44 (с, 1H), 7,41 (с, 1H), 7,23-7,18 (м, 4H), 7,18-7,16 (м, 1H), 7,12 (д, J=7,6 Гц, 2H), 7,09 (д, J=7,5 Гц, 1H), 6,09 (с, 2H), 5,98 (с, 2H), 4,36-4,27 (м, 4H), 3,66-3,60 (м, 2H), 3,55-3,50 (м, 2H), 3,48-3,42 (м, 2H), 3,38-3,34 (м, 2H), 3,28 (с, 3H), 3,24 (с, 3H), 2,32 (с, 3H), 2,31 (с, 3H), 1,38-1,30 (м, 6H).

Стадия G: этиловый эфир 1-(6-хлор-5-m-толилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[6-хлор-1-(2-метокси-этоксиметил)-5-m-толилсульфанил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,190 г, 0,379 ммоль) и EtOH (1 мл) добавляли 4M раствор HCl в диоксане (1 мл). Смесь перемешивали в течение 3 ч при 23°C. Реакционную смесь сконцентрировали и добавили Et2O (10 мл). Твердые вещества отфильтровали и промыли Et2O, получив искомое соединение (0,143 г, 91%). Масс-спектроскопия (ESI/CI): расч. масса для C20H17ClN4O2S, 412,1; получено m/z: 413,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d6): 8,95 (с, 1H), 8,35 (с, 1H), 7,77 (с, 1H), 7,41 (с, 1H), 7,29 (т, J=7,7 Гц, 1H), 7,19-7,14 (м, 2H), 7,12-7,06 (м, 1H), 4,30 (кв, J=7,1 Гц, 2H), 2,29 (с, 3H), 1,31 (т, J=7,0 Гц, 3H).

Стадия H: 1-(6-хлор-5-m-толилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. К смеси этилового эфира 1-(6-хлор-5-m-толилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (0,100 г, 0,242 ммоль), THF (1 мл) и воды (0,3 мл) добавили LiOH·H2O (40,7 мг, 0,969 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Растворитель выпаривали, добавляли воду (3 мл) и смесь подкисляли с помощью 1M HCl. Полученный белый осадок отфильтровывали и высушивали с получением искомого соединения (85,0 мг, 89%). Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O2S, 384,0; получено m/z: 385,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,82 (с, 1H), 8,22 (с, 1H), 7,73 (с, 1H), 7,43 (с, 1H), 7,27 (т, J=7,9 Гц, 1H), 7,15-7,10 (м, 2H), 7,04 (д, J=7,9 Гц, 1H), 2,27 (с, 3H).

Пример 61: 1-[6-хлор-5-(4-хлорфенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, за исключением использования 4-хлорбензолтиола вместо 3-метилбензолтиола на Стадии A и использования диизопропиламида лития вместо бутиллития на Стадии E. Масс-спектроскопия (ESI/CI): расч. масса для C17H10Cl2N4O2S, 404,0; получено m/z: 405,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,84 (с, 1H), 8,23 (с, 1H), 7,76 (с, 1H), 7,57 (с, 1H), 7,44-7,40 (м, 2H), 7,23-7,18 (м, 2H).

Пример 62: 1-(6-хлор-5-фенилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, за исключением использования бензолтиола вместо 3-метилбензолтиола на Стадии A и использования диизопропиламида лития вместо бутиллития на Стадии E. Масс-спектроскопия (ESI/CI): расч. масса для C17H11ClN4O2S, 370,0; получено m/z: 371,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,93 (с, 1H), 8,87 (с, 1H), 8,29 (с, 1H), 7,78 (уш с, 1H), 7,49-7,37 (м, 3H), 7,37-7,27 (м, 3H).

Пример 63: 1-[6-хлор-5-(3,4-дихлорфенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, за исключением использования 3,4-дихлорбензолтиола вместо 3-метилбензолтиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C17H9Cl3N4O2S, 437,9; получено m/z: 438,9 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,82 (с, 1H), 8,17 (с, 1H), 7,78 (с, 1H), 7,75 (с, 1H), 7,56 (д, J=8,5 Гц, 1H), 7,33 (д, J=1,8 Гц, 1H), 7,06 (дд, J=8,5, 2,2 Гц, 1H).

Пример 64: 1-[6-хлор-5-(3-метоксифенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, за исключением использования 3-метоксибензолтиола вместо 3-метилбензолтиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O3S, 400,0; получено m/z: 401,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,87 (д, J=0,5 Гц, 1H), 8,28 (д, J=0,5 Гц, 1H), 7,78 (уш с, 1H), 7,50 (уш с, 1H), 7,32-7,29 (м, 1H), 6,89 (ддд, J=8,3, 2,4, 0,9 Гц, 1H), 6,82-6,79 (м, 2H), 3,72 (с, 3H).

Пример 65: 1-[6-хлор-5-(4-метоксифенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, за исключением использования 4-метоксибензолтиола вместо 3-метилбензолтиола на Стадии A и использования диизопропиламида лития вместо бутиллития на Стадии E. Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O3S, 400,0; получено m/z: 401,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,72 (с, 1H), 8,14 (с, 1H), 7,64 (с, 1H), 7,39 (д, J=8,6 Гц, 2H), 7,08 (с, 1H), 7,04 (д, J=8,8 Гц, 2H), 3,80 (с, 3H).

Пример 66: 1-(5-бензилсульфанил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Способ A:

Стадия A: 5-бензилсульфанил-4-хлор-2-нитрофениламин. К смеси 4,5-дихлор-2-нитрофениламина (3,00 г, 14,5 ммоль) и DMF (72 мл) добавили K2CO3 (5,31 г, 29,0 ммоль) и фенилметантиол (3,94 г, 31,7 ммоль). Смесь нагревали при температуре 70°C в течение 18 ч, а затем охлаждали до 23°C. Реакционную смесь растворяли в EtOAc (200 мл), промывали насыщенным раствором бикарбоната натрия (100 мл), промывали солевым раствором (3×100 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (5-45% EtOAc/гексаны) с получением искомого соединения (2,39 г, 56%). Масс-спектроскопия (ESI/CI): расч. масса для C13H11ClN2O2S, 294,0; получено m/z: 295,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 7,96 (с, 1H), 7,56 (с, 2H), 7,50 (д, J=7,2 Гц, 2H), 7,37 (т, J=7,5 Гц, 2H), 7,31 (т, J=7,4 Гц, 1H), 7,05 (с, 1H), 4,27 (с, 2H).

Стадия B: этиловый эфир 1-[5-бензилсульфанил-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии А-Е, за исключением использования 5-бензилсульфанил-4-хлор-2-нитрофениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C24H25ClN4O4S, 500,1; получено m/z: 501,1 [M+H]+.

Стадия C: этиловый эфир 1-(5-бензилсульфанил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[5-бензилсульфанил-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (96,0 мг, 0,192 ммоль) и EtOH (5 мл) добавили 4M раствор HCl в диоксане (5 мл, 20 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Реакционную смесь сконцентрировали при пониженном давлении и полученный осадок растерли в Et2O. Полученную суспензию отфильтровали и промыли Et2O, получив искомое соединение (69,0 мг, 87%). Масс-спектроскопия (ESI/CI): расч. масса для C20H17ClN4O2S, 412,1; получено m/z: 413,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,53 (д, J=12,3 Гц, 1H), 8,95 (с, 1H), 8,35 (с, 1H), 7,78 (с, 0,5H), 7,65 (с, 0,5H), 7,55 (с, 0,5H), 7,44 (с, 0,5H), 7,38 (д, J=7,2 Гц, 2H), 7,31 (т, J=7,4 Гц, 2H), 7,25 (с, 1H), 4,32-4,26 (м, 4H), 1,32 (т, J=7,1 Гц, 3H).

Стадия D: 1-(5-бензилсульфанил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. К смеси этилового эфира 1-(5-бензилсульфанил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (57,0 мг, 0,127 ммоль), THF (2 мл) и воды (0,67 мл) добавили LiOH·H2O (27,0 мг, 0,654 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Реакционную смесь сконцентрировали при пониженном давлении, добавили воду (3 мл) и подкислили смесь до pH=3 при помощи 1M HCl. Полученный белый осадок отфильтровали и высушили с получением искомого соединения (39,0 мг, 80%). Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O2S, 384,0; получено m/z: 385,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,86 (с, 1H), 8,29 (с, 1H), 7,67 (с, 1H), 7,53 (с, 1H), 7,39 (д, J=7,4 Гц, 2H), 7,31 (т, J=7,4 Гц, 2H), 7,25 (т, J=7,1 Гц, 1H), 4,29 (с, 2H).

Способ B:

Стадия A: этиловый эфир 1-[5-трет-бутилсульфанил-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ A, Стадии A-B, за исключением использования 2-метил-пропан-2-тиола вместо фенил-метантиола на Стадии A, чтобы получить смесь региоизомеров с отношением 1:1 Масс-спектроскопия (ESI/CI): расч. масса для C21H27ClN4O4S, 466,1; получено m/z: 467,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,89-8,88 (м, 2H), 8,19 (с, 2H), 8,03 (с, 1H), 7,93 (с, 1H), 7,85 (с, 1H), 7,78 (с, 1H), 6,17 (с, 2H), 6,13 (с, 2H), 4,39-4,33 (м, 4H), 3,71-3,64 (м, 4H), 3,50-3,42 (м, 4H), 3,31 (с, J=5,1 Гц, 3H), 3,30 (с, 3H), 1,43-1,29 (м, 24H).

Стадия B: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(2-нитрофенилдисульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К перемешанному раствору, содержащему этиловый эфир 1-[5-трет-бутилсульфанил-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (3,00 г, 6,42 ммоль) и DCM (32 мл), добавили карбонат калия (1,78 г, 12,9 ммоль). Реакционную смесь обработали 2-нитробензолсульфенилхлоридом (3,05 г, 16,1 ммоль) и перемешивали при 23°C в течение 16 ч. Полученный осадок сконцентрировали и очистили методом КФХ (5-30% EtOAc/гексаны) с получением искомого соединения (2,99 г, выход неочищенного продукта 82%) в виде смеси региоизомеров с соотношением 2:1. Данное соединение использовали в последующих реакциях без дальнейшей очистки. Масс-спектроскопия (ESI/CI): расч. масса для C23H22ClN5O6S2, 563,1; получено m/z: 564,1 [M+H]+. 1H ЯМР (600 МГц, CDCl3): 8,85-8,82 (м, 2H), 8,17 (с, 2H), 7,75 (с, 0,66H), 7,72 (с, 1,34H), 7,68 (с, 1,34H), 7,64 (с, 0,66H), 7,45-7,42 (м, 4H), 7,31-7,26 (м, 4H), 6,09 (д, J=2,1 Гц, 4H), 4,36 (к, J=7,1 Гц, 4H), 3,67-3,62 (м, 4H), 3,49-3,42 (м, 4H), 3,31 (д, J=1,9, 6H), 1,38 (т, J=7,1 Гц, 6H).

Стадия C: этиловый эфир 1-[6-хлор-5-меркапто-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К перемешанному охлажденному (0°C) раствору, содержащему этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(2-нитрофенилдисульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (2,99 г, 5,29 ммоль) и EtOH (24 мл), по каплям добавляли раствор NaBH4 (0,729 г, 19,3 ммоль), EtOH (24 мл) и воды (10 мл) в течение 10 мин. Реакционную смесь перемешивали 15 мин, после чего добавили новую порцию NaBH4 (0,486 г, 12,8 ммоль) в EtOH (16 мл) и воду (6,7 мл). Реакционную смесь перемешивали в течение еще 30 мин, после чего разделили между DCM (200 мл) и водой (200 мл). Водный слой подкислили до pH 5 с помощью 1M HCl и экстрагировали продукт в DCM (3×300 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (5-80% EtOAc/гексаны) с получением искомого соединения (1,27 г, 48%) в виде смеси региоизомеров 2:1. Масс-спектроскопия (ESI/CI): расч. масса для C17H19ClN4O4S, 410,1; получено m/z: 411,1 [M+H]+. 1H ЯМР (600 МГц, CDCl3): 8,85-8,84 (м, 2H), 8,17 (с, 2H), 7,75 (с, 0,67H), 7,72 (с, 1,33 H), 7,68 (с, 1,33H), 7,64 (с, 0,67H), 6,10-6,09 (м, 4H), 4,36 (к, J=7,1 Гц, 4H), 4,02 (с, 0,67H), 3,93 (с, 1,33H), 3,66-3,62 (м, 4H), 3,47-3,44 (м, 4H), 3,31-3,30 (м, 6H), 1,38 (т, J=7,1 Гц, 6H). При широкомасштабном синтезе искомого соединения также получается димерный побочный продукт, димерная связь которого представляет собой сульфидную связь с образованием дисульфидного промежуточного соединения этилового эфира 1-[6-хлор-5-меркапто-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты, побочный продукт которого выделили, но не протестировали: масс-спектроскопия (ESI/CI): расч. масса для C34H36Cl2N8O8S2, 818,1; получено m/z: 819,1 [M+H]+.

Стадия D: этиловый эфир 1-[5-бензилсульфанил-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору, содержащему этиловый эфир 1-[6-хлор-5-меркапто-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,300 г, 0,730 ммоль), бромистый бензил (0,130 мл, 1,10 ммоль) и DMF (20 мл), добавили карбонат калия (0,151 г, 1,10 ммоль). Реакционную смесь перемешивали в течение 15 мин при 23°C и влили в воду (40 мл). Продукт экстрагировали с помощью EtOAc (3×50 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (2-50% EtOAc/гексаны) с получением искомого соединения (0,330 г, 90%). Масс-спектроскопия (ESI/CI): расч. масса для C24H25ClN4O4S, 500,1; получено m/z: 501,1 [M+H]+.

Стадия E: этиловый эфир 1-(5-бензилсульфанил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[5-бензилсульфанил-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (160 мг, 0,319 ммоль) и EtOH (3,2 мл) добавили 4M раствор HCl в диоксане (3,21 мл, 12,8 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Реакционную смесь сконцентрировали и полученный осадок растерли в Et2O. Суспензию отфильтровали и промыли Et2O с получением искомого соединения (0,125 г, 95%). Масс-спектроскопия (ESI/CI): расч. масса для C20H17ClN4O2S, 412,1; получено m/z: 413,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6); 13,53 (д, J=12,3 Гц, 1H), 8,95 (с, 1H), 8,35 (с, 1H), 7,78 (с, 0,5H), 7,65 (с, 0,5H), 7,55 (с, 0,5H), 7,44 (с, 0,5H), 7,38 (д, J=7,2 Гц, 2H), 7,31 (т, J=7,4 Гц, 2H), 7,25 (с, 1H), 4,32-4,26 (м, 4H), 1,32 (т, J=7,1 Гц, 3H).

Стадия F: 1-(5-бензилсульфанил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. К смеси этилового эфира 1-(5-бензилсульфанил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (0,115 г, 0,256 ммоль), THF (4,8 мл) и воды (1,2 мл) добавили LiOH·H2O (0,107 г, 2,56 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Растворитель выпаривали, добавляли воду (3 мл) и смесь подкисляли до pH 3 с помощью 1M HCl. Полученный белый осадок отфильтровывали и высушивали с получением искомого соединения (97,0 мг, 99%). Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O2S, 384,0; получено m/z: 385,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,86 (с, 1H), 8,29 (с, 1H), 7,67 (с, 1H), 7,53 (с, 1H), 7,39 (д, J=7,4 Гц, 2H), 7,31 (т, J=7,4 Гц, 2H), 7,25 (т, J=7,1 Гц, 1H), 4,29 (с, 2H).

Пример 67: 1-[5-(4-трет-бутилбензилсульфанил)-6-хлор-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ A, за исключением использования (4-трет-бутилфенил)-метантиола вместо фенилметантиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C22H21ClN4O2S, 440,1; получено m/z: 441,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,80 (с, 1H), 8,21 (с, 1H), 7,64 (с, 1H), 7,59 (с, 1H), 7,34-7,23 (м, 4H), 4,21 (с, 2H), 1,26 (с, 9H).

Пример 68: 1-[6-хлор-5-(4-фторбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ A, за исключением использования (4-фторфенил)-метантиола вместо фенилметантиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C18H12ClFN4O2S, 402,0; получено m/z: 403,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,85 (с, 1H), 8,28 (с, 1H), 7,67 (с, 1H), 7,60-7,46 (м, 1H), 7,39 (дд, J=8,7, 5,5 Гц, 2H), 7,19-7,06 (м, 2H), 4,27 (с, 2H).

Пример 69: 1-[6-хлор-5-(2-хлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ A, за исключением использования (2-хлорфенил)-метантиола вместо фенилметантиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C18H12Cl2N4O2S, 418,0; получено m/z: 419,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,84 (с, 1H), 8,26 (с, 1H), 7,68 (с, 1H), 7,52 (с, 1H), 7,46 (дд, J=7,9, 1,2 Гц, 1H), 7,34 (дд, J=7,5, 1,7 Гц, 1H), 7,29 (тд, J=7,6, 1,8 Гц, 1H), 7,24 (тд, J=7,4, 1,3 Гц, 1H), 4,31 (с, 2H).

Пример 70: 1-(6-хлор-5-фенэтилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ A, за исключением использования 2-фенилэтантиола вместо фенилметантиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C19H15ClN4O2S, 398,1; получено m/z: 399,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,26 (с, 1H), 8,86 (с, 1H), 8,28 (с, 1H), 7,69 (с, 1H), 7,60 (с, 1H), 7,34-7,29 (м, 4H), 7,24-7,21 (м, 1H), 3,30-3,25 (м, 2H), 2,95-2,90 (м, 2H).

Пример 71: 1-(6-метилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 5-метилсульфанил-2-нитро-4-трифторметилфениламин. К раствору 5-хлор-2-нитро-4-трифторметилфениламина (2,02 г, 8,40 ммоль) в DMF (40 мл) добавили тиометоксид натрия (0,618 г, 8,82 ммоль). Смесь нагревали при 90°C в течение 50 мин, после чего влили в солевой раствор. Добавили воду, доведя общий объем до 300 мл и собрали оранжевый осадок, получив искомое соединение (2,02 г, 95%). 1H ЯМР (400 МГц, CDCl3): 8,42 (с, 1H), 6,51 (с, 1H), 6,39 (уш с, 2H), 2,53 (с, 3H).

Стадия B: этиловый эфир 1-[1-(2-метоксиэтоксиметил)-6-метилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии А-Е, за исключением использования 5-метилсульфанил-2-нитро-4-трифторметилфениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Итоговый продукт получали в виде смеси региоизомеров 1:1. Масс-спектроскопия (ESI/CI): расч. масса для C19H21F3N4O4S, 458,1; получено m/z: 459,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,91 (с, 1H), 8,88 (с, 1H), 8,21-8,19 (м, 2H), 8,03 (с, 1H), 7,96 (с, 1H), 7,76 (с, 1H), 7,65 (с, 1H), 6,22-6,19 (м, 4H), 4,37 (кв, J=7,1 Гц, 4H), 3,70-3,63 (м, 4H), 3,49-3,45 (м, 4H), 3,32-3,30 (м, 6H), 2,61-2,57 (м, 6H), 1,39 (т, J=7,1 Гц, 6H).

Стадия C: 1-(6-метилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. К перемешанному раствору этилового эфира 1-[1-(2-метоксиэтоксиметил)-6-метилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,200 г, 0,436 ммоль) и уксусной кислоты (1,3 мл) добавили водный 6M раствор соляной кислоты (1,3 мл). Реакционная смесь нагревалась при температуре 100°C в течение 18 ч, а затем охлаждалась до 23°C. Осадок собрали, получив искомое соединение в форме соли HCl (0,118 г, выход 71%). Масс-спектроскопия (ESI/CI): расч. масса для C13H9F3N4O2S, 342,0; получено m/z: 343,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,92 (д, J=0,6 Гц, 1H), 8,33 (д, J=0,4 Гц, 1H), 7,90 (с, 1H), 7,68 (с, 1H), 2,59 (с, 3H).

Пример 72: 1-(6-пропилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 2-нитро-5-пропилсульфанил-4-трифторметилфениламин. К смеси 5-хлор-2-нитро-4-трифторметилфениламина (1,50 г, 6,26 ммоль), карбоната калия (1,72 г, 12,5 ммоль) и DMF (31 мл) добавили 1-пропантиол (0,620 мл, 6,86 ммоль). Реакционную смесь нагревали при 90°C в течение 16 ч, после чего дали охладиться до 23°C и влили в смесь льда и солевого раствора (300 мл). Полученный желтый осадок собрали, получив искомое соединение (1,67 мг, 95%). Масс-спектроскопия (ESI/CI): расч. масса для C10H11F3N2O2S, 280,1; получено m/z: 281,0 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,41 (с, 1H), 6,58 (с, 1H), 6,36 (уш с, 2H), 2,97 (т, J=7,3 Гц, 2H), 1,87-1,72 (м, 2H), 1,10 (т, J=7,4 Гц, 3H).

Стадия B: 1-(6-пропилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, Стадии B-C. Осадок очистили методом обратно-фазовой ВЭЖХ с получением искомого соединения. Масс-спектроскопия (ESI/CI): расч. масса для C15H13F3N4O2S, 370,1; получено m/z: 371,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,77 (с, 1H), 13,02 (с, 1H), 8,92 (д, J=0,6 Гц, 1H), 8,34 (д, J=0,6 Гц, 1H), 8,17-7,54 (м, 2H), 3,02 (т, J=7,1 Гц, 2H), 1,68-1,52 (м, 2H), 0,98 (т, J=7,3 Гц, 3H).

Пример 73: 1-(6-изопропилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 72, за исключением использования 2-пропантиола вместо 1-пропантиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C15H13F3N4O2S, 370,1; получено m/z: 371,1 [M+H]+. 1H ЯМР (400 МГц, CD3OD, таутомерное уширение): 8,94 (с, 1H), 8,21 (с, 1H), 8,03-7,78 (м, 2H), 3,53-3,38 (м, 1H), 1,29 (д, J=6,7 Гц, 6H).

Пример 74: 1-(5-фтор-6-метилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, за исключением использования 4,5-дифтор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H9FN4O2S, 292,0; получено m/z: 293,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,87 (с, 1H), 8,29 (с, 1H), 7,48 (д, J=6,7 Гц, 1H), 7,43 (д, J=10,1 Гц, 1H), 2,52 (с, 3H).

Пример 75: 1-(5-хлор-6-метилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, за исключением использования 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C13H9ClN4O2S, 308,0; получено m/z: 309,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,87 (д, J=0,6 Гц, 1H), 8,30 (д, J=0,5 Гц, 1H), 7,67 (с, 1H), 7,43 (с, 1H), 2,54 (с, 3H).

Пример 76: 1-(5-хлор-6-этилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, за исключением использования 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина и использования тиоэтоксида натрия вместо тиометоксида натрия на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C13H11ClN4O2S, 322,0; получено m/z: 323,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,85 (с, 1H), 8,27 (с, 1H), 7,65 (с, 1H), 7,53 (с, 1H), 2,99 (к, J=7,3 Гц, 2H), 1,25 (т, J=7,3 Гц, 3H).

Пример 77: 1-(5-хлор-6-изопропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, за исключением использования 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина и использования тиоизопропоксида натрия вместо тиометоксида натрия на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C14H13ClN4O2S, 336,0; получено m/z: 337,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,89 (с, 1H), 8,30 (с, 1H), 7,70 (с, 1H), 7,68 (с, 1H), 3,56-3,48 (м, 1H), 1,27 (д, J=6,6 Гц, 6H).

Пример 78: 1-(5-хлор-6-пропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, за исключением использования 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A; а также с выделением конечного соединения на Стадии B без очистки методом обратно-фазной ВЭЖХ. Масс-спектроскопия (ESI/CI): расч. масса для C14H13ClN4O2S, 336,0; получено m/z: 337,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,88 (с, 1H), 8,30 (с, 1H), 7,68 (с, 1H), 7,55 (с, 1H), 2,98 (т, J=7,2 Гц, 2H), 1,64 (h, J=7,3 Гц, 2H), 1,02 (т, J=7,3 Гц, 3H).

Пример 79: 1-(6-метилсульфанил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C13H9F3N4O3S, 358,0; получено m/z: 359,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,00 (уш с, 1H), 8,88 (с, 1H), 8,32 (с, 1H), 7,81-7,12 (м, 2H), 2,54 (с, 3H).

Пример 80: 1-(6-изопропилсульфанил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 72, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина и использования 2-пропантиола вместо 1-пропантиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C15H13F3N4O3S, 386,1; получено m/z: 387,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,65 (с, 1H), 13,00 (с, 1H), 8,89 (д, J=0,5 Гц, 1H), 8,32 (д, J=0,5 Гц, 1H), 7,65 (уш с, 2H), 3,57-3,44 (уш м, 1H), 1,24 (д, J=6,6 Гц, 6H).

Пример 81: 1-(6-пропилсульфанил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 72, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C15H13F3N4O3S, 386,1; получено m/z: 387,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,80-12,75 (м, 2H), 8,88 (д, J=0,6 Гц, 1H), 8,32 (д, J=0,6 Гц, 1H), 7,57 (с, 2H), 2,98 (т, J=7,2 Гц, 2H), 1,68-1,53 (м, 2H), 0,99 (т, J=7,3 Гц, 3H).

Пример 82: 1-[6-хлор-5-(толуол-3-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(толуол-3-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-m-толилсульфанил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из ПРИМЕРА 60, продукт Стадии F) (0,160 г, 0,319 ммоль) и MeOH (1,6 мл) добавили раствор реактива Oxone® (0,412 г, 0,671 ммоль) в воде (1,7 мл) при 23°C. Реакционную смесь перемешивали при 23°C в течение 16 ч. Добавили дихлорметан (30 мл), а затем раствор тиосульфата натрия (0,106 г, 0,670 ммоль) в насыщенном на 80% водном растворе NaHCO3 (30 мл). Смесь тщательно перемешивали, пока оба слоя не стали прозрачными. Органический слой собрали, а водный слой экстрагировали при помощи CH2Cl2 (2×50 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (0-100% EtOAc/гексаны), получив искомое соединение (0,105 мг, 62%) в виде смеси региоизомеров. Масс-спектроскопия (ESI/CI): расч. масса для C24H25ClN4O6S, 532,1; получено m/z: 533,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,90 (д, J=0,6 Гц, 1,5H), 8,89 (д, J=0,6 Гц, 0,5H), 8,73 (уш с, 1,5H), 8,69 (уш с, 0,5H), 8,19 (д, J=0,6 Гц, 0,5H), 8,18 (д, J=0,6, 1,5H), 7,79-7,75 (м, 2H), 7,75-7,72 (м, 2H), 7,71 (с, 0,5H), 7,67 (с, 1,5H), 7,39-7,36 (м, 4H), 6,27 (с, 1H), 6,14 (с, 3H), 4,40-4,32 (м, 4H), 3,71-3,67 (м, 1H), 3,66-3,61 (м, 3H), 3,49-3,45 (м, 1H), 3,44-3,39 (м, 3H), 3,28 (с, 1,5H), 3,24 (с, 4,5H), 2,38 (уш с, 6H), 1,38-1,33 (м, 6H).

Стадия B: 1-[6-хлор-5-(толуол-3-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии G-H. Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O4S, 416,0; получено m/z: 417,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,93 (д, J=0,5 Гц, 1H), 8,44 (с, 1H), 8,33 (д, J=0,4 Гц, 1H), 7,75-7,69 (м, 3H), 7,53-7,48 (м, 2H), 2,37 (с, 3H).

Пример 83: 1-(5-бензолсульфонил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 82, из этилового эфира 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-фенилсульфанил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт из Примера 62). Масс-спектроскопия (ESI/CI): расч. масса для C17H11ClN4O4S, 402,0; получено m/z: 403,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,94 (с, 1H), 8,47 (с, 1H), 8,35 (с, 1H), 7,95-7,89 (м, 2H), 7,76 (уш с, 1H), 7,74-7,67 (м, 1H), 7,65-7,58 (м, 2H).

Пример 84: 1-[6-хлор-5-(4-метоксибензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 82, из этилового эфира 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(4-метоксифенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт из Примера 65). Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O5S, 432,0; получено m/z: 433,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 14,09 (уш с, 1H), 13,04 (уш с, 1H), 8,94 (с, 1H), 8,42 (с, 1H), 8,35 (с, 1H), 7,89-7,84 (м, 2H), 7,75 (уш с, 1H), 7,14-7,10 (м, 2H), 3,84 (с, 3H).

Пример 85: 1-[6-хлор-5-(4-хлорбензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-5-(4-хлорбензолсульфонил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-хлор-5-(4-хлорфенилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт из Примера 61) (2,69 г, 5,16 ммоль) и дихлорметана (26 мл) добавили mCPBA (2,43 г, 10,8 ммоль) при 23°C. Реакционную смесь перемешивали в течение 16 ч при 23°C. Добавили дихлорметан (30 мл), а затем раствор тиосульфата натрия (1,71 г, 10,8 ммоль) в насыщенном на 80% водном растворе NaHCO3 (30 мл). Смесь тщательно перемешивали, пока оба слоя не стали прозрачными. Органический слой собрали, а водный слой экстрагировали при помощи CH2Cl2 (2×80 мл). Органические слои объединили, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (0-100% EtOAc/гексаны), получив искомое соединение (2,55 г, 89%) в виде смеси региоизомеров. Масс-спектроскопия (ESI/CI): расч. масса для C23H22Cl2N4O6S, 552,1; получено m/z: 553,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,91-8,89 (м, 2H), 8,73 (с, 1,4H), 8,68 (с, 0,6H), 8,20 (д, J=0,6 Гц, 0,6H), 8,18 (д, J=0,6 Гц, 1,4H), 7,91-7,87 (м, 4H), 7,72 (с, 0,6H), 7,68 (с, 1,4H), 7,48-7,43 (м, 4H), 6,27 (с, 1,2 H), 6,15 (с, 2,8H), 4,39-4,32 (м, 4H), 3,71-3,66 (м, 1,2H), 3,67-3,62 (м, 2,8H), 3,48-3,45 (м, 1,2H), 3,44-3,40 (м, 2,8H), 3,28 (с, 1,8H), 3,24 (с, 4,2H), 1,40-1,34 (м, 6H).

Стадия B: этиловый эфир 1-[6-хлор-5-(4-хлорбензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[6-хлор-5-(4-хлорбензолсульфонил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (2,55 г, 4,61 ммоль) и EtOH (11,5 мл) добавили 4M раствор HCl в диоксане (11,5 мл). Смесь перемешивали в течение 3 ч при 23°C. Реакционную смесь сконцентрировали и добавили Et2O. Твердые вещества отфильтровали и промыли Et2O, получив искомое соединение (1,92 г, 89%). Масс-спектроскопия (ESI/CI): расч. масса для C19H14Cl2N4O4S, 464,0; получено m/z: 465,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6 ): 9,02 (с, 1H), 8,45 (с, 1H), 8,40 (с, 1H), 7,95-7,92 (м, 2H), 7,76 (уш с, 1H), 7,70-7,67 (м, 2H), 4,30 (к, J=7,1 Гц, 2H), 1,32 (т, J=7,1 Гц, 3H).

Стадия C: 1-[6-хлор-5-(4-хлорбензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. К смеси этилового эфира 1-[6-хлор-5-(4-хлорбензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (1,92 г, 4,13 ммоль), THF (16 мл) и воды (5 мл) добавили LiOH·H2O (0,693 г, 16,5 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Растворитель выпаривали, добавляли воду (10 мл) и смесь подкисляли с помощью 1M HCl. Полученный осадок отфильтровывали и высушивали с получением искомого соединения (1,73 г, 94%). Масс-спектроскопия (ESI/CI): расч. масса для C17H10Cl2N4O4S, 436,0; получено m/z: 437,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,89 (с, 1H), 8,40 (с, 1H), 8,25 (с, 1H), 7,93-7,90 (м, 2H), 7,69-7,66 (м, 3H).

Пример 86: 1-[6-хлор-5-(4-трифторметоксибензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(4-трифторметоксифенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в Примере 60, Стадии A-F, за исключением использования 4-трифторметокси-бензолтиола вместо 3-метил-бензолтиола на Стадии A.

Стадия B: 1-[6-хлор-5-(4-трифторметоксибензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в Примере 85. Масс-спектроскопия (ESI/CI): расч. масса для C18H10ClF3N4O5S, 486,0; получено m/z: 487,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,77 (с, 1H), 8,29 (с, 1H), 8,02 (с, 1H), 8,01-7,97 (м, 2H), 7,56 (д, J=8,1 Гц, 2H), 7,45 (с, 1H).

Пример 87: 1-[6-хлор-5-(3,4-дихлорбензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-(3,4-дихлорфенилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 63). Масс-спектроскопия (CI): расч. масса для C17H9Cl3N4O4S, 469,9; получено m/z: 468,9 [M-H]-. 1H ЯМР (600 МГц, DMSO-d 6): 8,95 (с, 1H), 8,48 (уш с, 1H), 8,34 (с, 1H), 8,16 (д, J=1,6 Гц, 1H), 7,92-7,88 (м, 2H), 7,78 (уш с, 1H).

Пример 88: 1-[6-хлор-5-(3-метоксибензолсульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(3-метоксифенилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 64). Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O5S, 432,0; получено m/z: 433,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 14,15 (с, 1H), 13,04 (с, 1H), 8,95 (д, J=0,5 Гц, 1H), 8,45 (с, 1H), 8,36 (с, 1H), 7,77 (уш с, 1H), 7,53 (т, J=8,0 Гц, 1H), 7,48-7,43 (м, 1H), 7,41-7,38 (м, 1H), 7,27 (ддд, J=8,3, 2,6, 1,0 Гц, 1H), 3,81 (с, 3H).

Пример 89: 1-(6-хлор-5-фенилметансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[5-бензилсульфанил-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 66). Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O4S, 416,0; получено m/z: 417,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,92 (с, 1H), 8,33 (с, 1H), 7,98-7,82 (м, 2H), 7,33-7,15 (м, 5H), 4,86 (с, 2H).

Пример 90: 1-[6-хлор-5-(2,4,6-триметилфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(2,4,6-триметилбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ A, Стадии A-B, за исключением использования (2,4,6-триметилфенил)-метантиола вместо фенил-метантиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C27H31ClN4O4S, 542,2; получено m/z: 543,2 [M+H]+.

Стадия B: 1-[6-хлор-5-(2,4,6-триметилфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в Примере 85. Масс-спектроскопия (ESI/CI): расч. масса для C21H19ClN4O4S, 458,1; получено m/z: 459,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,95 (с, 1H), 8,35 (с, 1H), 8,13 (с, 1H), 7,94 (с, 1H), 6,90 (с, 2H), 4,85 (с, 2H), 2,32 (с, 6H), 2,23 (с, 3H).

Пример 91: 1-[6-хлор-5-(4-метоксифенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-5-(4-метоксибензилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ A, Стадии A-B, за исключением использования (4-метоксифенил)-метантиола вместо фенилметантиола на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C25H27ClN4O5S, 530,1; получено m/z: 531,1 [M+H]+.

Стадия B: 1-[6-хлор-5-(4-метоксифенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в Примере 85. Масс-спектроскопия (ESI/CI): расч. масса для C19H15ClN4O5S, 446,1; получено m/z: 447,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,92 (с, 1H), 8,34 (с, 1H), 8,03 (с, 0,6H), 7,92 (с, 0,4H), 7,83 (с, 0,6H), 7,74 (с, 0,4H), 7,11 (д, J=8,7 Гц, 2H), 6,82 (д, J=8,4 Гц, 2H), 4,79 (с, 2H), 3,68 (с, 3H).

Пример 92: 1-[6-хлор-5-(4-фторфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-(4-фторбензилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 68). Масс-спектроскопия (ESI/CI): расч. масса для C18H12ClFN4O4S, 434,0; получено m/z: 435,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,92 (с, 1H), 8,32 (с, 1H), 7,95-7,83 (м, 2H), 7,26-7,21 (м, 2H), 7,11 (т, J=8,8 Гц, 2H), 4,87 (с, 2H).

Пример 93: 1-[6-хлор-5-(2-хлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-(2-хлорбензилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 69). Масс-спектроскопия (ESI/CI): расч. масса для C18H12Cl2N4O4S, 450,0; получено m/z: 451,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 14,05 (с, 1H), 13,02 (с, 1H), 8,94 (с, 1H), 8,34 (с, 1H), 8,04-7,83 (м, 2H), 7,43 (дд, J=7,2 Гц, 2,1 Гц, 1H), 7,40 (дд, J=7,7 Гц, 1,5, 1H), 7,34 (pd, J=7,3 Гц, 1,8 Гц, 2H), 5,02 (с, 2H).

Пример 94: 1-[6-хлор-5-(2-фенилэтансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-фенэтилсульфанил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 70). Масс-спектроскопия (ESI/CI): расч. масса для C19H15ClN4O4S, 430,1; получено m/z: 431,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,95 (с, 1H), 8,35 (с, 1H), 8,16 (с, 1H), 7,84 (с, 1H), 7,22-7,16 (м, 4H), 7,15-7,11 (м, 1H), 3,88-3,82 (м, 2H), 2,96-2,87 (м, 2H).

Пример 95: 1-(5-хлор-6-этансульфинил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[1-(2-метоксиэтоксиметил)-6-этилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, Стадии A-B, за исключением использования 4,5-дихлор-2-нитро-фениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина и использования тиоэтоксида натрия вместо тиометоксида натрия на Стадии A. Наблюдалась смесь региоизомеров в отношении 1:1. 1H ЯМР (600 МГц, CDCl3): 8,86 (д, J=0,6 Гц, 1H), 8,85 (д, J=0,6 Гц, 1H), 8,18 (с, 2H), 7,75 (с, 1H), 7,68 (с, 1H), 7,67 (с, 1H), 7,56 (с, 1H), 6,14 (с, 2H), 6,10 (с, 2H), 4,36 (кв, J=7,1 Гц, 4H), 3,68-3,63 (м, 4H), 3,48-3,44 (м, 4H), 3,31 (с, 3H), 3,31 (с, 3H), 3,02 (п, J=7,3 Гц, 4H), 1,41-1,36 (м, 12H).

Стадия B: этиловый эфир 1-[1-(2-метоксиэтоксиметил)-6-этилсульфинил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[1-(2-метоксиэтоксиметил)-6-этилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,501 г, 1,14 ммоль) и MeOH (5,7 мл) добавили раствор реактива Oxone®/ калия пероксимоносульфата (1,47 г, 2,40 ммоль) в воде (5,7 мл). Смесь перемешивали в течение 44 ч при 23°C. Добавили EtOAc (50 мл) и воду (30 мл) и двухфазную смесь перемешали. Слои разделили и водный слой подвергли экстрагированию с помощью EtOAc (50 мл). Объединенные органические слои промыли солевым раствором, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (10-80% EtOAc/гексаны), получив искомое соединение (0,232 г, выход 45%, смесь региоизомеров 2:1) и этиловый эфир 1-[1-(2-метоксиэтоксиметил)-6-этилсульфонил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,260 г, выход 48%, смесь региоизомеров 5:2). Масс-спектроскопия (ESI/CI): расч. масса для C13H23ClN4O5S, 454,1; получено m/z: 455,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,90 (д, J=0,6 Гц, 1H), 8,20 (д, J=0,6 Гц, 1H), 8,13 (с, 1H), 7,74 (с, 1H), 6,25-6,16 (м, 2H), 4,37 (кв, J=7,1 Гц, 2H), 3,68-3,62 (м, 2H), 3,46-3,41 (м, 2H), 3,27 (с, 3H), 3,26-3,13 (м, 1H), 2,94-2,83 (м, 1H), 1,39 (т, J=7,1 Гц, 3H), 1,27 (т, J=7,4 Гц, 3H).

Стадия C: этиловый эфир 1-(5-хлор-6-этансульфинил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[1-(2-метоксиэтоксиметил)-6-этилсульфинил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,191 г, 0,420 ммоль) в этаноле (2 мл) добавили 4M раствор HCl в диоксане (2 мл). Реакционную смесь перемешивали при 23°C в течение 2 ч. Полученный осадок собрали и промыли диэтиловым эфиром, получив искомое соединение (0,103 г, выход 67%). Масс-спектроскопия (ESI/CI): расч. масса для C15H15ClN4O3S, 366,1; получено m/z: 367,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 9,02 (д, J=0,6 Гц, 1H), 8,40 (д, J=0,6 Гц, 1H), 7,87 (с, 1H), 7,80 (с, 1H), 4,30 (кв, J=7,1 Гц, 2H), 3,17 (дкв, J=14,6, 7,3 Гц, 1H), 2,84 (дкв, J=14,6, 7,4 Гц, 1H), 1,32 (т, J=7,1 Гц, 3H), 1,08 (т, J=7,3 Гц, 3H).

Стадия D: 1-(5-хлор-6-этансульфинил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. К раствору, содержащему этиловый эфир 1-(5-хлор-6-этансульфинил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (100 мг, 0,273 ммоль), THF (1,0 мл) и воду (0,33 мл), был добавлен гидроксид лития (31,3 мг, 0,818 ммоль). Смесь подвергли краткой ультразвуковой обработке и перемешивали при 23°C в течение 56 ч. Растворитель выпарили, добавили воду и полученный раствор подкислили до pH 1 при помощи 1M водного раствора HCl. Собрали осадок и получили искомое соединение (79,1 мг, выход 85%). Масс-спектроскопия (ESI/CI): расч. масса для C13H11ClN4O3S, 338,0; получено m/z: 339,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,88 (уш с, 1H), 13,01 (уш с, 1H), 8,94 (с, 1H), 8,40 (с, 1H), 8,03-7,55 (м, 2H), 3,23-3,11 (м, 1H), 2,89-2,78 (м, 1H), 1,08 (т, J=7,4 Гц, 3H).

Пример 96: 1-(5-хлор-6-этансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[1-(2-метоксиэтоксиметил)-6-этилсульфонил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[1-(2-метоксиэтоксиметил)-6-этилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (ПРИМЕР 95, продукт Стадии A) (0,501 г, 1,14 ммоль) и метанола (5,7 мл) добавили раствор реактива Oxone®/калия пероксимоносульфата (1,47 г, 2,40 ммоль) в воде (5,7 мл). Смесь перемешивали в течение 44 ч при 23°C. Добавили EtOAc (50 мл) и воду (30 мл) и двухфазную смесь перемешали. Слои разделили и водный слой подвергли экстрагированию с помощью EtOAc (50 мл). Объединенные органические слои промыли солевым раствором, высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (10-80% EtOAc/гексаны), получив искомое соединение (0,260 г, выход 48%, смесь региоизомеров 5:2) и этиловый эфир 1-[1-(2-метоксиэтоксиметил)-6-этилсульфинил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,232 г, выход 45%, смесь региоизомеров 2:1). Масс-спектроскопия (ESI/CI): расч. масса для C13H23ClN4O6S, 470,1; получено m/z: 471,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,91 (д, J=0,6 Гц, 1H), 8,53 (с, 1H), 8,20 (д, J=0,6 Гц, 1H), 7,82 (с, 1H), 6,21 (с, 2H), 4,37 (кв, J=7,1 Гц, 2H), 3,72-3,67 (м, 2H), 3,53-3,42 (м, 4H), 3,29 (с, 3H), 1,39 (т, J=7,1 Гц, 3H), 1,30 (т, J=7,4 Гц, 3H).

Стадия B: 1-(5-хлор-6-этансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 95, Стадии C-D, из этилового эфира 1-[1-(2-метоксиэтоксиметил)-6-этилсульфонил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Масс-спектроскопия (ESI/CI): расч. масса для C13H11ClN4O4S, 354,0; получено m/z: 355,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,02 (уш с, 1H), 8,95 (д, J=0,6 Гц, 1H), 8,36 (д, J=0,5 Гц, 1H), 8,18 (с, 1H), 7,90 (уш с, 1H), 3,53 (к, J=7,4 Гц, 2H), 1,14 (т, J=7,4 Гц, 3H).

Пример 97: 1-(6-метансульфонил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 95, за исключением использования 5-хлор-2-нитро-4-трифторметилфениламина вместо 4,5-дихлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C13H9F3N4O4S, 374,0; получено m/z: 375,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,41 (уш с, 1H), 13,08 (уш с, 1H), 8,99 (с, 1H), 8,60-7,85 (м, 3H), 3,33 (с, 3H).

Пример 98: 1-(5-фтор-6-метансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в Примере 95, за исключением использования 4,5-дифтор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H9FN4O4S, 324,0; получено m/z: 325,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,03 (уш с, 1H), 13,04 (уш с, 1H), 8,95 (д, J=0,4 Гц, 1H), 8,36 (с, 1H), 8,15-7,41 (м, 2H), 3,35 (с, 3H).

Пример 99: 1-(5-хлор-6-метансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в Примере 95, за исключением использования 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C12H9ClN4O4S, 340,0; получено m/z: 341,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,10 (уш с, 1H), 13,05 (уш с, 1H), 8,96 (с, 1H), 8,37 (с, 1H), 8,32-7,63 (м, 2H), 3,40 (с, 3H).

Пример 100: 1-(6-метансульфонил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в Примере 95, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C13H9F3N4O5S, 390,0; получено m/z: 391,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,19 (уш с, 1H), 13,07 (уш с, 1H), 8,95 (с, 1H), 8,38 (с, 1H), 8,11 (уш с, 1H), 7,81 (уш с, 1H), 3,33 (с, 3H).

Пример 101: 1-[5-хлор-6-(пропан-2-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-хлор-5-изопропилсульфанил-2-нитрофениламин. К раствору 4,5-дихлор-2-нитрофениламина (3 г, 14,5 ммоль) и DMF (73 мл) добавили тиоизопропоксид натрия (4,95 г, 45,6 ммоль). Раствор нагревали при 100°C в течение 4 дней, охладили и влили в солевой раствор (300 мл). Водный слой далее экстрагировали с помощью EtOAc (3×200 мл), а объединенные органические слои промыли водой (3×200 мл) и солевым раствором (1×200 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Неочищенный продукт использовали на следующей стадии реакции без дополнительной очистки. Масс-спектроскопия (ESI/CI): расч. масса для C9H11ClN2O2S, 246,0; получено m/z: 247,0 [M+H]+.

Стадия B: этиловый эфир 1-[5-хлор-1-(2-метоксиэтоксиметил)-6-(пропан-2-сульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии А-Е, за исключением использования 4-хлор-5-изопропилсульфанил-2-нитрофениламина вместо 3-хлор-2-нитрофениламина на Стадии A. Получили смесь региоизомеров в отношении 1:1. Масс-спектроскопия (ESI/CI): расч. масса для C20H25ClN4O4S, 452,1; получено m/z: 453,1 [M+H]+. 1H ЯМР (600 МГц, CDCl3): 8,87-8,86 (м, 2H), 8,18 (д, J=0,4 Гц, 2H), 7,81 (с, 1H), 7,77 (с, 1H), 7,72 (с, 1H), 7,70 (с, 1H), 6,14 (с, 2H), 6,11 (с, 2H), 4,36 (к, J=7,1 Гц, 4H), 3,69-3,62 (м, 4H), 3,55-3,43 (м, 6H), 3,31 (с, 3H), 3,30 (с, 3H), 1,38 (т, J=7,1 Гц, 6H), 1,35 (дд, J=6,7, 2,0 Гц, 12H).

Стадия C: этиловый эфир 1-[5-хлор-1-(2-метоксиэтоксиметил)-6-(пропан-2-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[5-хлор-1-(2-метоксиэтоксиметил)-6-(пропан-2-сульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,249 г, 0,550 ммоль) и дихлорметана (2,8 мл) добавили m-CPBA (0,259 г, 1,15 ммоль, 77% по массе). Реакционную смесь перемешивали в течение 2,5 дней при 23°C. Добавили этилацетат (20 мл) и раствор тиосульфата натрия (0,182 г, 1,15 ммоль) в насыщенном на 80% водном растворе карбоната натрия (10 мл), после чего слои интенсивно перемешивали в течение 10 мин, пока смесь не стала прозрачной. Слои разделили и водную фазу экстрагировали с помощью EtOAc (2×30 мл). Объединенные органические слои промыли солевым раствором (10 мл), высушили и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (10-60% EtOAc/гексаны) с получением искомого соединения (0,254 г, выход 95%) в виде смеси региоизомеров 10:9. Масс-спектроскопия (ESI/CI): расч. масса для C20H25ClN4O6S, 484,1; получено m/z: 485,1 [M+H]+. 1H ЯМР (600 МГц, CDCl3): 8,91 (д, J=0,5 Гц, 1H), 8,51 (с, 1H), 8,20 (д, J=0,5 Гц, 1H), 7,81 (с, 1H), 6,21 (с, 2H), 4,37 (кв, J=7,1 Гц, 2H), 3,90-3,83 (м, 1H), 3,72-3,68 (м, 2H), 3,49-3,45 (м, 2H), 3,29 (с, 3H), 1,39 (т, J=7,1 Гц, 3H), 1,35 (д, J=6,8 Гц, 6H).

Стадия D: этиловый эфир 1-[5-хлор-6-(пропан-2-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[5-хлор-1-(2-метоксиэтоксиметил)-6-(пропан-2-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,243 г, 0,501 ммоль) в этаноле (1,8 мл) добавили 4M раствор HCl в диоксане (1,8 мл). Реакционную смесь перемешивали при 23°C в течение 1,5 ч. Добавили диэтиловый эфир и собрали осадок, получив искомое соединение (0,183 г, выход 92%). Масс-спектроскопия (ESI/CI): расч. масса для C16H17ClN4O4S, 369,1; получено m/z: 397,1 [M+H]+. 1H ЯМР (400 МГц, DMSO): 9,03 (д, J=0,6 Гц, 1H), 8,42 (д, J=0,6 Гц, 1H), 8,16 (с, 1H), 7,90 (с, 1H), 4,31 (кв, J=7,1 Гц, 2H), 3,89-3,76 (м, 1H), 1,33 (т, J=7,1 Гц, 3H), 1,21 (д, J=6,8 Гц, 6H).

Стадия E: 1-[5-хлор-6-(пропан-2-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. К раствору, содержащему этиловый эфир 1-[5-хлор-6-(пропан-2-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,179 мг, 0,451 ммоль), THF (1,7 мл) и воду (0,55 мл), добавили LiOH·H2O (56,8 мг, 1,35 ммоль). Смесь подвергли краткой ультразвуковой обработке и перемешивали при 23°C в течение 56 ч. Растворитель выпарили, добавили воду и полученный раствор подкислили до pH 1 при помощи 1M водного раствора HCl. Собрали осадок, получив искомое соединение (0,146 г, выход 86%). Масс-спектроскопия (ESI/CI): расч. масса для C14H13ClN4O4S, 368,0; получено m/z: 369,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6, таутомерное уширение): 14,07 (с, 1H), 13,03 (с, 1H), 8,95 (д, J=0,4 Гц, 1H), 8,36 (с, 1H), 8,16 (с, 1H), 8,09-7,64 (м, 1H), 3,88-3,76 (м, 1H), 1,22 (д, J=7,9 Гц, 6H).

Пример 102: 1-[5-хлор-6-(пропан-1-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-хлор-2-нитро-5-пропилсульфанилфениламин. К смеси 4,5-дихлор-2-нитрофениламина (3,50 г, 16,9 ммоль), карбоната калия (4,67 г, 33,8 ммоль) и DMF (85 мл) добавили 1-пропантиол (2,30 мл, 25,4 ммоль). Полученную реакционную смесь выдержали при температуре 90°C в течение 1,5 ч и дали ей остыть до температуры 23°C. Затем смесь добавили к смеси солевого раствора со льдом (600 мл) и собрали выпавший осадок, получив искомое соединение (4,09 г, 98%). 1H ЯМР (600 МГц, CDCl3): 8,11 (с, 1H); 6,46 (с, 1H); 6,10 (уш с, 2H); 2,91 (т, J=7,3 Гц, 2H); 1,85-1,76 (м, 2H); 1,12 (т, J=7,4 Гц, 3H).

Стадия B: 1-[5-хлор-6-(пропан-1-сульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 101, Стадии B-E. Масс-спектроскопия (ESI/CI): расч. масса для C14H13ClN4O4S, 368,0; получено m/z: 369,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6, таутомерное уширение): 14,05 (с, 1H); 13,02 (с, 1H); 8,95 (с, 1H); 8,36 (с, 1H); 8,30-8,08 (м, 1H); 8,07-7,64 (м, 1H); 3,57-3,44 (м, 2H); 1,64-1,55 (м, 2H); 0,94 (т, J=7,4 Гц, 3H).

Пример 103: 1-[6-(пропан-2-сульфонил)-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 102, за исключением использования 5-хлор-2-нитро-4-трифторметилфениламина вместо 4,5-дихлор-2-нитрофениламина и 2-пропантиол вместо 1-пропантиола на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C15H13F3N4O4S: 402,1; получено m/z: 403,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,68-12,50 (м, 1H); 8,99 (с, 1H); 8,39 (с, 1H); 8,29 (с, 1H); 8,18 (с, 1H); 3,59-3,47 (м, 1H); 1,22 (д, J=6,8 Гц, 6H).

Пример 104: 1-[6-(пропан-1-сульфонил)-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 102, за исключением использования 5-хлор-2-нитро-4-трифторметилфениламина вместо 4,5-дихлор-2-нитрофениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C15H13F3N4O4S: 402,1; получено m/z: 403,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,37 (с, 1H); 13,08 (с, 1H); 8,99 (с, 1H); 8,51-7,88 (м, 3H); 3,40-3,32 (м, 2H); 1,75-1,57 (м, 2H); 0,95 (т, J=7,4 Гц, 3H).

Пример 105: 1-[6-(пропан-2-сульфонил)-5-трифторметокси-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 102, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 4,5-дихлор-2-нитрофениламина и 2-пропантиол вместо 1-пропантиола на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C15H13F3N4O5S: 418,1; получено m/z: 419,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,17 (с, 1H); 13,07 (с, 1H); 8,95 (с, 1H); 8,40-8,35 (м, 1H); 8,08 (с, 1H); 7,78 (с, 1H); 3,59-3,45 (м, 1H); 1,20 (д, J=6,8 Гц, 6H).

Пример 106: 1-[6-(пропан-1-сульфонил)-5-трифторметокси-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 102, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 4,5-дихлор-2-нитрофениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C15H13F3N4O5S: 418,1; получено m/z: 419,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,17 (с, 1H); 13,06 (с, 1H); 8,95 (с, 1H); 8,37 (с, 1H); 8,09 (с, 1H); 7,78 (с, 1H); 3,44-3,34 (м, 2H); 1,67-1,51 (м, 2H); 0,93 (т, J=7,4 Гц, 3H).

Пример 107: 1-(5-бензолсульфинил-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 82, из этилового эфира 1-[6-хлор-5-(4-хлорфенилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт из Примера 61). Масс-спектроскопия (ESI/CI): расч. масса для C17H10Cl2N4O3S: 420,0; получено m/z: 421,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,94 (уш с, 1H); 13,05 (уш с, 1H); 8,93 (с, 1H); 8,34 (с, 1H); 8,06 (уш с, 1H); 7,78 (уш с, 1H); 7,76 (д, J=8,6 Гц, 2H); 7,65-7,58 (м, 2H). Энантиомеры разделили на колонки для препаративной хроматографии в сверхкритической жидкости Kromasil® DMB 250×21,2 мм (длина×внутр. диам.) при температуре 40°C, используя 8,5 мл/мин MeOH с добавкой 0,2% диизопропиламина и 34 г/мин CO2, с УФ детектированием на длине волны 214 нм. Два энантиомера выделили в виде соответствующих диизопропиламиновых солей. Масс-спектроскопия (ESI/CI): расч. масса для C17H10Cl2N4O3S: 420,0; получено m/z: 421,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,56 (с, 1H); 7,85 (с, 1H); 7,71 (с, 1H); 7,70-7,66 (м, 2H); 7,60-7,56 (м, 2H); 7,39 (с, 1H); 1,11 (д, J=6,4 Гц, 12H).

Пример 108: 1-(6-метансульфинил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[1-(2-метоксиэтоксиметил)-6-метилсульфинил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[1-(2-метоксиэтоксиметил)-6-метилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт из ПРИМЕРА 71, продукт Стадии B) (0,300 г, 0,654 ммоль) и метанола (3,3 мл) добавили раствор реактива OXONE®/пероксимоносульфата калия (0,402 г, 0,654 ммоль) в воде (3,3 мл). Полученную смесь перемешивали при температуре 23°C в течение 4 ч. Затем добавили EtOAc (40 мл) и воду (20 мл) и двухфазную смесь перемешали. Слои разделили и водный слой подвергли экстрагированию с помощью EtOAc (30 мл). Объединенные органические слои промыли солевым раствором (15 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (20-100% EtOAc/гексаны) и получили искомое соединение (0,249 г, выход 80%) в виде смеси региоизомеров 10:9. Масс-спектроскопия (ESI/CI): расч. масса для C19H21F3N4O5S: 474,1; получено m/z: 475,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,94 (д, J=0,6 Гц, 1H); 8,58 (с, 1H); 8,22 (с, 1H); 8,08 (с, 1H); 6,34-6,23 (м, 2H); 4,38 (кв, J=7,1 Гц, 2H); 3,74-3,66 (м, 2H); 3,51-3,41 (м, 2H); 3,28 (с, 3H); 2,81 (с, 3H); 1,40 (т, J=7,1 Гц, 3H).

Стадия B: 1-(6-метансульфинил-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C13H9F3N4O3S, 358,0; получено m/z: 359,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,25 (уш с, 1H); 13,06 (уш с, 1H); 8,98 (с, 1H); 8,38 (д, J=0,5 Гц, 1H); 8,34 (уш с, 1H); 8,05 (уш с, 1H); 2,79 (с, 3H).

Образовавшиеся энантиомеры выделили в виде соответствующих изопропиламиновых солей, используя препаративную хиральную хроматографию в сверхкритической жидкости. Разделение проводили на колонке Chiralpak® AD-H при температуре 40°C при расходе метанола с добавкой 0,2% изопропиламина 8,6 мл/мин и расходе CO2 33 мл/мин и давлении в колонке 3700 кПа (37 бар). Абсолютное стереохимическое отнесение для указанных соединений не проводили. Масс-спектроскопия (ESI/CI): расч. масса для C13H9F3N4O3S, 358,0; получено m/z: 359,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,78 (с, 1H); 8,26-7,14 (уш с, 3H); 8,16 (с, 1H); 8,04 (с, 1H); 7,77 (с, 1H); 3,29 (м, 1H); 2,70 (с, 3H); 1,17 (д, J=6,5 Гц, 6H).

Пример 109: 1-(6-бром-5-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 5-бром-4-фтор-2-нитрофениламин. Смесь 1-бром-2,5-дифтор-4-нитробензола (1,50 г, 6,30 ммоль) и 7М раствора аммиака в метаноле (25 мл) выдержали в герметичной трубке при температуре 60°C в течение 15 ч. Затем реакционную смесь перенесли в круглодонную колбу, промыв трубку EtOAc. Смесь сконцентрировали и полученный сырой продукт использовали на следующей стадии без дальнейшей очистки.

Стадия B: 1-(6-бром-5-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии B-H, за исключением использования 5-бром-4-фтор-2-нитрофениламина вместо 4-хлор-2-нитро-5-m-толилсульфанилфениламина на Стадии B и диизопропиламида лития вместо бутиллития на Стадии E. Масс-спектроскопия (ESI/CI): расч. масса для C11H6BrFN4O2, 324,0; получено m/z: 325,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,92 (с, 1H); 8,88 (с, 1H); 8,29 (с, 1H); 7,84 (уш с, 1H); 7,57 (уш с, 1H).

Пример 110: 1-(4-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии B-H, за исключением использования 2-фтор-6-нитрофениламина вместо 4-хлор-2-нитро-5-m-толилсульфанилфениламина на Стадии B и диизопропиламида лития вместо бутиллития на Стадии E. Масс-спектроскопия (ESI/CI): расч. масса для C11H7FN4O2, 246,1; получено m/z: 247,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,91 (д, J=0,5 Гц, 1H); 8,28 (д, J=0,4 Гц, 1H); 7,35 (д, J=8,0 Гц, 1H); 7,22 (тд, J=8,1; 4,9 Гц, 1H); 7,06 (дд, J=11,0; 8,1 Гц, 1H).

Пример 111: 1-(4,5-дифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии D-H, за исключением использования 4,5-дифторбензоимидазола вместо 6-хлор-5-m-толилсульфанил-1H-бензоимидазола на Стадии B и диизопропиламида лития вместо бутиллития на Стадии E. Масс-спектроскопия (ESI/CI): расч. масса для C11H6F2N4O2: 264,1; получено m/z: 265,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,76 (уш с, 1H); 12,97 (уш с, 1H); 8,94 (с, 1H); 8,31 (д, J=0,6 Гц, 1H); 7,38-7,21 (м, 2H).

Пример 112: 1-(4,6-дифтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии C-H, за исключением использования 3,5-дифторбензол-1,2-диамина вместо 4-хлор-5-m-толилсульфанилбензол-1,2-диамина на Стадии C и диизопропиламида лития вместо бутиллития на Стадии E. Масс-спектроскопия (ESI/CI): расч. масса для C11H6F2N4O2: 264,1; получено m/z: 265,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,84 (уш с, 1H); 12,95 (уш с, 1H); 8,91 (с, 1H); 8,30 (с, 1H); 7,19-7,11 (м, 2H).

Пример 113: 1-(6-хлор-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Способ A:

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 3-хлор-2-нитрофеноламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C12H6ClF3N4O3: 346,0; получено m/z: 347,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,37 (с, 1H); 8,88 (с, 1H); 8,29 (с, 1H); 7,80 (с, 1H); 7,71 (с, 1H).

Способ B:

Стадия A: 6-хлор-5-трифторметокси-1H-бензоимидазол. Смесь 5-хлор-2-нитро-4-трифторметоксифениламина (2,00 г, 7,80 ммоль), дитионита натрия (7,06 г, 40,5 ммоль), триметилортоформиата (23,1 мл, 210 ммоль), DMF (23 мл) и уксусной кислоты (4,0 мл) выдержали в герметичной трубке при температуре 100°C в течение 15 ч. Реакционной смеси дали остыть до температуры 23°C и разделили ее между EtOAc (100 мл) и насыщенным водным раствором NaHCO3 (100 мл). Органический слой собрали, водный слой экстрагировали с помощью EtOAc (2×80 мл). Объединенные органические слои высушили, профильтровали и сконцентрировали при пониженном давлении. Осадок очистили (КФХ) (0-15% MeOH/DCM) с получением искомого соединения (1,46 г, 78%). Масс-спектроскопия (ESI/CI): расч. масса для C8H4ClF3N2O: 236,0; получено m/z: 237,0 [M+H]+. 1H ЯМР (500 МГц, CDCl3): 8,11 (с, 1H); 7,74 (с, 1H); 7,64 (с, 1H).

Стадия B: 1-(6-хлор-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии D-H. Масс-спектроскопия (ESI/CI): расч. масса для C12H6ClF3N4O2: 346,0; получено m/z: 347,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,90 (с, 1H); 8,32 (с, 1H); 7,83 (уш с, 1H); 7,74 (уш с, 1H).

Способ C:

Стадия A: 4-хлор-5-трифторметоксибензол-1,2-диамин. 5-хлор-2-нитро-4-трифторметоксифениламин (180 г, 0,7 моль, 1,0 экв.) растворили в сухом DMF (1 л) и затем добавили катализатор - 5% Pt/C с содержанием воды 50,2% (4,0 г). Гидрирование проводили при давлении водорода 344,7 кПа (50 psi) при комнатной температуре в течение 16 ч. ВЭЖХ анализ показал полное завершение реакции. Масс-спектроскопия [M+H]+: получено 225,2. Полученную реакционную смесь использовали на следующей стадии без выделения продуктов.

Стадия B: 5-хлор-6-трифторметокси-1,3-дигидробензоимидазол-2-он. Из полученной на Стадии А смеси отфильтровали Pt/C катализатор и промыли его сухим DMF (250 мл). Фильтрат сконцентрировали до 750 мл. В раствор добавили активированные молекулярные сита типа 3A (100 г) и перемешивали смесь при комнатной температуре в течение 3 ч. Затем молекулярные сита отфильтровали и промыли их сухим DMF (250 мл). К полученному осушенному раствору в DMF при комнатной температуре добавили твердый CDI (125 г, 0,77 моль, 1,1 экв.), при этом смесь несколько нагрелась. Смесь перемешали при комнатной температуре в течение 30 мин и затем добавили воду (1,8 л). Полученную суспензию перемешивали при комнатной температуре в течение ночи. Выпавшее в осадок твердое вещество белого цвета собрали фильтрацией, промыли водой и тщательно высушили, получив искомое соединение (154,6 г, 87%). Масс-спектроскопия [M+H]+: получено 253,1.

Стадия C: 2,6-дихлор-5-трифторметокси-1H-бензоимидазол. Тщательно высушенный 5-хлор-6-трифторметокси-1,3-дигидробензоимидазол-2-он (154,6 г, 0,61 моль, 1,0 экв.) суспендировали в POCl3 (450 мл, 8,0 экв.). Реакционный раствор нагревали при температуре флегмы в течение 6 ч и затем охлаждали до комнатной температуры. Раствор медленно, при постоянном перемешивании, заливали на смесь колотого льда и воды (~3 л). Полученный раствор нейтрализовали с помощью NaOH до pH=6,0. Выпавшее в осадок твердое вещество собрали фильтрацией, промыли водой и высушили, получив искомое соединение (159,97 г, 96%). Неочищенный продукт использовали в описанной ниже реакции без дальнейшей очистки.

Следующие три стадии проводили в режиме «one-pot», промежуточные продукты не выделяли.

Стадия D: 1-(6-хлор-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. 2,6-дихлор-5-трифторметокси-1H-бензоимидазол (160 г, 0,59 моль, 1,0 экв.) растворили в сухом DMF (1,5 л) и затем последовательно добавили K2CO3 (98 г, 0,71 моль, 1,2 экв.) и хлорид диметилсульфамоила (85 г, 0,59 моль, 1,0 экв.). Полученную реакционную смесь перемешивали при комнатной температуре в течение 16 ч, получив диметиламид 2,6-дихлор-5-трифторметоксибензоимидазол-1-сульфоновой кислоты. Без выделения диметиламида 2,6-дихлор-5-трифторметоксибензоимидазол-1-сульфоновой кислоты в реакционную смесь добавили этиловый эфир 1H-пиразол-4-карбоновой кислоты (91 г, 0,65 моль, 1,1 экв.) и K2CO3 (98 г, 0,71 моль, 1,2 экв.). Полученную реакционную смесь перемешивали при температуре 70°C в течение 10 ч и затем охладили до комнатной температуры, получив этиловый эфир 1-(6-хлор-1-диметилсульфамоил-5-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. Без выделения продуктов в реакционную смесь добавили LiOH H2O (124 г, 2,95 моль, 5,0 экв.) в 2,5 л воды. Полученную реакционную смесь выдержали при температуре 70°C в течение 6 ч и затем охладили до комнатной температуры. Добавили концентрированную HCl, доведя pH до 4,0. Выпавшее в осадок твердое вещество собрали фильтрацией, промыли водой и высушили. Полученное твердое вещество перекристаллизовали из горячего EtOAc (~3 л). После охлаждения до комнатной температуры и фильтрации получили чистое искомое соединение в виде твердого вещества белого цвета (109 г, 0,31 моль, 54% за 3 стадии). Масс-спектроскопия (ESI/CI): расч. масса для C12H6ClF3N4O2: 346,0; получено m/z: 347,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,79 (с, 1H); 13,06 (с, 1H); 8,91 (с, 1H); 8,33 (с, 1H); 7,79 (уш д, 2H).

Пример 114: 1-(1H-нафто[2,3-d]имидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии C-H, за исключением использования 4-хлор-5-m-толилсульфанилбензол-1,2-диамина вместо нафталин-2,3-диамина на Стадии С. Масс-спектроскопия (ESI/CI): расч. масса для C15H10N4O2: 278,1; получено m/z: 279,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,12-12,83 (м, 1H); 9,00 (д, J=0,6 Гц, 1H); 8,34 (д, J=0,6 Гц, 1H); 8,06 (с, 2H); 8,01 (дд, J=6,3; 3,3 Гц, 2H); 7,40 (дд, J=6,4; 3,2 Гц, 2H).

Пример 115: 1-(3H-нафто[1,2-d]имидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии C-H, за исключением использования 4-хлор-5-m-толилсульфанилбензол-1,2-диамина вместо нафталин-1,2-диамина на Стадии С. Масс-спектроскопия (ESI/CI): расч. масса для C15H10N4O2: 278,1; получено m/z: 279,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,92 (с, 1H); 8,95 (д, J=0,6 Гц, 1H); 8,51 (д, J=8,0 Гц, 1H); 8,32 (д, J=0,5 Гц, 1H); 8,02 (д, J=8,0 Гц, 1H); 7,75 (кв, J=8,8 Гц, 2H); 7,67-7,59 (м, 1H); 7,51 (ддд, J=8,2; 6,9; 1,2 Гц, 1H).

Пример 116: 1-(5-фтор-4-метил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[5-фтор-1-(2-метокси-этоксиметил)-4-метил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, Стадии B-F, за исключением использования 3-фтор-2-метил-6-нитрофениламина вместо 4-хлор-2-нитро-5-m-толилсульфанилфениламина на Стадии B и диизопропиламид лития вместо бутиллития на Стадии E. Масс-спектроскопия (ESI/CI): расч. масса для C18H21FN4O4: 376,2; получено m/z: 377,1 [M+H]+.

Стадия B: 1-(5-фтор-4-метил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Смесь этилового эфира 1-[5-фтор-1-(2-метокси-этоксиметил)-4-метил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,131 г, 0,481 ммоль), ледяной уксусной кислоты (4,8 мл) и 6М водного раствора HCl (4,8 мл) выдержали в герметичной трубке при температуре 100°C в течение 4 ч. Реационную смесь охладили до температуры 23°C и затем до 0°C. Полученный осадок отфильтровывали и отмывали холодной водой с получением искомого соединения (75,0 мг, 60%). Масс-спектроскопия (ESI/CI): расч. масса для C12H9FN4O2: 260,1; получено m/z: 261,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,88 (с, 1H); 8,29 (с, 1H); 7,35 (дд, J=8,7; 4,5 Гц, 1H); 7,06 (дд, J=10,4; 8,8 Гц, 1H); 2,46 (д, J=1,3 Гц, 3H).

Пример 117: 1-(5-пиперидин-1-ил-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 2-нитро-5-пиперидин-1-ил-4-трифторметоксифениламин. Пиперидин (1,2 мл) добавили к 5-хлор-2-нитро-4-трифторметоксифениламину (0,757 г, 2,94 ммоль) и полученную смесь выдержали в герметичной трубке при температуре 100°C в течение 2 ч. Затем смесь охладили до температуры 23°C, добавили воду (50 мл) и экстрагировали с помощью EtOAc (3×80 мл). Объединенные органические слои промыли солевым раствором (50 мл), высушили, отфильтровали и сконцентрировали при пониженном давлении, получив искомое соединение (0,900 г, 99,9%). Масс-спектроскопия (ESI/CI): расч. масса для C12H14F3N3O3: 305,1; получено m/z: 306,1 [M+H]+.

Стадия B: 5-пиперидин-1-ил-6-трифторметокси-1H-бензоимидазол. Смесь 2-нитро-5-пиперидин-1-ил-4-трифторметоксифениламина (0,900 г, 2,94 ммоль), дитионита натрия (2,67 г, 15,3 ммоль), триметилортоформиата (8,72 мл, 79,6 ммоль), DMF (8,56 мл) и уксусной кислоты (1,45 мл) выдержали в герметичной трубке при температуре 100°C в течение 15 ч. Реакционной смеси дали остыть до температуры 23°C и разделили ее между EtOAc (80 мл) и насыщенным водным раствором NaHCO3 (80 мл). Органический слой собрали, водный слой экстрагировали с помощью EtOAc (2×80 мл). Объединенные органические слои высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (0-15% MeOH/DCM) и получили искомое соединение (0,589 г, 71%). Масс-спектроскопия (ESI/CI): расч. масса для C13H14F3N3O: 285,1; получено m/z: 286,1 [M+H]+.

Стадия C: этиловый эфир 1-[1-(2-метоксиэтоксиметил)-5-пиперидин-1-ил-6-трифторметокси-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали в виде 1:1 смеси региоизомеров аналогично тому, как описано в ПРИМЕРЕ 60, Стадии D-F, за исключением использования диизопропиламида лития вместо бутиллития на Стадии Е. Масс-спектроскопия (ESI/CI): расч. масса для C23H28F3N5O5: 511,2; получено m/z: 512,2 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,82 (д, J=0,6 Гц, 1H); 8,80 (д, J=0,6 Гц, 1H); 8,17-8,15 (м, 2H); 7,56-7,55 (м, 1H); 7,48-7,46 (м, 1H); 7,36 (с, 1H); 7,19 (с, 1H); 6,08 (с, 2H); 6,07 (с, 2H); 4,39-4,32 (м, 4H); 3,67-3,61 (м, 4H); 3,48-3,42 (м, 4H); 3,31 (с, 3H); 3,30 (с, 3H); 3,05-2,95 (м, 8H); 1,79-1,70 (м, 8H); 1,63-1,55 (м, 4H); 1,41-1,34 (м, 6H).

Стадия D: 1-(5-пиперидин-1-ил-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Смесь этилового эфира 1-[1-(2-метоксиэтоксиметил)-5-пиперидин-1-ил-6-трифторметокси-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,300 г, 0,586 ммоль), ледяной уксусной кислоты (5,9 мл) и 6М водного раствора HCl (6,9 мл) выдержали в герметичной трубке при температуре 100°C в течение 4,5 ч. Реационную смесь охладили до температуры 23°C и затем до 0°C. Выпавшее в осадок твердое вещество отфильтровали и промыли холодной водой, получив искомое соединение (60,0 мг, 26%). Масс-спектроскопия (ESI/CI): расч. масса для C17H16F3N5O3: 395,1; получено m/z: 396,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,84 (д, J=0,6 Гц, 1H); 8,27 (д, J=0,6 Гц, 1H); 7,47 (уш с, 1H); 7,21 (уш с, 1H); 2,98-2,89 (м, 4H); 1,71-1,59 (м, 4H); 1,58-1,47 (м, 2H).

Пример 118: 1-(5-фтор-6-пиперидин-1-ил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 117, за исключением использования 2-нитро-4,5-дифторанилина вместо 2-нитро-4-трифторметокси-5-хлоранилина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C16H16FN5O2: 329,1; получено m/z: 330,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,88 (с, 1H); 8,28 (с, 1H); 7,99 (уш с, 1H); 7,56 (д, J=12,2 Гц, 1H); 3,39 (уш с, 4H); 1,93 (уш с, 4H); 1,64 (уш м, 2H).

Пример 119: 1-(6-этокси-5-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 117, за исключением использования 2-нитро-4,5-дифторанилина вместо 2-нитро-4-трифторметокси-5-хлоранилина и этоксида натрия (21 вес.% раствор в этаноле) вместо пиперидина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C13H11FN4O3: 290,1; получено m/z: 291,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,63-12,41 (м, 2H); 8,82 (с, 1H); 8,25 (с, J=0,5 Гц, 1H); 7,61-6,97 (м, 2H); 4,13 (к, J=7,0 Гц, 2H); 1,38 (т, J=6,9 Гц, 3H).

Пример 120: 1-(5-фенилкарбамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: метиловый эфир 2-оксо-2,3-дигидро-1H-бензоимидазол-5-карбоновой кислоты. К раствору метилового эфира 3,4-диаминобензойной кислоты (5,00 г, 30,1 ммоль) и THF (40 мл) при температуре 0°C добавили карбонилдиимидазол (7,32 г, 45,1 ммоль). Полученную смесь перемешивали в течение 16 ч и затем дали ей прогреться до температуры 23°C. При температуре 0°C добавили 1M водный раствор HCl (50 мл) и затем воду (70 мл), полученную смесь перемешивали в течение 1 ч. Выпавшее в осадок твердое вещество отфильтровали и высушили при пониженном давлении в течение 18 ч, получив искомое соединение, которое использовали на следующей стадии без дальнейшей очистки (5,45 г, 94%). Масс-спектроскопия (ESI/CI): расч. масса для C9H8N2O3: 192,1; получено m/z: 193,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 11,01 (с, 1H); 10,84 (с, 1H); 7,63 (дд, J=8,2; 1,6 Гц, 1H); 7,47 (с, 1H); 7,02 (д, J=8,2 Гц, 1H); 3,82 (с, 3H).

Стадия B: метиловый эфир 2-хлор-1H-бензоимидазол-5-карбоновой кислоты. Метиловый эфир 2-оксо-2,3-дигидро-1H-бензоимидазол-5-карбоновой кислоты (3,00 г, 15,6 ммоль) смешали с оксихлоридом фосфора (30 мл) и полученную смесь выдержали при температуре 100°C в течение 48 ч. Смесь охладили до температуры 23°C и сконцентрировали при пониженном давлении. Осадок охладили до 0°C и осторожно добавили холодный насыщенный водный раствор NaHCO3 (60 мл). После перемешивания при 23°C в течение 15 мин смесь подвергли ультразвуковой обработке и образовавшийся осадок отфильтровали с получением искомого соединения (3,13 г, 95%), которое использовали на следующей стадии без дальнейшей очистки. Масс-спектроскопия (ESI/CI): расч. масса для C9H7ClN2O2: 210,02; получено m/z: 211,0 [M+H]+.

Стадия C: метиловый эфир 2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-карбоновой кислоты. К смеси метилового эфира 2-хлор-1H-бензоимидазол-5-карбоновой кислоты (2,00 г, 9,50 ммоль) и THF (17 мл) при температуре 23°C добавили DIPEA (2,46 мл, 14,3 ммоль), а затем 1-хлорметокси-2-метоксиэтан (1,30 мл, 11,4 ммоль). После перемешивания в течение 18 ч реакционную смесь сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (5-50% EtOAc/гексаны) и получили искомое соединение в виде смеси региоизомеров (1,71 г, 60%). Масс-спектроскопия (ESI/CI): расч. масса для C13H15ClN2O4: 298,1; получено m/z: 299,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,34-8,31 (м, 1H); 8,21-8,20 (м, 1H); 7,98 (дд, J=8,6; 1,6 Гц, 1H); 7,91 (дд, J=8,5; 1,6 Гц, 1H); 7,83 (дд, J=8,6; 0,5 Гц, 1H); 7,74 (дд, J=8,5; 0,5 Гц, 1H); 5,78 (с, 1H); 5,73 (с, 1H); 3,89 (д, J=6,3 Гц, 6H); 3,64-3,60 (м, 5H); 3,43-3,39 (м, 5H); 3,17 (д, J=2,6 Гц, 6H).

Стадия D: 2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-карбоновая кислота. К смеси метилового эфира 2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-карбоновой кислоты (0,600 г, 0,200 ммоль), THF (10 мл) и воды (3,33 мл) добавили LiOH·H2O (47,0 мг, 1,96 ммоль). Смесь перемешивали в течение 18 ч при 23°C. Растворитель выпаривали, добавляли воду (5 мл) и смесь подкисляли с помощью 1M HCl. Выпавшее в осадок твердое вещество белого цвета отфильтровали и высушили, получив искомое соединение (0,490 г, 86%). Масс-спектроскопия (ESI/CI): расч. масса для C12H13ClN2O4: 284,1; получено m/z: 285,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,93 (с, 2H); 8,30 (с, 1H); 8,18 (д, J=1,4 Гц, 1H); 7,96 (дд, J=8,6; 1,5 Гц, 1H); 7,90 (дд, J=8,5; 1,6 Гц, 1H); 7,80 (д, J=8,6 Гц, 1H); 7,71 (д, J=8,5 Гц, 1H); 5,74 (д, J=17,5 Гц, 4H); 3,64-3,60 (м, 4H); 3,43-3,39 (м, 4H); 3,18 (д, J=0,6 Гц, 6H).

Стадия E: фениламид 2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-карбоновой кислоты. К раствору 2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-карбоновой кислоты (0,235 г, 0,825 ммоль) в ацетонитриле (4 мл) добавили HATU (0,408 г, 1,07 ммоль). Полученную суспензию перемешали при температуре 23°C в течение 5 мин, обработали DIPEA (0,428 мл, 2,48 ммоль) и перемешали в течение дополнительных 20 мин. Затем реакционную смесь обработали анилином (90,0 мкл, 0,990 ммоль) и перемешали в течение еще 2 ч. После этого реакционную смесь разбавили водой (10 мл) и экстрагировали с помощью EtOAc (3×20 мл). Объединенные органические слои промыли солевым раствором, высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (5-70% EtOAc/гексаны) и получили искомое соединение (0,265 г, 89%) в виде смеси региоизомеров. Масс-спектроскопия (ESI/CI): расч. масса для C18H18ClN3O3: 359,1; получено m/z: 360,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 10,26 (д, J=7,5 Гц, 2H); 8,32 (дд, J=3,6; 1,5 Гц, 2H); 7,99 (дд, J=8,6; 1,6 Гц,1H); 7,94 (дд, J=8,5; 1,6 Гц, 1H); 7,87-7,73 (м, 6H); 7,41-7,32 (м, 4H); 7,16-7,02 (м, 2H); 5,75 (д, J=8,6 Гц, 4H); 3,67-3,61 (м, 4H); 3,43 (ддд, J=6,3; 4,7; 3,1 Гц, 4H); 3,19 (д, J=1,5 Гц, 6H).

Стадия F: 1-(5-фенилкарбамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии E-G. Масс-спектроскопия (ESI/CI): расч. масса для C18H13N5O3: 347,1; получено m/z: 348,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,73 (с, 1H); 12,93 (с, 1H); 10,25 (с, 1H); 8,94 (с, 1H); 8,32 (с, 1H); 8,24 (с, 1H); 7,90 (д, J=8,4 Гц, 1H); 7,81 (д, J=8,1 Гц, 1H); 7,68 (с, 1H); 7,36 (т, J=7,9 Гц, 2H); 7,10 (т, J=7,2 Гц, 1H).

Пример 121: 1-(5-бензилкарбамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 120, за исключением использования бензиламина вместо анилина на Стадии Е. Масс-спектроскопия (ESI/CI): расч. масса для C19H15N5O3: 361,1; получено m/z: 362,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,63 (с, 1H); 12,93 (с, 1H); 9,08 (с, 1H); 8,92 (с, 1H); 8,31 (с, 1H); 8,22 (с, 0,5H); 8,05 (с, 0,5H); 7,85 (с, 1H); 7,70 (с, 0,5H); 7,55 (с, 0,5H); 7,44-7,27 (м, 4H); 7,25 (с, 1H); 4,51 (д, J=5,9 Гц, 2H).

Пример 122: 1-[5-(морфолин-4-илкарбамоил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 120, за исключением использования морфолин-4-иламина вместо анилина на Стадии Е. Масс-спектроскопия (ESI/CI): расч. масса для C16H16N6O4: 356,1; получено m/z: 357,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 12,95 (с, 1H); 9,56 (с, 1H); 8,92 (с, 1H); 8,31 (с, 1H); 8,02 (с, 1H); 7,71 (д, J=8,4 Гц, 1H); 7,59 (д, J=8,0 Гц, 1H); 3,68 (с, 6H); 2,93 (с, 5H).

Пример 123: 1-(5-бензилоксиметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: [2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-ил]-метанол. К смеси метилового эфира 2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-карбоновой кислоты (Промежуточный продукт из ПРИМЕРА 120, продукт Стадии C) (0,500 г, 1,67 ммоль) и THF (30 мл) при температуре 0°C при перемешивании по каплям в течение 10 мин добавили алюмогидрид лития (2M раствор в THF, 0,836 мл). Полученную смесь перемешивали в течение 48 ч, дав ей прогреться до температуры 23°C. Затем реакционную смесь охладили до температуры 0°C, добавили воду (20 мл) и подкислили смесь с помощью 1M HCl. Полученный продукт экстрагировали с помощью EtOAc (3×40 мл), объединенные органические слои промыли солевым раствором, высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (5-80% EtOAc/гексаны) и получили искомое соединение (0,356 г, 78%) в виде смеси региоизомеров 1:1. Масс-спектроскопия (ESI/CI): расч. масса для C12H15ClN2O3: 270,1; получено m/z: 271,1 [M+H]+. 1H (600 МГц, CDCl3): 7,65-7,61 (м, 2H); 7,52 (д, J=0,7 Гц, 1H); 7,45 (д, J=8,3 Гц, 1H); 7,35 (дд, J=8,3; 1,5 Гц, 1H); 7,27 (дд, J=8,2; 1,5 Гц, 1H); 5,63 (с, 2H); 5,62 (с, 2H); 4,81 (с, 2H); 4,77 (с, 2H); 3,64-3,60 (м, 4H); 3,49 (дд, J=5,4; 3,6 Гц, 4H); 3,35 (с, 3H); 3,34 (с, 3H); 2,59 (с, 1H); 2,50 (с, 1H).

Стадия B: 5-бензилоксиметил-2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол. К раствору [2-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-5-ил]-метанола (100 мг, 0,370 ммоль) и DMF (3 мл) при температуре 0°C добавили NaH (30,0 мг, 0,740 ммоль, 60% суспензия в минеральном масле). Полученную смесь перемешивали при температуре 0°C в течение 1 ч и затем обработали бензилбромидом (52,0 мкл, 0,440 ммоль). Полученную смесь перемешивали в течение 16 ч. Затем добавили воду (5 мл) и экстрагировали продукт с помощью EtOAc (3×20 мл). Объединенные органические слои промыли солевым раствором, высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (5-50% EtOAc/гексаны) и получили искомое соединение (100 мг, 75%). Масс-спектроскопия (ESI/CI): расч. масса для C19H21ClN2O3: 360,1; получено m/z: 361,1 [M+H]+

Стадия C: получение 1-(5-бензилоксиметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии E-G. Масс-спектроскопия (ESI/CI): расч. масса для C19H16N4O3: 348,1; получено m/z: 349,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,31 (с, 1H); 12,93 (с, 1H); 8,88 (с, 1H); 8,27 (с, 1H); 7,62 (с, 1H); 7,48 (с, 1H); 7,39-7,35 (м, 4H); 7,32-7,21 (м, 2H); 4,64 (с, 2H); 4,55 (с, 2H).

Пример 124: 1-(4-бром-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 1-бензоил-3-(2,6-дибром-4-фторфенил)-тиомочевина. Смесь 2,6-дибром-4-фторфениламина (1,00 г, 3,72 ммоль), изотиоцианата бензоила (0,600 мл, 4,46 ммоль), диметилпиридин-4-иламина (45,0 г, 0,370 ммоль) и толуола (5 мл) перемешивали при температуре 23°C в течение 16 ч. Выпавшее в осадок твердое вещество собрали фильтрацией и промыли гексаном, получив искомое соединение (1,37 г, 85%). Масс-спектроскопия (ESI/CI): расч. масса для C14H9Br2FN2OS: 429,9; получено m/z: 430,9 [M+H]+. 1H ЯМР (400 МГц, CD3OD-d 4): 8,05-7,98 (м, 2H); 7,73-7,66 (м, 1H); 7,62-7,55 (м, 4H).

Стадия B: (2,6-дибром-4-фторфенил)-тиомочевина. К раствору 1-бензоил-3-(2,6-дибром-4-фторфенил)-тиомочевины (1,37 г, 3,17 ммоль) в MeOH (12 мл) при температуре 0°C по каплям добавили раствор метоксида натрия (5,4M в MeOH, 1,29 мл, 6,96 ммоль). Полученную смесь прогрели до температуры 23°C и перемешивали в течение 16 ч. MeOH сконцентрировали при пониженном давлении. Остаток растворили в воде, полученный раствор охладили до температуры 0°C и подкислили до pH 4 с помощью 1M HCl. Выпавшее в осадок твердое вещество собрали фильтрацией и промыли гексанами, получив искомое соединение (1,04 г, 99%). Масс-спектроскопия (ESI/CI): расч. масса для C7H5Br2FN2S: 325,9; получено m/z: 326,9 [M+H]+. 1H ЯМР (400 МГц, CD3OD-d 4): 8,05-8,01 (м, 2H).

Стадия C: 2,6-дибром-4-фторфенилцианамид. Раствор (2,6-дибром-4-фторфенил)-тиомочевины (0,300 г, 0,920 ммоль) в 1M водном растворе KOH (7,23 мл) нагрели до температуры 100°C и добавили раствор тригидрата ацетата свинца (II) (0,400 г, 1,05 ммоль) в воде (2 мл). Полученную смесь выдержали при температуре 100°C в течение еще 10 мин, наблюдая за образованием осадка. Затем смесь охладили до температуры 0°C и профильтровали, получив прозрачный бесцветный раствор. Фильтрат уксусной кислотой подкислили до pH 5. Выпавшее в осадок твердое вещество собрали фильтрацией, получив искомое соединение (0,170 г, 63%). 1H ЯМР (400 МГц, DMSO-d 6): 7,80-7,78 (м, 2H).

Стадия D: этиловый эфир 1-[N-(2,6-дибром-4-фторфенил)-карбамимидоил]-1H-пиразол-4-карбоновой кислоты. Смесь 2,6-дибром-4-фторфенилцианамида (0,167 г, 0,570 ммоль), этилпиразол-4-карбоксилата (80,0 мг, 0,570 ммоль), 4M раствора HCl в диоксане (0,156 мл, 0,630 ммоль) и 1,4-диоксана (2 мл) нагревали при температуре флегмы в течение 2 ч, за которые произошло образование осадка. Затем смеси дали остыть до температуры 23°C. К смеси добавили Et2O (10 мл). Выпавшее в осадок твердое вещество собрали фильтрацией, промыли Et2O и высушили, получив искомое соединение (0,134 г, 50%) в виде гидрохлоридной соли. Масс-спектроскопия (ESI/CI): расч. масса для C13H11Br2FN4O2: 431,9; получено m/z: 432,9 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,20 (с, 1H); 7,43 (с, 1H); 6,82 (д, J=7,9 Гц, 2H); 3,56 (к, J=7,1 Гц, 2H); 2,85 (с, 3H); 0,57 (т, J=7,1 Гц, 3H).

Стадия E: этиловый эфир 1-(4-бром-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. Смесь этилового эфира 1-[N-(2,6-дибром-4-фторфенил)-карбамимидоил]-1H-пиразол-4-карбоновой кислоты (0,134 г, 0,290 ммоль), CuI (6,00 мг, 0,0290 ммоль), Cs2CO3 (0,464 г, 1,43 ммоль) и DMF (2 мл) выдержали при температуре 80°C в течение 1 ч. Затем смесь охладили до температуры 23°C, разбавили EtOAc (3 мл) и профильтровали через Celite®, который промыли EtOAc. Полученный фильтрат промыли 1M водным раствором HCl, затем водой, высушили (MgSO4), отфильтровали и сконцентрировали при пониженном давлении. Затем добавили дихлорметан и выпавшее в осадок твердое вещество собрали фильтрацией, получив искомое соединение (17,0 мг, 17%). Масс-спектроскопия (ESI/CI): расч. масса для C13H10BrFN4O2: 353,2; получено m/z: 354,2 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,86 (с, 1H); 8,95 (с, 1H); 8,36 (с, 1H); 7,45 (дд, J=9,6; 2,3 Гц, 1H); 7,32 (с, 1H); 4,30 (к, J=7,1 Гц, 2H); 1,33 (т, J=7,1 Гц, 3H).

Стадия F: 1-(4-бром-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Смесь этилового эфира 1-(4-бром-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (16,0 мг, 45,0 ммоль), LiOH (10,0 мг, 0,230 ммоль), THF (0,5 мл) и H2O (0,17 мл) перемешивали при температуре 23°C в течение 16 ч. Затем THF отогнали при пониженном давлении и добавили водный раствор HCl. Выпавшее в осадок твердое вещество собрали фильтрацией и промыли водой, получив искомое соединение (10,0 мг, 67%). Масс-спектроскопия (ESI/CI): расч. масса для C11H6BrFN4O2: 325,1; получено m/z: 326,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,82 (с, 1H); 12,94 (с, 1H); 8,87 (с, 1H); 8,30 (д, J=0,5 Гц, 1H); 7,45 (дд, J=9,6; 2,3 Гц, 1H); 7,32 (с, 1H).

Пример 125: 1-(8H-имидазо[4',5':3,4]бензо[2,1-d]тиазол-7-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 124, Стадии A-E, за исключением использования 4-бромбензотиазол-5-иламина вместо 2,6-дибром-4-фторфениламина на Стадии А. На Стадии E были сделаны следующие изменения:

Стадия E: этиловый эфир 1-(8H-имидазо[4',5':3,4]бензо[2,1-d]тиазол-7-ил)-1H-пиразол-4-карбоновой кислоты. Смесь гидрохлоридной соли этилового эфира 1-[N-(4-бромбензотиазол-5-ил)-карбамимидоил]-1H-пиразол-4-карбоновой кислоты (0,128 г, 0,297 ммоль), 1,10-фенантролина (10,7 мг, 59,4 мкмоль), карбоната цезия (0,290 г, 0,891 ммоль) и DME (5,5 мл) поместили в герметизируемую пробирку для СВЧ нагрева. Приготовленную смесь пробарботировали сухим азотом и добавили йодид меди (I) (5,70 мг, 29,7 мкмоль). Полученную смесь еще раз пробарботировали азотом, пробирку герметично закрыли и выдержали при температуре 80°C в течение 1,75 ч. Затем реакционную смесь разделили между 1M водным раствором HCl (15 мл) и EtOAc (25 мл). Водный слой далее экстрагировали с помощью EtOAc (2×20 мл), а объединенные органические слои промыли солевым раствором (10 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (10-60% EtOAc/гексаны, сухая загрузка), очищенные фракции сконцентрировали и полученный остаток растерли с диэтиловым эфиром, получив искомое соединение (19,5 мг, выход 21%). Масс-спектроскопия (ESI/CI): расч. масса для C14H11N5O2S: 313,1; получено m/z: 314,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,75 (с, 1H); 9,45 (с, 1H); 9,05 (с, 1H); 8,37 (с, 1H); 8,00 (д, J=8,6 Гц, 1H); 7,65 (д, J=6,0 Гц, 1H); 4,31 (к, J=7,0 Гц, 2H); 1,34 (т, J=7,1 Гц, 3H).

Стадия F: 1-(8H-имидазо[4',5':3,4]бензо[2,1-d]тиазол-7-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 124, Стадия F. Масс-спектроскопия (ESI/CI): расч. масса для C12H7N5O2S: 285,0; получено m/z: 286,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,94 (уш с, 1H); 9,46 (с, 1H); 8,98 (д, J=0,47 Гц, 1H); 8,31 (с, 1H); 8,00 (д, J=8,6 Гц, 1H); 7,69 (д, J=8,5 Гц, 1H).

Пример 126: 1-(5,6-бис-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 124, за исключением использования 2-бром-4,5-бис-трифторметилфениламина вместо 2,6-дибром-4-фторфениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C13H6F6N4O2: 364,0; получено m/z: 365,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 14,29 (с, 1H); 13,06 (с, 1H); 8,97 (д, J=0,4 Гц, 1H); 8,37 (с, 1H); 8,15 (с, 2H).

Пример 127: 1-(4,5,6-трихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 2,3,4-трихлор-6-нитрофениламин. Смесь 4,5-дихлор-2-нитрофениламина (0,500 г, 2,42 ммоль), N-хлорсукцинимида (0,403 г, 3,02 ммоль) и DMF (5 мл) выдержали при температуре 100°C в течение 1 ч. После остывания до температуры 23°C полученный раствор вылили в ледяную воду. Выпавшее в осадок твердое вещество желтого цвета собрали фильтрацией и растворили в дихлорметане. Органическую фазу промыли водой, высушили (MgSO4), отфильтровали и сконцентрировали, получив искомое соединение (0,468 г, 81%). 1H ЯМР (400 МГц, CDCl3): 8,28 (с, 1H); 6,70 (с, 2H). Для данного соединения не были получены масс-спектрометрические данные.

Стадия B: 4,5,6-трихлор-1H-бензоимидазол. Смесь 2,3,4-трихлор-6-нитрофениламина (0,250 г, 1,04 ммоль), дитионита натрия (0,907 г, 5,21 ммоль), триметилортоформиата (4 мл), DMF (4 мл) и уксусной кислоты (0,5 мл) выдержали в герметизированной пробирке при температуре 100°C в течение 15 ч. Реакционной смеси дали остыть до температуры 23°C и разделили ее между EtOAc и насыщенным водным раствором NaHCO3. Органический слой собрали, водный слой экстрагировали с помощью EtOAc. Объединенные органические слои высушили (MgSO4), профильтровали и сконцентрировали, получив искомое соединение (0,098 г, 43%). Масс-спектроскопия (ESI/CI): расч. масса для C7H3Cl3N2: 219,9; получено m/z: 221,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,16 (с, 1H); 8,43 (с, 1H); 7,90 (с, 1H).

Стадия C: 4,5,6-трихлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол. К смеси 4,5,6-трихлор-1H-бензоимидазола (0,098 г, 0,446 ммоль) и THF (2,5 мл) при температуре 23°C добавили DIPEA (0,155 мл, 0,892 ммоль) и затем 1-хлорметокси-2-метоксиэтан (0,057 мл, 0,49 ммоль). Полученную смесь перемешивали в течение 18 ч и затем добавили EtOAc. Органический слой промыли насыщенным водным раствором NaHCO3. Водный слой далее экстрагировали с помощью EtOAc. Органический слой высушили над MgSO4, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) и получили искомое соединение в виде смеси региоизомеров (0,084 г, 61%). Масс-спектроскопия (ESI/CI): расч. масса для C11H11Cl3N2O2: 308,0; получено m/z: 309,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,59 (с, 1H); 8,58 (с, 1H); 8,09 (с, 1H); 8,04 (д, J=8,5 Гц, 1H); 5,84 (с, 2H); 5,71 (с, 2H); 3,59-3,57 (м, 2H); 3,56-3,53 (м, 2H); 3,42-3,38 (м, 4H); 3,18 (с, 3H); 3,17 (с, 3H).

Стадия D: 2,4,5,6-тетрахлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол. Раствор 4,5,6-трихлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазола (0,388 г, 1,26 ммоль) и THF (6 мл) охладили до температуры -78°C на бане из ацетона и сухого льда. По каплям добавили диизопропиламид лития (1,0 M раствор в THF, 2,52 мл, 2,52 ммоль) и полученную смесь перемешивали при температуре -78°C в течение 1 ч. Затем добавили раствор N-хлорсукцинимида (0,336 г, 2,52 ммоль) в THF (2 мл). Полученной реакционной смеси дали прогреться до температуры 23°C и перемешивали ее в течение 2 ч. Затем в смесь добавили насыщенный водный раствор NH4Cl и экстрагировали сырой продукт с помощью EtOAc. Объединенные органические слои высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) и получили искомое соединение в виде смеси региоизомеров (0,267 г, 62%). Масс-спектроскопия (ESI/CI): расч. масса для C11H10Cl4N2O2: 342,0; получено m/z: 343,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,18 (с, 1H); 8,03 (с, 1H); 5,88 (д, J=5,8 Гц, 2H); 5,71 (с, 2H); 3,71-3,66 (м, 2H); 3,64-3,61 (м, 2H); 3,44-3,38 (м, 4H); 3,17 (т, J=1,7 Гц, 6H).

Стадия E: этиловый эфир 1-[4,5,6-трихлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь 2,4,5,6-тетрахлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазола (0,275 г, 0,80 ммоль), Cs2CO3 (0,524 г, 1,61 ммоль), этилового эфира 1H-пиразол-4-карбоновой кислоты (0,124 г, 0,89 ммоль) и DMF (4 мл) выдержали при температуре 80°C в течение 2 ч. Полученную смесь охладили до температуры 23°C, добавили EtOAc и промыли смесь солевым раствором. Органический слой высушили (MgSO4), профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) и получили искомое соединение в виде смеси региоизомеров (0,166 г, 46%). Масс-спектроскопия (ESI/CI): расч. масса для C17H17Cl3N4O4: 446,0; получено m/z: 447,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 9,01-8,97 (м, 2H); 8,40 (т, J=2,3 Гц, 1H); 8,37 (с, 1H); 8,21 (с, 1H); 8,13 (с, 1H); 6,09 (с, 2H); 6,01 (с, 2H); 4,30 (кв.д, J=7,1; 2,9 Гц, 8H); 3,58-3,51 (м, 2H); 3,44 (д, J=4,9 Гц, 2H); 3,11 (с, 3H); 3,08 (с, 3H); 1,32 (тт, J=7,1; 1,7 Гц, 6H).

Стадия F: 1-(4,5,6-трихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. К раствору этилового эфира 1-[4,5,6-трихлор-1-(2-метокси-этоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,166 г, 0,372 ммоль) в уксусной кислоте (6 мл) при перемешивании добавили 6М водный раствор соляной кислоты (6 мл). Реакционная смесь нагревалась при температуре 100°C в течение 18 ч, а затем охлаждалась до 23°C. Выпавшее в осадок твердое вещество собрали, получив искомое соединение в виде его гидрохлоридной соли (0,91 г, выход 74%). Масс-спектроскопия (ESI/CI): расч. масса для C11H5Cl3N4O2: 330,0; получено m/z: 331,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,92 (с, 1H); 8,34 (с, 1H); 7,74 (с, 1H).

Пример 128: 1-(4-бром-5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[4-бром-5,6-дихлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 127, Стадии A-E, за исключением использования N-бромсукцинимида вместо N-хлорсукцинимида на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C17H17BrCl2N4O4: 490,0; получено m/z: 491,0 [M+H]+.

Стадия B: этиловый эфир 1-(4-бром-5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К смеси этилового эфира 1-[4-бром-5,6-дихлор-1-(2-метокси-этоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,132 г, 0,27 ммоль) и EtOH (2 мл) добавили 4 M раствор HCl в диоксане (2 мл). Смесь перемешивали в течение 18 ч при 23°C. Выпавшее в осадок твердое вещество белого цвета собрали фильтрацией и промыли EtOH, получив искомое соединение (0,088 г, 81%). Масс-спектроскопия (ESI/CI): расч. масса для C13H9BrCl2N4O4: 402,9; получено m/z: 403,9 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 14,22-13,94 (м, 1H); 8,98 (с, 1H); 8,40 (с, 1H); 7,74 (с, 1H); 4,30 (к, J=7,1 Гц, 2H); 1,33 (т, J=7,1 Гц, 3H).

Стадия C: 1-(4-бром-5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. К смеси этилового эфира 1-(4-бром-5,6-дихлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (0,088 г, 0,22 ммоль), THF (1 мл) и воды (0,33 мл) добавили LiOH·H2O (0,046 г, 1,09 ммоль) и полученную смесь перемешивали при температуре 23°C в течение 18 ч. Растворитель выпаривали, добавляли воду (3 мл) и смесь подкисляли с помощью 1M HCl. Выпавшее в осадок твердое вещество белого цвета отфильтровали и высушили при пониженном давлении, получив искомое соединение (0,068 г, 83%). Масс-спектроскопия (ESI/CI): расч. масса для C11H5BrCl2N4O2: 374,9; получено m/z: 375,9 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,89 (с, 1H); 8,32 (с, 1H); 7,74 (с, 1H).

Пример 129: 1-(6-фтор-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: N-(3-фтор-4-трифторметилфенил)-ацетамид. К смеси 3-фтор-4-трифторметилфениламина (16,9 г, 92,6 ммоль), N,N-диметил-4-аминопиридина (1,13 г, 9,26 ммоль) и толуола (230 мл) добавили уксусный ангидрид (13,1 мл, 0,139 моль). Полученную смесь нагревали при температуре флегмы в течение 3 ч и затем перемешивали при температуре 23°C в течение 16 ч. Затем реакционную смесь сконцентрировали и растворили полученный сырой продукт в EtOAc (100 мл). Органический слой промыли водой (40 мл) и затем солевым расвором (40 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Полученный в виде твердого вещества сырой продукт растерли из смеси DCM/гексаны, получив искомое соединение (16,5 г, выход 81%). Масс-спектроскопия (ESI/CI): расч. масса для C9H7F4NO: 221,1; получено m/z: 222,0 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 7,68 (д, J=12,5 Гц, 1H); 7,52 (т, J=8,3 Гц, 1H); 7,45 (уш с, 1H); 7,19 (д, J=8,5 Гц, 1H); 2,22 (с, 3H).

Стадия B: N-(5-фтор-2-нитро-4-трифторметилфенил)-ацетамид. К раствору N-(3-фтор-4-трифторметилфенил)-ацетамида (0,663 г, 3,00 ммоль) в серной кислоте (3 мл) при температуре 0°C при интенсивном перемешивании по каплям добавили раствор нитрата калия (0,607 г, 6,00 ммоль) в концентрированной серной кислоте (3 мл). Полученную смесь перемешивали при температуре 0°C в течение 1 ч и затем при перемешивании медленно пипетировали в смесь воды со льдом. Выпавшее в осадок твердое вещество собрали и высушили in vacuo, получив искомое соединение (0,648 г, выход 81%) в виде единственного региоизомера. Для данного соединения не были получены масс-спектрометрические данные. 1H ЯМР (600 МГц, CDCl3): 10,67 (уш с, 1H); 8,86 (д, J=12,9 Гц, 1H); 8,57 (д, J=7,2 Гц, 1H); 2,35 (с, 3H).

Стадия C: 5-фтор-2-нитро-4-трифторметилфениламин. Суспензию N-(5-фтор-2-нитро-4-трифторметилфенил)-ацетамида (17,8 г, 67,0 ммоль) в водном растворе HCl (3М, 400 мл) нагревали при температуре флегмы в течение 3 ч. Полученную суспензию охладили до температуры 0°C и NaHCO3 довели до pH 8. Выпавшее в осадок твердое вещество собрали, получив искомое соединение (13,7 г, выход 91%). Для данного соединения не были получены масс-спектрометрические данные. 1H ЯМР (400 МГц, CDCl3): 8,48 (д, J=7,3 Гц, 1H); 6,75-6,18 (м, 3H).

Стадия D: 1-(6-фтор-5-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, Стадии B-C. Масс-спектроскопия (ESI/CI): расч. масса для C12H6F4N4O2: 314,0; получено m/z: 315,1 [M+H]+. 1H ЯМР (400 МГц, CD3OD, таутомерное уширение): 8,93 (с, 1H); 8,20 (с, 1H); 7,87 (уш с, 1H); 7,49 (уш с, 1H).

Пример 130: 1-(6-хлор-5-этиламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-5-этиламино-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь кашицы из 4 Å молекулярных сит (1,2 г) и этилового эфира 1-[5-амино-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 41, продукт Стадии A) (0,300 г, 0,762 ммоль) и этанола (3 мл) поместили в герметизируемую пробирку для СВЧ нагрева и при температуре 0°C добавили в нее ацетальдегид (0,500 мл, 8,91 ммоль). Пробирку герметично закрыли и дали реакционной смеси прогреться до температуры 23°C в течение 16 ч. Полученную смесь выдержали при температуре 60°C в течение 1 ч. Из полученного раствора фильтрованием удалили молекулярные сита и сконцентрировали фильтрат при пониженном давлении. К остатку добавили триацетоксиборгидрид натрия (0,242 г, 1,14 ммоль), THF (3 мл) и ледяную уксусную кислоту (0,04 мл) и перемешивали полученную суспензию при температуре 23°C в течение 7,5 ч. Затем реакционную смесь сконцентрировали и разделили остаток между насыщенным водным раствором бикарбоната натрия и EtOAc (35 мл). Водный слой экстрагировали далее с помощью EtOAc (2×35 мл), а объединенные органические слои промыли солевым раствором (15 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (10-45% EtOAc/гексаны) и получили искомое соединение (0,169 г, выход неочищенного продукта 47%). Полученное соединение использовали в последующих реакциях без дальнейшей очистки. Масс-спектроскопия (ESI/CI): расч. масса для C19H24ClN5O4: 421,2; получено m/z: 422,1 [M+H]+.

Стадия B: 1-(6-хлор-5-этиламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C13H12ClN5O2: 305,1; получено m/z: 306,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 8,84 (с, 1H); 8,27 (с, 1H); 7,60 (с, 1H); 7,03 (уш с, 1H); 3,22 (кв, J=6,9 Гц, 2H); 1,25 (т, J=7,1 Гц, 3H).

Пример 131: 1-(6-хлор-5-пропиламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-5-этиламино-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[5-амино-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт из Примера 41, продукт Стадии A) (0,300 г, 0,762 ммоль) и пропиональдегида (61,0 мкл, 0,838 ммоль) в THF (3 мл) добавили триацетоксиборгидрид натрия (0,226 г, 1,07 ммоль) и затем уксусную кислоту (40,9 мкл, 0,762 ммоль). Полученную смесь перемешивали при температуре 23°C в течение 22 ч. Затем добавили молекулярные сита (4 Å, 1,2 г) и выдержали реакционную смесь при температуре 40-50°C в течение 24 ч. В течение следующих 48 ч в смесь добавили еще по две порции пропиональдегида и триацетоксиборгидрида натрия. Затем реакционную смесь погасили насыщенным водным раствором бикарбоната натрия (10 мл). Водный слой экстрагировали с помощью EtOAc (3×35 мл), объединенные органические слои промыли солевым раствором (25 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (10-45% EtOAc/гексаны) и получили искомое соединение (0,178 г, выход 54%) в виде смеси региоизомеров 1:1. 1H ЯМР (400 МГц, CDCl3): 8,83 (с, 1H); 8,76 (с, 1H); 8,15 (с, 2H); 7,63 (с, 1H); 7,55 (с, 1H); 6,94 (с, 1H); 6,76 (с, 1H); 6,03 (с, 4H); 4,42 (уш с, 1H); 4,35 (кв, J=7,1 Гц, 4H); 4,27 (уш с, 1H); 3,65-3,59 (м, 4H); 3,49-3,41 (м, 4H); 3,33 (с, 3H); 3,32 (с, 3H); 3,23-3,12 (м, 4H); 1,82-1,69 (м, 4H); 1,37 (т, J=7,1 Гц, 6H); 1,11-1,01 (м, 6H).

Стадия B: 1-(6-хлор-5-этиламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C14H14ClN5O2: 319,1; получено m/z: 320,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 12,91 (уш с, 1H); 8,80 (с, 1H); 8,24 (с, 1H); 7,51 (уш с, 1H); 6,71 (уш с, 1H); 3,10 (т, J=7,1 Гц, 2H); 1,69-1,59 (м, 2H); 0,96 (т, J=7,4 Гц, 3H).

Пример 132: 1-(5-бензиламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[5-(бензилиденамино)-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. Смесь бензальдегида (93,0 мг, 0,876 ммоль), этилового эфира 1-[5-амино-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 41, продукт Стадии A) (0,300 г, 0,762 ммоль), THF (3 мл) и 4 Å молекулярных сит (0,910 г) перемешивали при температуре 23°C в течение 18 ч. Затем в смесь добавили триацетоксиборгидрид натрия (0,242 г, 1,14 ммоль) и продолжили перемешивание в течение еще 4 дней. Полученную реакционную смесь погасили насыщенным водным раствором бикарбоната натрия (15 мл) и размешали с дихлорметаном (25 мл). Полученную смесь профильтровали и разделили слои. Водный слой экстрагировали дихлорметаном (2×25 мл), а объединенные органические слои промыли солевым раствором (20 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (10-45% EtOAc/гексаны) и получили искомое соединение (0,288 г, выход 78%) в виде смеси региоизомеров 4:3. Полученное соединение не было достаточно стабильным для получения масс-спектрометрических данных. 1H ЯМР (400 МГц, CDCl3): 8,87 (с, 1H); 8,48 (с, 1H); 8,19 (с, 1H); 8,03-7,94 (м, 2H); 7,73 (с, 1H); 7,58-7,48 (м, 3H); 7,39 (с, 1H); 6,12 (с, 2H); 4,36 (кв, J=7,1 Гц, 2H); 3,7-3,6 (м, 2H); 3,5-3,4 (м, 2H); 3,32 (с, 3H); 1,39 (т, J=7,1 Гц, 3H).

Стадия B: этиловый эфир 1-[5-бензиламино-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К кашице из этилового эфира 1-[5-(бензилиденамино)-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,177 г, 0,366 ммоль) в этаноле (7 мл) при температуре 0°C добавили боргидрид натрия (41,6 мг, 1,10 ммоль). Полученную желтую кашицу прогрели до температуры 23°C в течение 24 ч. Реакционную смесь сконцентрировали и добавили к остатку насыщенный водный раствор бикарбоната натрия (25 мл). Реакционную смесь экстрагировали с помощью EtOAc (3×25 мл), а объединенные органические слои промыли солевым раствором (20 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (10-45% EtOAc/гексаны) и получили искомое соединение в виде смеси региоизомеров 6:5 (0,144 г, выход 81%). Масс-спектроскопия (ESI/CI): расч. масса для C24H26ClN5O4: 483,2; получено m/z: 484,2 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,79 (с, 1H); 8,14 (с, 1H); 7,58 (с, 1H); 7,43-7,27 (м, 5H); 6,92 (с, 1H); 6,03 (с, 2H); 4,75 (т, J=6,0 Гц, 1H); 4,49-4,43 (м, 2H); 4,34 (кв, J=7,2 Гц, 2H); 3,65-3,61 (м, 2H); 3,47-3,44 (м, 2H); 3,32 (с, 1H); 1,36 (т, J=7,1 Гц, 3H).

Стадия C: 1-(5-бензиламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C18H14ClN5O2: 367,1; получено m/z: 368,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 12,87 (уш с, 1H); 8,76 (д, J=0,5 Гц, 1H); 8,20 (с, 1H); 7,52 (уш с, 1H); 7,40-7,31 (м, 4H); 7,25-7,20 (м, 1H); 6,56 (уш с, 1H); 6,00 (уш с, 1H); 4,44 (с, 2H).

Пример 133: 1-(6-хлор-5-фениламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-фениламино-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. В высушенную в печи колбу поместили этиловый эфир 1-[5-амино-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 41, продукт Стадии A) (0,100 г, 0,254 ммоль), бромбензол (43,8 мг, 0,279 ммоль), Pd(dba)2 (1,50 мг, 2,50 мкмоль), Q-Phos (3,60 мг, 5,10 мкмоль) и трет-бутоксид натрия (36,6 мг, 0,381 ммоль). Колбу пробарботировали N2. В смесь добавили сухой толуол (0,5 мл) и полученную кашицу подвергли краткой ультразвуковой обработке. Полученную смесь выдержали при температуре 50°C в течение 18 ч. Затем реакционную смесь разбавили дихлорметаном и профильтровали через слой Celite®. Оставшийся на фильтре осадок промыли EtOAc и сконцентрировали фильтрат при пониженном давлении. Остаток очистили (КФХ) (10-45% EtOAc/гексаны) и получили искомое соединение (7,1 мг, выход 6%), которое использовали на следующей стадии без дальнейшей очистки. Масс-спектроскопия (ESI/CI): расч. масса для C23H24ClN5O4: 469,2; получено m/z: 470,1 [M+H]+.

Стадия B: 1-(6-хлор-5-фениламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C17H12ClN5O2: 353,1; получено m/z: 354,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 12,94 (уш с, 1H); 8,86 (с, 1H); 8,28 (с, 1H); 7,74-7,69 (м, 2H); 7,40 (с, 1H); 7,24-7,18 (м, 2H); 6,95 (д, J=7,8 Гц, 2H); 6,81 (т, J=7,3 Гц, 1H).

Пример 134: 1-[6-хлор-5-(2-морфолин-4-илэтиламино)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(2-морфолин-4-илэтиламино)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К кашице из 4 Å молекулярных сит (0,9 г), этилового эфира 1-[5-амино-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 41, продукт Стадии A) (0,187 г, 0,475 ммоль), 1-гидрокси-2-морфолин-4-илэтансульфоната натрия (0,122 г, 0,523 ммоль) и THF (2,5 мл) добавили триэтиламин (0,300 мл, 2,15 ммоль). Полученную кашицу перемешивали при температуре 23°C в течение 24 ч и затем добавили триацетоксиборгидрид натрия (0,282 г, 1,33 ммоль). Полученную реакционную смесь перемешивали в течение еще 24 ч. Затем добавили еще одну порцию 1-гидрокси-2-морфолин-4-илэтансульфоната натрия (62,0 мг, 0,270 ммоль) и выдержали реакционную смесь при температуре 23°C в течение еще 24 ч. Полученную смесь разбавили EtOAc, профильтровали и промыли насыщенным водным раствором NaHCO3. Водный слой экстрагировали далее с помощью EtOAc (2×30 мл). Объединенные органические слои промыли солевым раствором, высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (EtOAc/гексаны) и получили искомое соединение (30 мг, выход сырого продукта 12%). Полученное соединение использовали в последующих реакциях без дальнейшей очистки. Масс-спектроскопия (ESI/CI): расч. масса для C23H31ClN6O5: 506,2; получено m/z: 507,2 [M+H]+.

Стадия B: 1-[6-хлор-5-(2-морфолин-4-илэтиламино)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C17H19ClN6O3: 390,1; получено m/z: 391,1 [M+H]+. 1H ЯМР (600 МГц, CD3OD-d 4, таутомерное уширение): 8,77 (с, 1H); 8,12 (с, 1H); 7,50 (уш с, 1H); 6,86 (уш с, 1H); 3,79-3,74 (м, 4H); 3,38 (т, J=6,3 Гц, 2H); 2,89-2,82 (уш м, 2H); 2,69 (уш с, 4H).

Пример 135: 1-(6-хлор-5-циклопропансульфониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-5-циклопропансульфониламино-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[5-амино-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт из Примера 41, продукт Стадии A) (0,100 г, 0,254 ммоль) в пиридине (1,5 мл) при температуре 0°C при перемешивании по каплям добавили хлорид циклопропансульфонила (71,0 мг, 0,510 ммоль). Полученную смесь медленно подогрели до температуры 23°C и поддерживали при этой температуре в течение 42 ч. Затем реационную смесь погасили насыщенным водным раствором бикарбоната натрия (10 мл) и экстрагировали с помощью EtOAc (3×15 мл). Объединенные органические слои промыли солевым раствором (10 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (10-55% EtOAc/гексаны) и получили искомое соединение (96,0 мг, 76%) в виде смеси региоизомеров 5:4. Масс-спектроскопия (ESI/CI): расч. масса для C20H24ClN5O6S: 497,1; получено m/z: 498,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,83 (с, 1H); 8,19 (с, 1H); 8,03 (с, 1H); 7,71 (с, 1H); 6,73 (с, 1H); 6,14 (с, 2H); 4,31-4,28 (м, 2H); 3,71-3,64 (м, 2H); 3,51-3,45 (м, 2H); 3,32 (с, 3H); 2,54-2,44 (м, 1H); 1,43-1,35 (м, 3H); 1,21-1,11 (м, 2H); 1,00-0,92 (м, 2H).

Стадия B: получение 1-(6-хлор-5-циклопропансульфониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 71, Стадия C. Масс-спектроскопия (ESI/CI): расч. масса для C14H12ClN5O4S: 381,0; получено m/z: 382,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,55 (уш с, 1H); 12,97 (уш с, 1H); 9,46 (уш с, 1H); 8,89 (с, 1H); 8,31 (с, 1H); 7,94-7,45 (м, 2H); 2,69-2,59 (м, 1H); 0,98-0,79 (м, 4H).

Пример 136: 1-(6-хлор-5-метансульфониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 135, за исключением использования хлорид метансульфонила вместо хлорида циклопропансульфонила на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C12H10ClN5O4: 355,0; получено m/z: 356,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 9,48 (с, 1H); 8,90 (с, 1H); 8,31 (с, 1H); 7,72 (с, 1H); 7,61 (с, 1H); 3,01 (с, 3H).

Пример 137: 1-(6-хлор-5-этансульфониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 135, за исключением использования хлорид этансульфонила вместо хлорида циклопропансульфонила на Стадии А. В спектре 1H ЯМР наблюдалась 5:4 смесь таутомеров. Масс-спектроскопия (ESI/CI): расч. масса для C13H12ClN5O4S: 369,0; получено m/z: 370,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,60-13,48 (м, 1H); 12,97 (уш с, 1H); 9,46 (с, 1H); 8,89 (с, 1H); 8,31 (с, 1H); 7,85-7,52 (м, 2H); 3,18-3,04 (м, 2H); 1,35-1,20 (м, 3H).

Пример 138: 1-(5-бензолсульфониламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 135, за исключением использования хлорид бензолсульфонила вместо хлорида циклопропансульфонила на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C17H12ClN5O4S: 417,0; получено m/z: 418,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,58-13,46 (м, 1H); 12,97 (уш с, 1H); 10,02-9,90 (м, 1H); 8,93-8,81 (м, 1H); 8,29 (с, 1H); 7,70-7,42 (м, 6H); 7,34 (с, 1H).

Пример 139: 1-(5-ацетиламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[5-ацетиламино-6-хлор-1-(2-метокси-этоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К суспензии этилового эфира 1-[5-амино-6-хлор-1-(2-метокси-этоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (Промежуточный продукт из Примера 41, продукт Стадии A) (0,300 г, 0,762 ммоль) в THF (4 мл) при температуре 0°C при перемешивании добавили диизопропилэтиламин (0,330 мл, 1,90 ммоль). Затем в полученную смесь добавили ацетилхлорид (57,0 мкл, 0,800 ммоль). Через 3 ч реакционную смесь погасили водой (10 мл) и экстрагировали с помощью EtOAc (3×35 мл). Объединенные органические слои промыли солевым раствором (15 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (5-65% EtOAc/гексаны) и получили искомое соединение (0,270 г, 81%) в виде смеси региоизомеров 2:1. Масс-спектроскопия (ESI/CI): расч. масса для C19H22ClN5O5: 435,1; получено m/z: 436,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,83 (с, 1H); 8,71 (с, 1H); 8,18 (с, 1H); 7,79 (уш с, 1H); 7,74 (с, 1H); 6,10 (с, 1H); 4,36 (кв, J=7,1 Гц, 2H); 3,66-3,62 (м, 2H); 3,48-3,43 (м, 2H); 3,29 (с, 3H); 2,29 (с, 3H); 1,38 (т, J=7,1 Гц, 3H).

Стадия B: 1-(5-ацетиламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C13H10ClN5O3: 319,1; получено m/z: 320,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 9,54 (с, 1H); 8,89 (с, 1H); 8,94 (с, 1H); 8,30 (с, 1H); 7,82 (с, 1H); 7,69 (с, 1H); 2,11 (с, 3H).

Пример 140: 1-(6-хлор-5-пропиониламино-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 139, за исключением использования пропионилхлорида вместо ацетилхлорида на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C14H12ClN5O3: 333,1; получено m/z: 334,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,48 (уш с, 1H); 12,96 (уш с, 1H); 9,41 (с, 1H); 8,88 (с, 1H); 8,30 (с, 1H); 7,93-7,43 (м, 2H); 2,46-2,35 (м, 2H); 1,11 (т, J=7,6 Гц, 3H).

Пример 141: 1-(5-бензоиламино-6-хлор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 139, за исключением использования бензоилхлорида вместо ацетилхлорида на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C18H12ClN5O3: 381,1; получено m/z: 382,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 12,96 (уш с, 1H); 10,10 (с, 1H); 8,93 (с, 1H); 8,32 (с, 1H); 8,06-8,00 (м, 2H); 7,78-7,72 (м, 2H); 7,65-7,51 (м, 3H).

Пример 142: 1-[6-хлор-5-(2-морфолин-4-илацетиламино)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[5-(2-бромацетиламино)-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору диизопропилэтиламина (0,86 мл, 4,95 ммоль) и этилового эфира 1-[5-амино-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 41, продукт Стадии A) (0,650 г, 1,65 ммоль) и THF (8 мл) при температуре 0°C добавили бромид бромацетила (0,244 мл, 2,81 ммоль). Полученной смеси дали медленно подогреться до температуры 23°C, добавили вторую аликвоту бромида бромацетила (0,244 мл, 2,81 ммоль) и выдержали реакционную смесь при температуре 23°C еще 25 мин. Затем в смесь добавили воду (20 мл) и экстрагировали водный слой с помощью EtOAc (2×75 мл). Объединенные органические слои промыли солевым раствором (25 мл), высушили, профильтровали и сконцентрировали при пониженном давлении. Остаток очистили (КФХ) (10-45% EtOAc/гексаны) и после растирания с EtOAc получили искомое соединение (0,361 г, выход 42%). В спектре 1H ЯМР наблюдалась смесь региоизомеров 3:2. Масс-спектроскопия (ESI/CI): расч. масса для C19H21BrClN5O5: 513,0; получено m/z: 514,0 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,89 (с, 1H); 8,87 (уш с, 1H); 8,71 (с, 1H); 8,18 (с, 1H); 7,70 (с, 1H); 6,13 (с, 2H); 4,36 (кв, J=7,2 Гц, 2 H); 4,13 (с, 2H); 3,68-3,62 (м, 2H); 3,49-3,43 (м, 2H); 3,31 (с, 3H); 1,38 (т, J=7,1 Гц, 3H).

Стадия B: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(2-морфолин-4-илацетиламино)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К суспензии этилового эфира 1-[5-(2-бромацетиламино)-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (0,100 г, 0,194 ммоль) в дихлорметане (1 мл) добавили морфолин (51,0 мкл, 0,580 ммоль). Полученную смесь перемешивали при температуре 23°C в течение 50 мин, разделили между EtOAc (15 мл) и водой (10 мл) и далее экстрагировали водный слой с помощью EtOAc (2×15 мл). Объединенные органические слои промыли солевым раствором (15 мл), высушили, профильтровали и сконцентрировали при пониженном давлении, получив искомое соединение (97 мг, выход 96%) в виде смеси региоизомеров 3:1. Масс-спектроскопия (ESI/CI): расч. масса для C23H29ClN6O6: 520,2; получено m/z: 521,2 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 10,00 (с, 1H); 8,89 (с, 1H); 8,85(с, 1H); 8,18 (с, 1H); 7,68 (с, 1H); 6,12 (с, 2H); 4,36 (к, J=7,1 Гц, 2H); 3,87-3,80 (м, 4H); 3,67-3,60 (м, 2H); 3,48-3,42 (м, 2H); 3,32 (с, 2H); 3,24 (с, 3H); 2,73-2,67 (м, 4H); 1,38 (т, J=7,1 Гц, 3H).

Стадия C: 1-[6-хлор-5-(2-морфолин-4-илацетиламино)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27, Стадии F-G. Масс-спектроскопия (ESI/CI): расч. масса для C17H17ClN6O4: 404,1; получено m/z: 405,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,46 (уш с, 1H); 12,95 (уш с, 1H); 10,04-9,86 (м, 1H); 8,88 (с, 1H); 8,46 (с, 1H); 8,29 (с, 1H); 7,96-7,43 (м, 1H); 3,73-3,65 (м, 4H); 3,21 (с, 2H); 2,64-2,56 (м, 4H).

Пример 143: 1-[6-хлор-5-(2-пиперидин-1-илацетиламино)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 142, за исключением использования пиперидина вместо морфолина на Стадии В, и выделили в виде его гидрохлоридной соли. Масс-спектроскопия (ESI/CI): расч. масса для C18H19ClN6O3: 402,1; получено m/z: 403,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,68 (уш с, 1H); 13,00 (уш с, 1H); 10,47 (с, 1H); 10,02 (уш с, 1H); 8,91 (с, 1H); 8,32 (с, 1H); 7,89-7,62 (м, 2H); 4,32-4,13 (м, 2H); 3,60-3,45 (м, 2H); 3,21-3,02 (м, 2H); 1,90-1,61 (м, 5H); 1,50-1,33 (м, 1H).

Пример 144: 1-{6-хлор-5-[2-(4-метилпиперазин-1-ил)-ацетиламино]-1H-бензоимидазол-2-ил}-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 142, за исключением использования N-метилпиперазина вместо морфолина на Стадии В. Искомое соединение выделили в виде его гидрохлоридной соли. Масс-спектроскопия (ESI/CI): расч. масса для C18H20ClN7O3: 417,1; получено m/z: 418,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,53 (уш с, 1H); 12,98 (уш с, 1H); 10,67 (уш с, 1H); 9,77 (с, 1H); 8,89 (с, 1H); 8,33-8,23 (м, 2H); 7,77 (уш с, 1H); 3,50-3,35 (м, 4H); 3,18-3,03 (м, 4H); 2,85-2,70 (м, 5H).

Пример 145: 1-[6-хлор-5-(4-метоксифенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования 4-метоксифенола вместо 3,4-дихлорфенола и 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C18H13ClN4O4: 384,1; получено m/z: 385,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,23 (с, 2H); 8,86 (д, J=0,5 Гц, 1H); 8,28 (д, J=0,5 Гц, 1H); 7,75 (с, 1H); 7,13 (с, 1H); 6,95 (с, 4H); 3,75 (с, 3H).

Пример 146: 1-[6-хлор-5-(4-хлор-2-фторфенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение готовили аналогично ПРИМЕРУ 50, за исключением использования 4-хлор-2-фторфенола вместо 3,4-дихлор-2-фенола и 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии A. Масс-спектроскопия (ESI/CI): расч. масса для C17H9Cl2FN4O3: 406,0; получено m/z: 407,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,33 (с, 1H); 8,87 (с, 1H); 8,29 (с, 1H); 7,79 (с, 1H); 7,65 (дд, J=10,9; 2,5 Гц, 1H); 7,36 (с, 1H); 7,23 (дд, J=8,8; 1,6 Гц, 1H); 6,91 (т, J=8,9 Гц, 1H).

Пример 147: 1-[6-хлор-5-(4-трифторметоксифенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования 4-трифторметоксифенола вместо 3,4-дихлорфенола и 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C18H10ClF3N4O4, 438,0; получено m/z: 439,0 [M+H]+. 1H ЯМР (смесь таутомеров, 500 МГц, DMSO-d 6): 13,64 (с, 0,5H); 13,58 (с, 0,5H); 12,97 (с, 1H); 8,89 (с, 1H); 8,31 (с, 1H); 7,92 (с, 0,5H); 7,67 (с, 0,5H); 7,59 (с, 0,5H); 7,37 (д, J=7,6, 2H); 7,28 (с, 0,5H); 7,03 (с, 2H).

Пример 148: 1-[6-хлор-5-(3-хлор-4-фторфенокси)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 50, за исключением использования 3-хлор-4-фторфенола вместо 3,4-дихлорфенола и 4,5-дихлор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C17H9Cl2FN4O3: 406,0; получено m/z: 407,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,88 (с, 1H); 8,31 (д, J=0,4 Гц, 1H); 7,79 (с, 1H); 7,41 (т, J=9,0 Гц, 2H); 7,19 (д, J=2,8 Гц, 1H); 6,94 (д, J=9,0 Гц, 1H).

Пример 149: 1-(5-этилсульфанил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-хлор-5-этилсульфанил-2-нитрофениламин. К раствору 5-хлор-2-нитро-4-трифторметилфениламина (2,23 г, 9,25 ммоль) и DMF (46 мл) добавили тиоэтоксид натрия (2,16 г, 23,1 ммоль). Полученную реакционную смесь выдержали при температуре 100°C в течение 18 ч, охладили и вылили в смесь солевого раствора со льдом (350 мл). Выпавшее в осадок твердое вещество собрали, получив искомое соединение (2,10 г, выход 85%). Для данного соединения не были получены масс-спектрометрические данные. 1H ЯМР (400 МГц, CDCl3): 8,41 (с, 1H); 6,59 (с, 1H); 6,38 (с, 3H); 3,02 (к, J=7,4 Гц, 2H); 1,43 (т, J=7,4 Гц, 3H).

Стадия B: 1-(5-этилсульфанил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27. Масс-спектроскопия (ESI/CI): расч. масса для C14H11F3N4O2S: 356,1; получено m/z: 357,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,02 (с, 1H); 8,92 (д, J=0,6 Гц, 1H); 8,34 (д, J=0,6 Гц, 1H); 7,91 (с, 1H); 7,79 (с, 1H); 3,06 (к, J=7,3 Гц, 2H); 1,23 (т, J=7,3 Гц, 3H).

Пример 150: 1-(5-этилсульфанил-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 149, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C14H11F3N4O3S: 372,1; получено m/z: 373,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,60 (с, 1H); 12,99 (с, 1H); 8,88 (д, J=0,6 Гц, 1H); 8,32 (д, J=0,6 Гц, 1H); 7,83-7,36 (м, 2H); 3,02 (к, J=7,3 Гц, 2H); 1,25 (т, J=7,3 Гц, 3H).

Пример 151: 1-(5-этилсульфанил-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 149, за исключением использования 4,5-дифтор-2-нитрофениламина вместо 5-хлор-2-нитро-4-трифторметилфениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C13H11FN4O2S: 306,1; получено m/z: 307,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,46 (с, 1H); 12,97 (с, 1H); 8,87 (д, J=0,6 Гц, 1H); 8,30 (д, J=0,6 Гц, 1H); 7,58 (с, 1H); 7,44 (с, 1H); 2,95 (кв, J=7,3 Гц, 2H); 1,21 (т, J=7,3 Гц, 3H).

Пример 152: 1-(6-фтор-5-пропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: 4-фтор-2-нитро-5-пропилсульфанилфениламин. К смеси 4,5-дифтор-2-нитрофениламина (1,51 г, 8,67 ммоль), карбоната калия (2,40 г, 17,3 ммоль) и DMF (43 мл) добавили 1-пропантиол (0,865 мл, 9,54 ммоль). Полученную реакционную смесь выдержали при температуре 90°C в течение 1,5 ч и затем дали ей остыть до температуры 23°C. Смесь вылили в смесь солевого раствора со льдом (400 мл) и собрали выпавший осадок, получив искомое соединение (1,97 г, выход 98%). Масс-спектроскопия (ESI/CI): расч. масса для C9H11FN2O2S: 230,1; получено m/z: 231,1 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 7,78 (д, J=10,3 Гц, 1H); 6,52 (д, J=6,3 Гц, 1H); 6,04 (с, 2H); 2,93 (т, J=7,3 Гц, 2H); 1,84-1,70 (м, 2H); 1,09 (т, J=7,4 Гц, 3H).

Стадия B: 1-(6-фтор-5-пропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 27. Масс-спектроскопия (ESI/CI): расч. масса для C14H13F3N4O2S: 320,1; получено m/z: 321,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,99-12,55 (м, 2H); 8,87 (д, J=0,6 Гц, 1H); 8,30 (д, J=0,6 Гц, 1H); 7,87-7,18 (м, 2H); 2,91 (т, J=7,1 Гц, 2H); 1,66-1,48 (м, 2H); 0,98 (т, J=7,3 Гц, 3H).

Пример 153: 1-(6-фтор-5-изопропилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 152, за исключением использования 2-пропантиола вместо 1-пропантиола на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C14H13FN4O2S: 320,1; получено m/z: 321,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,88-13,19 (м, 1H); 12,97 (с, 1H); 8,88 (д, J=0,6 Гц, 1H); 8,30 (д, J=0,6 Гц, 1H); 7,87-7,22 (м, 2H); 3,46-3,33 (м, 1H); 1,21 (д, J=6,4 Гц, 6H).

Пример 154: 1-(5-этилсульфонил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 101, за исключением использования 5-хлор-2-нитро-4-трифторметилфениламина вместо 4,5-дихлор-2-нитрофениламина и тиоэтоксида натрия вместо тиоизопропоксида натрия на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C14H11F3N4O4S: 388,0; получено m/z: 389,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,38 (с, 1H); 13,08 (с, 1H); 8,99 (с, 1H); 8,39 (д, J=0,6 Гц, 1H); 8,38-7,94 (м, 2H); 3,39 (кв, J=7,4 Гц, 2H); 1,18 (т, J=7,4 Гц, 3H).

Пример 155: 1-(5-этилсульфонил-6-трифторметокси-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 101, за исключением использования 5-хлор-2-нитро-4-трифторметоксифениламина вместо 4,5-дихлор-2-нитрофениламина и тиоэтоксида натрия вместо тиоизопропоксида натрия на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C14H11F3N4O5S: 404,0; получено m/z: 405,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 14,19 (с, 1H); 13,07 (с, 1H); 8,95 (с, 1H); 8,38 (с, 1H); 8,09 (с, 1H); 7,80 (с, 1H); 3,40 (кв, J=7,4 Гц, 2H); 1,13 (т, J=7,4 Гц, 3H).

Пример 156: 1-(5-этилсульфонил-6-фтор-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 101, за исключением использования 4,5-дифтор-2-нитрофениламина вместо 4,5-дихлор-2-нитрофениламина и тиоэтоксида натрия вместо тиоизопропоксида натрия на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C13H11FN4O4S: 338,1; получено m/z: 339,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,04 (с, 1H); 13,04 (с, 1H); 8,95 (д, J=0,5 Гц, 1H); 8,36 (с, 1H); 8,09-7,35 (м, 2H); 3,42 (кв, J=7,4 Гц, 2H); 1,15 (т, J=7,3 Гц, 3H).

Пример 157: 1-(6-фтор-5-пропилсульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 102, за исключением использования 4,5-дифтор-2-нитрофениламина вместо 4,5-дихлор-2-нитрофениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C14H13FN4O4S: 352,1; получено m/z: 353,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,04 (с, 1H); 13,04 (с, 1H); 8,94 (д, J=0,6 Гц, 1H); 8,36 (с, 1H); 8,09-7,46 (м, 2H); 3,44-3,37 (м, 2H); 1,72-1,53 (м, 2H); 0,94 (т, J=7,4 Гц, 3H).

Пример 158: 1-(6-фтор-5-изопропилсульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 102, за исключением использования 4,5-дифтор-2-нитрофениламина вместо 4,5-дихлор-2-нитрофениламина и 2-пропантиола вместо 1-пропантиола на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C14H13FN4O4S: 352,1; получено m/z: 353,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 14,03 (с, 1H); 13,04 (с, 1H); 8,94 (д, J=0,6 Гц, 1H); 8,36 (с, 1H); 8,08-7,45 (м, 2H); 3,61-3,46 (м, 1H); 1,22 (д, J=6,8 Гц, 6H).

Пример 159: 1-(5-фенилсульфанил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, за исключением использования бензолтиола вместо 3-метилбензолтиола и 5-хлор-2-нитро-4-трифторметилфениламина вместо 4,5-дихлор-2-нитрофениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C18H11F3N4O2S: 404,1; получено m/z: 405,0 [M+H]+. 1H ЯМР (600 МГц, DMSO): 8,80 (д, J=0,5 Гц, 1H); 8,11 (с, 1H); 7,92 (с, 1H); 7,63 (с, 1H); 7,31-7,26 (м, 2H); 7,20-7,16 (м, 1H); 7,12-7,09 (м, 2H).

Пример 160: 1-[5-(4-метоксифенилсульфанил)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 60, за исключением использования 4-метоксибензолтиола вместо 3-метилбензолтиола и 5-хлор-2-нитро-4-трифторметилфениламина вместо 4,5-дихлор-2-нитрофениламина на Стадии А. Масс-спектроскопия (ESI/CI): расч. масса для C19H13F3N4O3S: 434,1; получено m/z: 435,1 [M+H]+. 1H ЯМР (500 МГц, DMSO): 8,79 (с, 1H); 8,15 (с, 1H); 7,87 (с, 1H); 7,36 (с, 1H); 7,32 (д, J=8,6 Гц, 2H); 6,98 (д, J=8,7 Гц, 2H); 3,76 (с, 3H).

Пример 161: 1-(5-бензолсульфонил-6-трифторметил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[1-(2-метокси-этоксиметил)-5-фенилсульфанил-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 159). Масс-спектроскопия (ESI/CI): расч. масса для C18H11F3N4O4S: 436,0; получено m/z: 437,0 [M+H]+. 1H ЯМР (600 МГц, DMSO): 14,40 (с, 1H); 13,03 (с, 1H); 8,98 (с, 1H); 8,61 (с, 1H); 8,38 (с, 1H); 8,11 (с, 1H); 7,85 (д, J=7,7 Гц, 2H); 7,70-7,66 (м, 1H); 7,63-7,58 (м, 2H).

Пример 162: 1-[5-(4-метоксибензолсульфонил)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[1-(2-метокси-этоксиметил)-5-(4-метоксифенилсульфанил)-6-трифторметил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 160). Масс-спектроскопия (ESI/CI): расч. масса для C19H13F3N4O5S: 466,1; получено m/z: 467,1 [M+H]+. 1H ЯМР (600 МГц, DMSO): 14,35 (с, 1H); 13,05 (с, 1H); 8,97 (с, 1H); 8,55 (с, 1H); 8,38 (с, 1H); 8,11 (уш с, 1H); 7,81 (д, J=7,9 Гц, 2H); 7,16-7,07 (м, 2H); 3,83 (с, 3H).

Пример 163: 1-[6-хлор-5-(4-хлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 1-бромметил-4-хлорбензола вместо бромистого бензила на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C18H12Cl2N4O2S, 418,0; получено m/z: 419,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,50 (с, 1H); 12,95 (с, 1H); 8,87 (с, 1H); 8,29 (с, 1H); 7,84-7,49 (м, 2H); 7,37 (к, J=8,6 Гц, 4H); 4,29 (с, 2H).

Пример 164: 1-[6-хлор-5-(3-хлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 1-бромметил-3-хлорбензола вместо бензилбромида на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C18H12Cl2N4O2S, 418,0; получено m/z: 419,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,86 (д, J=0,5, 1H); 8,28 (д, J=0,5 Гц, 1H); 7,67 (с, 1H); 7,53 (с, 1H); 7,44 (с, 1H); 7,34-7,29 (м, 3H); 4,30 (с, 2H).

Пример 165: 1-(6-хлор-5-циклогексилметилсульфанил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования бромметилциклогексана вместо бензилбромида на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C18H19ClN4O2S: 390,1; получено m/z: 391,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,87 (д, J=0,5 Гц, 1H); 8,29 (д, J=0,5 Гц, 1H); 7,67 (с, 1H); 7,53 (с, 1H); 2,90 (д, J=6,7 Гц, 2H); 1,88 (д, J=12,3 Гц, 2H); 1,69 (дд, J=9,6; 3,1 Гц, 2H); 1,61 (д, J=10,9 Гц, 1H); 1,57-1,47 (м, 1H); 1,25-1,10 (м, 3H); 1,10-1,00 (м, 2H).

Пример 166: 1-[6-хлор-5-(2-морфолин-4-илэтилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 4-(2-бромэтил)-морфолина вместо бензилбромида на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C17H18ClN5O3S: 407,1; получено m/z: 408,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,62 (с, 1H); 12,99 (с, 1H); 8,86 (с, 1H); 8,32 (с, 1H); 7,86 (с, 1H); 7,61 (с, 1H); 3,97 (с, 2H); 3,71 (с, 2H); 3,50 (с, 2H); 3,41 (с, 2H); 3,35 (с, 2H); 3,12 (с, 2H).

Пример 167: 1-[6-хлор-5-(3,4-дихлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 4-бромметил-1,2-дихлорбензола вместо бромистого бензила на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C18H11Cl3N4O2S: 452,0; получено m/z: 452,9 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 13,52 (с, 1H); 12,95 (с, 1H); 8,87 (с, 1H); 8,29 (д, J=0,5 Гц, 1H); 7,86- 7,28 (м, 5H); 4,30 (с, 2H).

Пример 168: 1-[6-хлор-5-(2,6-дихлорбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 2-бромметил-1,3-дихлорбензола вместо бензилбромида на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C18H11Cl3N4O2S: 452,0; получено m/z: 452,9 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,89 (с, 1H); 8,31 (с, 1H); 7,72 (с, 1H); 7,57 (с, 1H); 7,45 (д, J=8,0 Гц, 2H); 7,33 (дд, J=8,4; 7,8 Гц, 1H); 4,38 (с, 2H).

Пример 169: 1-[6-хлор-5-(4-метилбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 1-бромметил-4-метилбензола вместо бензилбромида на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C19H15ClN4O2S: 398,1; получено m/z: 399,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 8,86 (д, J=0,5 Гц, 1H); 8,29 (д, J=0,5 Гц, 1H); 7,67 (с, 1H); 7,53 (с, 1H); 7,27 (д, J=8,0 Гц, 2H); 7,12 (д, J=7,8 Гц, 2H); 4,25 (с, 2H); 2,26 (с, 3H).

Пример 170: 1-[6-хлор-5-(4-трифторметилбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 1-бромметил-4-трифторметилбензола вместо бензилбромида на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C19H12ClF3N4O2S: 452,0; получено m/z: 453,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,25 (с, 2H); 8,86 (д, J=0,4 Гц, 1H); 8,29 (д, J=0,5 Гц, 1H); 7,70-7,47 (м, 6H); 4,40 (с, 2H).

Пример 171: 1-[5-(2,4-бис-трифторметилбензилсульфанил)-6-хлор-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 1-бромметил-2,4-бис-трифторметилбензола вместо бензилбромида на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C20H11ClF6N4O2S: 520,0; получено m/z: 521,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,56 (с, 2H); 12,99 (с, 1H); 8,88 (с, 1H); 8,31 (с, 1H); 8,05-7,99 (м, 2H); 7,90-7,33 (м, 5H); 4,45 (с, 2H).

Пример 172: 1-[6-хлор-5-(2'-цианобифенил-4-илметилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 66, Способ B, за исключением использования 4'-бромметилбифенил-2-карбонитрила вместо бензилбромида на Стадии D. Масс-спектроскопия (ESI/CI): расч. масса для C25H16ClN5O2S: 485,1; получено m/z: 486,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 13,50 (с, 1H); 12,98 (с, 1H); 8,88 (с, 1H); 8,30 (с, 1H); 7,95 (дд, J=7,7; 1,0 Гц, 1H); 7,78 (тд, J=7,7; 1,3 Гц, 1H); 7,74-7,50 (м, 8H); 4,40 (с, 2H).

Пример 173: 1-[6-хлор-5-(4-хлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-(4-хлорбензилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 163). Масс-спектроскопия (ESI/CI): расч. масса для C18H12Cl2N4O4S, 450,0; получено m/z: 451,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 14,01 (с, 1H); 13,02 (с, 1H); 8,96-8,90 (м, 1H); 8,34 (с, 1H); 7,87 (с, 2H); 7,35 (д, J=8,5 Гц, 2H); 7,25- 7,20 (м, 2H); 4,90 (с, 2H).

Пример 174: 1-[6-хлор-5-(3-хлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-(3-хлорбензилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 164). Масс-спектроскопия (ESI/CI): расч. масса для C18H12Cl2N4O4S, 450,0; получено m/z: 451,0 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 14,03 (с, 1H); 13,03 (с, 1H); 8,93 (с, 1H); 8,33 (с, 1H); 7,96-7,86 (м, 2H); 7,37 (ддд, J=8,0; 2,1; 0,9 Гц, 1H); 7,34-7,28 (м, 2H); 7,14 (д, J=7,8 Гц, 1H); 4,91 (с, 2H).

Пример 175: 1-(6-хлор-5-циклогексилметансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-циклогексилметилсульфанил-1-(2-метокси-этоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 165). Масс-спектроскопия (ESI/CI): расч. масса для C18H19ClN4O4S: 422,1; получено m/z: 423,1 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 14,06 (с, 1H); 13,02 (с, 1H); 8,95 (с, 1H); 8,35 (с, 1H); 8,19 (с, 1H); 7,90 (с, 1H); 3,44 (д, J=6,2 Гц, 2H); 1,89-1,81 (м, 1H); 1,75 (д, J=10,0 Гц, 2H); 1,60 (дд, J=9,3; 3,4 Гц, 2H); 1,53 (д, J=11,9 Гц, 1H); 1,22-1,05 (м, 5H).

Пример 176: 1-[6-хлор-5-(3,4-дихлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-(3,4-дихлорбензилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 167). Масс-спектроскопия (ESI/CI): расч. масса для C18H11Cl3N4O4S: 484,0; получено m/z: 484,9 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 14,05 (с, 1H); 13,02 (с, 1H); 8,94-8,93 (м, 1H); 8,35 (с, 1H); 8,10-7,82 (м, 2H); 7,57 (д, J=8,3 Гц, 1H); 7,52 (д, J=2,0 Гц, 1H); 7,16 (дд, J=8,3 Гц, 2,0 Гц, 1H); 4,93 (с, 2H).

Пример 177: 1-[6-хлор-5-(2,6-дихлорфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-(2,6-дихлорбензилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 168). Масс-спектроскопия (ESI/CI): расч. масса для C18H11Cl3N4O4S: 484,0; получено m/z: 484,9 [M+H]+. 1H ЯМР (600 МГц, DMSO-d 6): 8,95 (д, J=0,5 Гц, 1H); 8,35 (д, J=0,5 Гц, 1H); 8,03-7,85 (м, 2H); 7,50 (д, J=7,9 Гц, 2H); 7,41 (дд, J=8,7 Гц, 7,5 Гц, 1H); 5,16 (с, 2H).

Пример 178: 1-(6-хлор-5-п-толилметансульфонил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(4-метилбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 169). Масс-спектроскопия (ESI/CI): расч. масса для C19H15ClN4O4S, 430,1; получено m/z: 431,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,98 (с, 1H); 13,02 (с, 1H); 8,93 (с, 1H); 8,34 (с, 1H); 8,03 (с, 1H); 7,85 (с, 1H); 7,07 (с, 4H); 4,82 (с, 2H); 2,22 (с, 3H).

Пример 179: 1-[6-хлор-5-(4-трифторметилфенилметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-(4-трифторметилбензилсульфанил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 170). Масс-спектроскопия (ESI/CI): расч. масса для C19H12ClF3N4O4S: 484,0; получено m/z: 485,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 14,05 (д, J=57,4 Гц, 1H); 13,03 (с, 1H); 8,93 (с, 1H); 8,35 (с, 1H); 8,10-7,74 (м, 3H); 7,69 (д, J=8,1 Гц, 2H); 7,46 (д, J=8,1 Гц, 2H); 5,02 (с, 2H).

Пример 180: 1-[5-(2,4-бис-трифторметилфенилметансульфонил)-6-хлор-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[5-(2,4-бис-трифторметилбензилсульфанил)-6-хлор-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 171). Масс-спектроскопия (ESI/CI): расч. масса для C20H11ClF6N4O4S: 552,0; получено m/z: 553,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 14,10 (с, 1H); 13,04 (с, 1H); 8,96 (с, 1H); 8,36 (с, 1H); 8,16 (д, J=8,2 Гц, 1H); 8,13-7,98 (м, 3H); 7,87 (д, J=8,0 Гц, 1H); 5,16 (с, 2H).

Пример 181: 1-[6-хлор-5-(2'-цианобифенил-4-илметансульфонил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 85, из этилового эфира 1-[6-хлор-5-(2'-цианобифенил-4-илметилсульфанил)-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (промежуточный продукт из Примера 172). Масс-спектроскопия (ESI/CI): расч. масса для C25H16ClN5O4S: 517,1; получено m/z: 518,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,97 (с, 1H); 13,03 (с, 1H); 8,93 (с, 1H); 8,34 (с, 1H); 7,96 (с, 1H); 7,94-7,83 (м, 2H); 7,76 (тд, J=7,9; 1,3 Гц, 1H); 7,60-7,55 (м, 2H); 7,52 (д, J=8,3 Гц, 2H); 7,39 (д, J=8,3 Гц, 2H); 4,97 (с, 2H).

Пример 182: 1-(1H-имидазо[4,5-b]хиноксалин-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этилового эфира 1-карбамимидоил-1H-пиразол-4-карбоновой кислоты гидрохлорид. К раствору этилового эфира 1H-пиразол-4-карбоновой кислоты (5,00 г, 35,7 ммоль) и цианамида (1,50 г, 35,7 ммоль) в диоксане (25 мл) добавили 4М раствор HCl в диоксане (9,80 мл, 39,3 ммоль). Полученную реакционную смесь выдержали при температуре 100°C в течение 3 ч. Затем смесь охладили до температуры 23°C и добавили Et2O (20 мл). Выпавшее в осадок твердое вещество белого цвета отфильтровали, получив искомое соединение (7,26 г, 93%). 1H ЯМР (400 МГц, DMSO-d 6): 9,65 (уш м, 4H); 9,29 (с, 1H); 8,43 (с, 1H); 4,31 (кв, J=7,1 Гц, 2H); 1,31 (т, J=7,1 Гц, 3H).

Стадия B: этиловый эфир 1-(1H-имидазо[4,5-b]хиноксалин-2-ил)-1H-пиразол-4-карбоновой кислоты. Раствор гидрохлорида этилового эфира 1-карбамимидоил-1H-пиразол-4-карбоновой кислоты (0,220 г, 1,00 ммоль), 2,3-дихлорхиноксалина (200 мг, 1,00 ммоль) и Cs2CO3 (1,63 г, 5,00 ммоль) в DMF (2 мл) перемешивали в течение 4 ч. Затем в смесь добавили H2O (3 мл) и подкислили ее до pH 2 с помощью 1M водного раствора HCl, получив белый осадок. Выпавший осадок отфильтровали, растерли с безводным EtOH (2 мл) и профильтровали, получив искомое соединение (0,130 г, 43%). Масс-спектроскопия (CI): расч. масса для C15H12N6O2: 308,1; получено m/z: 309,1 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6): 9,08 (с, 1H); 8,23 (с, 1H); 7,92 (д, J=8,1 Гц, 1H); 7,87 (д, J=8,2 Гц, 1H); 7,75 (т, J=7,1 Гц, 1H); 7,59 (т, J=7,5 Гц, 1H); 4,31 (кв, J=7,1 Гц, 2H); 1,32 (т, J=7,1 Гц, 3H).

Стадия C: 1-(1H-имидазо[4,5-b]хиноксалин-2-ил)-1H-пиразол-4-карбоновая кислота. Смесь этилового эфира 1-(1H-имидазо[4,5-b]хиноксалин-2-ил)-1H-пиразол-4-карбоновой кислоты (0,110 г, 0,360 ммоль), водного KOH (1M, 3,0 мл) и THF (3,0 мл) перемешивали в течение 4 ч. Затем смесь сконцентрировали и водный остаток подкислили до pH 2 с помощью 1M водного раствора HCl. Выпавшее в осадок вещество собрали фильтрацией, получив искомое соединение (89,0 мг, 89%). Масс-спектроскопия (ESI/CI): расч. масса для C13H8N6O2: 280,2; получено m/z: 281,1 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 13,32-12,37 (уш м, 1H); 9,03 (с, 1H); 8,19 (с, 1H); 7,94 (д, J=8,2 Гц, 1H); 7,89 (д, J=8,3 Гц, 1H); 7,76 (т, J=7,6 Гц, 1H); 7,61 (т, J=7,0 Гц, 1H).

Пример 183: 1-(6,7-дихлор-1H-имидазо[4,5-b]хиноксалин-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 182, за исключением использования 2,3,6,7-тетрахлорхиноксалина вместо 2,3-дихлорхиноксалина на Стадии B. Масс-спектроскопия (CI): расч. масса для C13H6Cl2N6O2: 349,1; получено m/z: 349,0 [M]+. 1H ЯМР (500 МГц, CD3OD-d 4): 9,23 (с, 1H); 8,20 (с, 1H); 8,12 (с, 1H); 8,03 (с, 1H).

Пример 184: 1-(1H-имидазо[4,5-b]пиразин-2-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 182, за исключением использования 2,3-дихлорпиразина вместо 2,3-дихлорхиноксалина на Стадии B. Масс-спектроскопия (ESI): расч. масса для C9H6N6O2: 230,2; получено m/z: 229,2 [M-H]- 1H ЯМР (500 МГц, DMSO-d 6): 13,21-12,59 (уш м, 1H); 8,93 (с, 1H); 8,41 (с, 1H); 8,25 (с, 1H); 8,21 (с, 1H).

Пример 185: 1-(6-хлор-9H-пурин-8-ил)-1H-пиразол-4-карбоновая кислота.

Искомое соединение получали аналогично тому, как описано в ПРИМЕРЕ 182, за исключением использования 4,5,6-трихлорпиримидина вместо 2,3-дихлорхиноксалина на Стадии B. Масс-спектроскопия (ESI/CI): расч. масса для C9H5ClN6O2: 264,6; получено m/z: 265,0 [M+H]+. 1H ЯМР (500 МГц, DMSO-d 6): 8,76 (с, 1H); 8,51 (с, 1H); 8,19 (с, 1H).

Пример 186: 1-(6-хлор-5-фенилсульфамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота.

Стадия A: этиловый эфир 1-[6-хлор-5-хлорсульфонил-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К суспензии дисульфида (Пример 66, Способ B, Стадия C, побочный продукт крупномасштабного синтеза) (0,100 г, 0,122 ммоль) в смеси 2M водного раствора HCl (0,15 мл, 0,305 ммоль) и ацетонитрила (0,75 мл) при температуре 0°C добавили N-хлорсукцинимид (97,7 мг, 0,732 ммоль). Полученную смесь перемешивали в течение 75 мин, затем разбавили ее EtOAc (20 мл), промыли солевым раствором (10 мл), высушили, профильтровали и сконцентрировали. Остаток очистили (КФХ) (5-40% EtOAc/гексаны) и получили искомое соединение (77,0 мг, выход 66%) в виде смеси региоизомеров 1:1. Масс-спектроскопия (ESI/CI): расч. масса для C17H18Cl2N4O6S: 476,0; получено m/z: 477,0 [M+H]+. 1H ЯМР (400 МГц, CDCl3): 8,96 (д, J=0,6 Гц, 1H); 8,92 (д, J=0,6 Гц, 1H); 8,54 (с, 1H); 8,50 (с, 1H); 8,23 (д, J=0,5 Гц, 1H); 8,22 (д, J=0,5 Гц, 1H); 7,92 (с, 1H); 7,90 (с, 1H); 6,29 (с, 2H); 6,25 (с, 2H); 4,38 (кв, J=7,1 Гц, 4H); 3,75-3,67 (м, 4H); 3,51-3,43 (м, 4H); 3,29 (с, 3H); 3,29 (с, 3H); 1,43-1,37 (м, 6H).

Стадия B: этиловый эфир 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-фенилсульфамоил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-хлор-5-хлорсульфонил-1-(2-метоксиэтоксиметил)-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (75,0 мг, 0,157 ммоль) в пиридине (0,79 мл) добавили анилин (15,8 мкл, 0,173 ммоль) и полученную смесь перемешивали при температуре 23°C в течение 1,5 ч. Затем смесь разделили между EtOAc (20 мл) и водой (20 мл). Водный слой далее экстрагировали с помощью EtOAc (20 мл), объединенные органические слои промыли солевым раствором (10 мл), высушили, профильтровали и сконцентрировали. Остаток очистили (КФХ) (5-80% EtOAc/гексаны) и получили искомое соединение (36,0 мг, выход 43%). Масс-спектроскопия (ESI/CI): расч. масса для C23H24ClN5O6S: 533,1; получено m/z: 534,1 [M+H]+.

Стадия C: этиловый эфир 1-(6-хлор-5-фенилсульфамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты. К раствору этилового эфира 1-[6-хлор-1-(2-метоксиэтоксиметил)-5-фенилсульфамоил-1H-бензоимидазол-2-ил]-1H-пиразол-4-карбоновой кислоты (35,0 мг, 65,5 мкмоль) в этаноле (0,50 мл) добавили раствор соляной кислоты в диоксане (4M, 0,241 мл) и полученную смесь перемешивали при температуре 23°C в течение 2,5 ч. Затем растворитель отогнали и очистили остаток (КФХ) (5-100% EtOAc/гексаны), получив искомое соединение (28,7 мг, выход 98%). Масс-спектроскопия (ESI/CI): расч. масса для C19H16ClN5O4S: 445,1; получено m/z: 446,0 [M+H]+.

Стадия D: 1-(6- хлор-5-фенилсульфамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновая кислота. Смесь моногидрата гидроксида лития (7,90 мг, 0,188 ммоль), этилового эфира 1-(6-хлор-5-фенилсульфамоил-1H-бензоимидазол-2-ил)-1H-пиразол-4-карбоновой кислоты (28,0 мг, 62,8 мкмоль), THF (0,24 мл) и воды (79 мкл) подвергли краткой ультразвуковой обработке и затем перемешивали при температуре 23°C в течение 18 ч. Затем отогнали растворитель и добавили 2 мл воды. Полученный раствор довели до pH 1 с помощью 1M водного раствора HCl, выпавшее в осадок твердое вещество отфильтровали и высушили, получив искомое соединение (20,6 мг, выход 75%). Масс-спектроскопия (ESI/CI): расч. масса для C17H12ClN5O4S: 417,0; получено m/z: 418,0 [M+H]+. 1H ЯМР (400 МГц, DMSO-d 6, таутомерное уширение): 13,96 (с, 1H); 13,02 (с, 1H); 10,55 (с, 1H); 8,91 (с, 1H); 8,33 (с, 1H); 8,31-8,08 (м, 1H); 7,95-7,53 (м, 1H); 7,26-7,04 (м, 4H); 6,96 (т, J=7,2 Гц, 1H).

Биологические протоколы:

Как указано ранее (см. таблицы выше), биологическая активность соединений в соответствии с настоящим изобретением определялась согласно следующим протоколам.

Экспрессия и очистка PHD2 181-417

Конструкцию для экспрессирования гена PHD2 человека, содержащую аминокислоты 181-417 последовательности GenBank NM_022051, клонировали в вектор pBAD (Invitrogen), вводя и N-терминальный гистидиновый, и Smt3 сигнальный пептиды, оба из которых отщепляются Ulp1. Белки нарабатывали путем экспрессии в клетках BL21, выращиваемых в среде Terrific Broth с добавкой 100 мкг/мл ампицилина. Клеточные культуры инфицировали при температуре 37°C и выращивали до оптической плотности 0,8 на длине волны 600 нм. Культуры индуцировали 0,1% арабинозой и выращивали в течение ночи при температуре 20°C при непрерывном встряхивании на шэйкере со скоростью 225 об/мин. Затем клетки собрали центрифугированием и хранили при температуре -80°C. Клеточную массу суспендировали в Буфере A (50 мМ Tris-HCl pH 7,2, 100 мМ NaCl, 100 мМ L-аргинина, 1 мМ TCEP, 0,05% (вес./об.) NP-40, 50 мМ имидазола) и затем добавили к ней лизозим и эндонуклеазу benzonase. Клетки лизировали на ультразвуковой бане и очистили центрифугированием (15 000 об/мин, 90 мин, 4°C). Наработанный белок очистили с помощью никельаффинной хроматографии на колонке HisTrap Crude FF column (GE Healthcare). Образцы элюировали в Буфере A с градиентом имидазола 50-200 мМ. Отщепление сигнального пептида Smt протеазой Ulp1 проводили путем инкубирования в течение ночи с диализом от Буфера A. Затем полученный образец PHD2181-417 пропустили через вторую колонку HisTrap Crude FF column (GE Healthcare) для удаления белка с неотщепленной меткой. Прошедший через вторую колонку раствор затем диализовали в 50 мМ MES pH 6,0, 1 мМ TCEP, 5 мМ NaCl для ионобменной хроматографии на катионобменной колонке HiTrap SP Cation Exchange column (GE Healthcare). Белок PHD2181-417 элюировали с градиентом NaCl 0-0,2 M. Собранные фракции объединили для дальнейшей очистки путем гельфильтрации (size exclusion chromatography) на колонке Superdex 75 Size Exclusion Column (GE Healthcare). Итоговый белок сконцентрировали до 4 мг/мл и диализовали в 10 мМ PIPES pH 7,0, 100 мМ NaCl, 0,5 мМ TCEP. По результатам гельэлектрофорезного анализа чистота полученного белка составила >95%.

Анализ активности фермента

Полученный полипептид PHD2181-417 (3 мкг) перед измерением ферментативной активности полипептида предварительно инкубировали в течение 30 мин с анализируемым соединением. Затем определяли ферментативную активность PHD, перенося смесь очищенного полипептида PHD2181-417 (3 мкг) с анализируемым соединением в 0,5 мл реакционной смеси, содержащей следующие компоненты: синтетический пептид HIF-1α, содержащий остатки [KNPFSTGDTDLDLEMLAPYIPMDDDFQLRSFDQLS] (10 мкМ, California Peptide Research Inc., Напа, Калифорния, США), и [5-14C]-2-оксоглутаровую кислоту (активность 50 мКюри/ммоль, Moravek Chemicals, Бреа, Калифорния, США), в реакционном буфере (40 мМ Tris-HCl, pH 7,5, 0,4 мг/мл каталазы, 0,5 мМ DTT, 1 мМ аскорбата) на 10 мин в присутствии соединения. Реакцию останавливали добавлением 50 мкл 70 мМ H3PO4 и 50 мкл 500 мМ NaH2PO4, pH 3,2. Детектирование [14C]-янтарной кислоты проводили путем отделения от [5-14C]-2-оксоглутаровой кислоты, инкубируя реакционную смесь со 100 мкл 0,16 М DNP, приготовленного в 30% перхлорной кислоты. Затем в смесь в качестве носителя для радиоактивных соединений добавили 50 мкл смеси немеченой 20 мМ 2-оксоглутаровой кислоты/20 мМ янтарной кислоты и инкубировали ее в течение 30 мин при комнатной температуре. Затем реакционную смесь в течение еще 30 мин инкубировали при комнатной температуре с 50 мкл 1M раствора 2-оксоглутаровой кислоты для осаждения избытка DNP. После этого реакционную смесь центрифугировали на 2800×g при комнатной температуре в течение 10 мин для отделения [14C]-янтарной кислоты в супернатанте от выпавшего в осадок [14C]-динитрофенилгидразона. Активность фракций супернатанта (400 мкл) определяли на счетчике бета-частиц (Beckman Coulter, Фуллертон, Калифорния, США). Степень ингибирования активности PHD2181-417 определяли как понижение продукции [14C]-янтарной кислоты. Величины IC50 оценивали путем подгонки полученных данных трехпараметрической логистической функцией в программной среде GraphPad Prism, версия 4.02 (Graph Pad Software, Сан Диего, Калифорния, США). Величины IC50 вплоть до 10 мкМ определяли количественно, при больших концентрациях указывали как >10 мкМ. Все анализируемые соединения разводили до концентрации 10 мМ в 100% DMSO (вес./об.) и проверяли в диапазоне концентраций от 10 мкМ до 3 нМ в полулогарифмической последовательности разведений, при этом конечная концентрация DMSO в среде составляла 2% (вес./об.).

Клеточный анализ

Клетки линии Hep-3B (ATCC, Манасас, Вирджиния, США) высевали на 96-луночные планшеты с плотностью 20 000 клеток на лунку в 100 мкл среды DMEM с добавкой 10% эмбриональной бычьей сыворотки, 1% заменимых аминокислот, 50 МЕ/мл пенициллина и 50 мкг/мл стрептомицина (все реагенты для клеточной культуральной среды компании Invitrogen, Карлсбад, Калифорния, США). Через 24 ч после посева в лунки добавляли анализируемые соединения и инкубировали планшет в течение еще 24 ч. Все анализируемые соединения разводили до концентрации 10 мМ в 100% DMSO (вес./об.) и проверяли в условиях насыщения, при этом конечная концентрация анализируемых соединений составляла 100 мкМ в 1% DMSO (вес./об.). Затем пятьдесят микролитров супернатанта переносили в набор для анализа «human Hypoxia assay kit» (Meso-Scale Discovery, Гейтерсбург, Мэриленд, США). Эритропоэтин в супернатанте определяли в соответствии с рекомендациями производителя набора следующим образом. Планшеты для детектирования EPO в течение ночи блокировали 3% BSA в фосфатном буфере, а 50 мкл супернатанта инкубировали при комнатной температуре на орбитальном шейкере в течение 2 ч. Затем в лунки добавили по двадцать пять микролитров 0,5 мкг/мл анти-EPO детектирующих антител и встряхивали планшет на орбитальном шейкере при комнатной температуре в течение еще 2 ч. После трехкратной промывки фосфатным буфером в лунки добавили по 150 мкл 1X буфера для измерений и измерили оптическую плотность на анализаторе MSD SECTOR. Затем проанализировали данные, определив процент секреции EPO в присутствии 10 мкМ или 100 мкМ анализируемого соединения по отношению к уровню секреции в присутствии контрольного соединения для данного теста, 7-[(4-хлорфенил)-(5-метилизоксазол-3-иламино)-метил]-хинолин-8-ол. Полученные данные приводятся в виде процентной доли уровня секреции EPO относительно контрольного соединения и воспроизводятся с точностью 10%.

Несмотря на то что излагаемое изобретение было проиллюстрировано конкретными примерами и предпочтительными вариантами осуществления, должно быть понятно, что настоящее изобретение не ограничивается приведенным выше подробным описанием.

1. Соединение формулы (I)

где
n равно от 2 до 4;
каждый из заместителей R1 независимо выбирают из Н, галогена, -С1-4алкила, -С1-4пергалоалкила, трифтор-С1-4алкокси, -NO2, -CN, СО2Н, -ОС1-4алкила, -SC1-4алкила, -S(С1-4алкил)-Rc, -S(O)21-4алкил)-Rc, -S(О)-С1-4алкила, -SO21-4алкила, -S-Rc, -S(O)-Rc, -SO2-Rc, -SO2-NH-Rc, -O-Rc, -CH2-O-Rc, -С(O)NH-Rc, -NRaRb, бензилокси, фенила, необязательно замещенного одним-двумя Rd, цианобифенил-4-илметилсульфанила, цианобифенил-4-илметансульфонила или -S-(СН2)2-морфолина и две смежные группы R1 могут соединяться с образованием ароматического 5-6-членного кольца, необязательно замещенного одной метильной группой или двумя атомами галогена, необязательно содержащего один или два S или N;
Ra и Rb каждый независимо представляет собой Н, С1-4алкил, -C(O)C1-4алкил, -С(O)-Rc, -C(O)CH2-Re, C1-4алкил-Re, -SO2-Rc, -SO2-C1-4алкил, фенил, бензил; или же Ra и Rb вместе с атомом азота, с которым они соединены, образуют моноциклическое 5-6-членное гетероциклоалкильное кольцо, необязательно содержащее один гетероатом, выбранный из О;
Rc представляет собой -C3-8циклоалкил, фенил, необязательно замещенный одним-двумя Rd, бензил, необязательно замещенный одним-тремя Rd; морфолин;
Rd независимо представляет собой галоген, -OH, -C1-4алкил или -C1-4пергалогеналкил, трифтор C1-4алкокси, -OC1-4алкил, или -O-бензил, необязательно замещенный галогеном;
Re представляет собой -C6гетероциклоалкил, необязательно содержащий один или два атомов O или N, необязательно замещенный метильной группой;
R2 и R3 оба представляют собой H, -CF3 или C1-3алкил;
каждый из Z представляет собой атом C или атом N, при условии, что одновременно не более двух Z представляют собой N; и
энантиомеры, диастереоизомеры, рацематы и фармацевтически приемлемые соли этих соединений, обладающее ингибиторной активностью в отношении PHD.

2. Соединение по п.1, где R2 и R3 каждый представляют собой -H.

3. Соединение по п.1, где каждый заместитель R1 независимо выбирают из группы, состоящей из: Н, галогена, -CF3, -OCF3, фенила (необязательно замещенного или незамещенного, несущего до двух групп -CF3, галогена, -OH, C1-4алкила, C1-4алкокси и -OCF3), бензилоксифенила (необязательно замещенного или незамещенного галогеном), бензилокси, бензилоксиметила, фенилсульфанила (необязательно замещенного или незамещенного, несущего до двух групп -С1-4алкила, галогена, -CF3, -OCF3 и -С1-4алкокси), бензилсульфанила (необязательно замещенного или незамещенного, несущего до трех групп галогена, С1-4алкила, -CF3 и -OCF3), фенэтилсульфанила, бензолсульфонила (необязательно замещенного или незамещенного, несущего до двух групп С1-4алкила, С1-4алкокси, галогена, -CF3 и -OCF3), фенилметансульфонила (необязательно замещенного или незамещенного, несущего до трех групп С1-4алкила, С1-4алкокси, галогена, -CF3 и -OCF3), фенилэтансульфонила, бензолсульфинила, цианобифенил-4-илметилсульфанила, цианобифенил-4-илметансульфонила, фенилкарбамоила, бензилкарбамоила, бензиламино, фенилсульфамоила, фениламино, бензоиламино и бензолсульфониламино.

4. Соединение по п.1, где две смежные группы R1 объединены с образованием замещенного 5-6-членного кольца, содержащего один или два гетероатома S или N.

5. Соединение по п.1, где упомянутое замещенное 5-6-членное кольцо является ароматическим.

6. Соединение по п.1, где каждый из заместителей R1 независимо выбирают из Н, галогена, -С1-4алкила, -CF3, -OCF3, -С1-4алкилсульфонила, -С1-4алкилсульфинила, -С1-4алкилсульфанила, -NO2, -NH2, -NH-С1-4алкила, -NH-SO23-8циклоалкила, -NH-SO21-4алкила, -NH-C(О)-С1-4алкила, -CN, -CO2H, -ОС1-4алкила, -NH-(СН2)2-морфолина, -NH(СО)СН2-морфолина, -NHC(О)-СН2-пиперидина, -NHC(О)-СН2-(N-метилпиперазина), -NH-С1-4алкилморфолина, -S-(СН2)2-морфолина, -С(O)-NH-морфолина, пирролидина, пиперидина и морфолина.

7. Соединение, выбранное из группы, состоящей из следующего:
1-(1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5,6-дихлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-6-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5,6-диметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бром-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-метокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4-хлор-6-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5,6-диметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4,5-диметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-{5-[3-(3-хлорбензилокси)-фенил]-1Н-бензоимидазол-2-ил}-1Н-пиразол-4-карбоновая кислота;
1-{5-[3-(2-хлорбензилокси)-фенил]-1Н-бензоимидазол-2-ил}-1Н-пиразол-4-карбоновая кислота;
1-{5-[3-(4-хлорбензилокси)-фенил]-1Н-бензоимидазол-2-ил}-1Н-пиразол-4-карбоновая кислота;
1-[5-(3-бензилоксифенил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-(4-бензилоксифенил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-(3-трифторметилфенил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-(3,4-дихлорфенил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-бром-1Н-бензоимидазол-2-ил)-3-трифторметил-1Н-пиразол-4-карбоновая кислота;
1-(5,6-дихлор-1Н-бензоимидазол-2-ил)-3-трифторметил-1Н-пиразол-4-карбоновая кислота;
1-(5-бром-1Н-бензоимидазол-2-ил)-3,5-диметил-1Н-пиразол-4-карбоновая кислота;
1-(5,6-дихлор-1Н-бензоимидазол-2-ил)-3,5-диметил-1Н-пиразол-4-карбоновая кислота;
1-[5-(4-гидроксифенил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-(3-гидроксифенил)-1Н-бензимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бром-6,7-диметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-7-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(7-бром-5-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4,5,6-трифтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4-бром-5,6-дифтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-4-метил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4,6-дихлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4-бром-6-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5,6-дифтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4-бром-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-метансульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-циано-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-нитро-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-амино-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-пирролидин-1-ил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-пиперидин-1-ил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-морфолин-4-ил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-метокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
2-(4-карбоксипиразол-1-ил)-1Н-бензоимидазол-5-карбоновая кислота;
1-(5-бром-7-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бром-7-метил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бром-7-метил-1Н-имидазо[4,5-f]хинолин-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[5-(3,4-дихлорфенокси)-6-трифторметил-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-хлорфенокси)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-(4-хлорфенокси)-6-трифторметокси-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-фенокси-6-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[5-(4-фторфенокси)-6-трифторметил-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-(4-хлорфенокси)-6-трифторметил-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-фенокси-6-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-фенокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бензилокси-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-м-толилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-хлорфенилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-фенилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3,4-дихлорфенилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3-метоксифенилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-метоксифенилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-бензилсульфанил-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[5-(4-трет-бутилбензилсульфанил)-6-хлор-1Н-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-фторбензилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2-хлорбензилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-фенэтилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-метилсульфанил-5-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-пропилсульфанил-5-трифторметил-1H-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-изопропилсульфанил-5-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-фтор-6-метилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-6-метилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-6-этилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-6-изопропилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-6-пропилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-метилсульфанил-5-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-изопропилсульфанил-5-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-пропилсульфанил-5-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(толуол-3-сульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-бензолсульфонил-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-метоксибензолсульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-хлорбензолсульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-трифторметоксибензолсульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3,4-дихлорбензолсульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3-метоксибензолсульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-фенилметансульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2,4,6-триметилфенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-метоксифенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-фторфенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2-хлорфенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2-фенилэтансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-6-этансульфинил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-6-этансульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-метансульфонил-5-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-фтор-6-метансульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-хлор-6-метансульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-метансульфонил-5-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[5-хлор-6-(пропан-2-сульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-хлор-6-(пропан-1-сульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-(пропан-2-сульфонил)-5-трифторметил-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-(пропан-1-сульфонил)-5-трифторметил-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-(пропан-2-сульфонил)-5-трифторметокси-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-(пропан-1-сульфонил)-5-трифторметокси-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-бензолсульфинил-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-метансульфинил-5-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-бром-5-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4,5-дифтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4,6-дифтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(1H-нафто[2,3-d]имидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(3Н-нафто[1,2-d]имидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-фтор-4-метил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-пиперидин-1-ил-6-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-фтор-6-пиперидин-1-ил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-этокси-5-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-фенилкарбамоил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бензилкарбамоил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[5-(морфолин-4-илкарбамоил)-1Н-бензоимидазол-2-ил]-1H-пиразол-4-карбоновая кислота;
1-(5-бензилоксиметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4-бром-6-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(8H-имидазо[4',5':3,4]бензо[2,1-d]тиазол-7-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5,6-бис-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4,5,6-трихлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(4-бром-5,6-дихлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-фтор-5-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-этиламино-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-пропиламино-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бензиламино-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-фениламино-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2-морфолин-4-ил-этиламино)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-циклопропансульфониламино-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-метансульфониламино-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-этансульфониламино-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бензолсульфониламино-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-ацетиламино-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-пропиониламино-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-бензоиламино-6-хлор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2-морфолин-4-илацетиламино)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2-пиперидин-1-илацетиламино)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-{6-хлор-5-[2-(4-метилпиперазин-1-ил)-ацетиламино]-1Н-бензоимидазол-2-ил}-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-метоксифенокси)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-хлор-2-фторфенокси)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-трифторметоксифенокси)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3-хлор-4-фторфенокси)-1Н-бензимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота
1-(5-этилсульфанил-6-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-этилсульфанил-6-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-этилсульфанил-6-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-фтор-5-пропилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-фтор-5-изопропилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-этилсульфонил-6-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-этилсульфонил-6-трифторметокси-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-этилсульфонил-6-фтор-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-фтор-5-пропилсульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-фтор-5-изопропилсульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(5-фенилсульфанил-6-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[5-(4-метокси-фенилсульфанил)-6-трифторметил-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(5-бензолсульфонил-6-трифторметил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[5-(4-метоксибензолсульфонил)-6-трифторметил-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-хлорбензилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3-хлорбензилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-циклогексилметилсульфанил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2-морфолин-4-ил-этилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3,4-дихлорбензилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2,6-дихлорбензилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-метилбензилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-трифторметилбензилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-(2,4-бис-трифторметилбензилсульфанил)-6-хлор-1H-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2'-цианобифенил-4-илметилсульфанил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-хлорфенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3-хлорфенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-циклогексилметансульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(3,4-дихлорфенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2,6-дихлор-фенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-п-толилметансульфонил-1Н-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(4-трифторметилфенилметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[5-(2,4-бис-трифторметилфенилметансульфонил)-6-хлор-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-[6-хлор-5-(2'-цианобифенил-4-илметансульфонил)-1Н-бензоимидазол-2-ил]-1Н-пиразол-4-карбоновая кислота;
1-(1H-имидазо[4,5-b]хиноксалин-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6,7-дихлор-1Н-имидазо[4,5-b]хиноксалин-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(1H-имидазо[4,5-b]пиразин-2-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-9Н-пурин-8-ил)-1Н-пиразол-4-карбоновая кислота;
1-(6-хлор-5-фенилсульфамоил-1H-бензоимидазол-2-ил)-1Н-пиразол-4-карбоновая кислота,
а также их фармацевтически приемлемые соли.

8. Фармацевтическая композиция, обладающая ингибиторной активностью в отношении PHD, включающая фармацевтически приемлемый наполнитель и эффективное количество соединения формулы (I) по п.1 или энантиомеры, диастереоизомеры, рацематы и фармацевтически приемлемые соли этих соединений.

9. Фармацевтическая композиция, обладающая ингибиторной активностью в отношении PHD, включающая одно из соединений по п.7 или его фармацевтически приемлемые соли.

10. Способ лечения анемии, гипоксии, ишемии, заболеваний периферических сосудов, инфаркта миокарда, инсульта, диабета, ожирения, воспалительных заболеваний кишечника, язвенного колита, болезни Крона, ран, инфекций, ожогов и переломов кости, включающий введение нуждающемуся в этом пациенту терапевтически эффективного количества обладающего ингибиторной активностью в отношении PHD соединения формулы (I) по п.1 или энантиомеров, диастереоизомеров, рацематов и фармацевтически приемлемых солей этих соединений.

11. Способ лечения гипоксического расстройства, включающий введение нуждающемуся в этом пациенту терапевтически эффективного количества обладающего ингибиторной активностью в отношении PHD соединения формулы (I) по п.1 или энантиомеров, диастереоизомеров, рацематов и фармацевтически приемлемых солей этих соединений.



 

Похожие патенты:

Изобретение относится к (3aR,6aR)-N-(4-(3-этинилфениламино)-7-метоксихиназолин-6-ил)-1-метилгексагидропирроло[3,4-b]пиррол-5(1Н)-карбоксамиду или его фармацевтически приемлемой соли, а также к фармацевтической композиции для лечения ракового заболевания, чувствительного к ингибированию гиперэкспрессии и/или гиперактивности рецептора эпидермального фактора роста, содержащей указанное соединение, способу лечения ракового заболевания, способу ингибирования и к применению указанного соединения для приготовления лекарственного средства.

Изобретение относится к новому 5-метил-6-нитро-7-оксо-4,7-дигидро-1,2,4-триазоло[1,5-α]пиримидинид l-аргининия моногидрату формулы (1) Соединение обладает противовирусной активностью в отношении вирусов штаммов гриппа А и В в системах in vitro и in vivo.

Изобретение относится к хиназолиноновым соединениям формулы (I) и его фармацевтически приемлемым солям, в которой n равно от 0 до 3 и R1 имеет определения, указанные в формуле изобретения.

Изобретение относится к соединениям формулы (I), где A означает морфолинил, 1,4-оксазепамил, пиперидинил, пирролидинил или азетидинил, который связан по N; R1 означает C1-C6-алкильную группу; R2 означает бициклическую арильную группу, выбранную из 1H-индолила, 1H-пирроло[3,2-b]пиридила, хинолила, нафтила, 1H-пирроло[2,3-b]пиридила, 5H-пирроло[3,2-d]пиримидинила, 7H-пирроло[2,3-d]пиримидинила, бензо[b]тиофенила, имидазо[1,2-а]пиридила, бензо[b]тиазолила, 5Н-пирроло[2,3-b]пиразинила и хиноксалинила, которая может быть замещена R4; R3 означает водород или атом галогена; R4 означает C1-C6-алкильную группу, C1-C6-галогеналкильную группу, OR1A, галоген, -(CH2)aOH, CN, NHCOR1A, SO2R1A или NHSO2R1A; R5 означает C1-C6-алкильную группу, -(CH2)aOH, -(CH2)aOR1B, галоген или CONH2; когда p является множественным числом, R5 может быть одинаковым или различным, или R5 может быть объединен с другим R5; каждый из R1A и R1B независимо означает C1-C6-алкильную группу; a равно 0, 1 или 2; n равно 1 или 2; p равно 0, 1, 2, 3, 4 или 5.

Описываются новые производные имидазо[1,2-b][1,2,4,5]тетразинов общей формулы где: Het=4-метилимидазол-1-ил, R=Н или Het=3,5-диметилпиразол-1-ил, R=пропилтио, и противоопухолевые агенты на их основе для лечения онкологических больных.

Изобретение относится к соединениям или их фармацевтически приемлемым солям, где соединение имеет формулу I-а, в которой R1 и R3 отсутствуют, m представляет собой целое число от 1 до 2, n представляет собой целое число от 1 до 3, A представляет собой , B представляет собой или , где X2 представляет собой O или S, R4a отсутствует, R4b выбирают из группы, состоящей из: , , , , и ; Rk выбирают из C1-6алкила и C1-6галогеналкила, L и E являются такими, как указано в п.1 формулы изобретения; или соединение является таким, как указано в b) п.1 формулы изобретения.

Описывается конкретный перечень разнообразных новых азаазуленовых соединений, содержащих 6,5-конденсированный гетероцикл индольного типа, бензимидазольного типа, пуринового типа, 3Н-имидазо[4,5-b]пиридин, 3Н-имидазо[4,5-с] пиридин т.д., которые могут быть изображены общей формулой (I). где R1 - =О; R2- Н или диэтиламиноС2-4алкил; R3-R7 - Н; другие переменные в этой формуле (I) отражены в конкретных структурных формулах описываемых соединений.

Изобретение относится к новым производным пиразоло[1,5-a]пиримидинов, обладающим ингибирующей активностью в отношении тропомиозин-зависимых киназ (Trk). В формуле I R1 является H или (1-6C алкилом); R2 представляет собой NRbRc, (1-4C)алкил, (1-4C)фторалкил, CF3, (1-4С)гидроксиалкил, -(1-4Cалкил)hetAr1, -(1-4Cалкил)NH2, -(1-4C алкил)NH(1-4Салкил), -(1-4Cалкил)N(1-4Cалкил)2, hetAr2, hetCyc1, hetCyc2, фенил, замещенный, при необходимости, NHSO2(1-4Cалкилом) или (3-6С)циклоалкилом, замещенным, при необходимости, (1-4C алкилом), CN, OH, OMe, NH2, NHMe, N(CH3)2, F, CF3, CO2(1-4C алкилом), CO2H; C(=O)NReRf или C(=O)ORg; Rb является H или (1-6C алкилом); Rc представляет собой H, (1-4C)алкил, (1-4C)гидроксиалкил, hetAr3 или фенил, где указанный фенил замещен, при необходимости, одним или несколькими заместителями, выбранными, независимо, из галогена, CN, CF3 и -O(1-4C алкила); Re представляет собой H или (1-4C)алкил; Rf представляет собой H, (1-4C)алкил или (3-6C)циклоалкил; Rg представляет собой H или (1-6C)алкил; X отсутствует или является -CH2-, -CH2CH2-, -CH2O- или -CH2NRd; Rd представляет собой H или (1-4C алкил); R3 представляет собой H или (1-4C алкил); и n равняется 0-6.

Изобретение относится к фармацевтически приемлемым солям (R)-7-[3-амино-4-(2,4,5-трифторфенил)-бутаноил]-3-трифторметил-5,6,7,8-тетрагидроимидазо[1,5-а]пиразин-1-карбоновой кислоты, где соль присоединения кислоты выбрана из группы, состоящей из фосфата, малата и тартрата, соль присоединения основания выбрана из группы, состоящей из соли натрия, соли лития, соли калия, соли кальция, соли магния, соли тетраметиламмония, соли тетраэтиламмония, соли этаноламина, соли холина и соли аргинина.

Изобретение относится к соединениям формулы (I), где A обозначает шестичленный арильный радикал или пятичленный гетероарильный радикал, который содержит один гетероатом, выбранный из кислорода и серы, один или несколько атомов водорода в упомянутых арильных или гетероарильных радикалах могут быть заменены замещающими группами R1, которые независимо друг от друга выбирают из группы, включающей: F, Cl, Br, I, (C1-C10)-алкил-, (C1-C10)-алкокси-, -NR13R14; В обозначает радикал с моно- или конденсированными бициклическими кольцами, выбранный из группы, включающей: шести-десятичленные арильные радикалы, пяти-десятичленные гетероарильные радикалы и девяти-четырнадцатичленные циклогетероалкиларильные радикалы, где циклогетероалкильные звенья могут быть насыщенными или частично ненасыщенными, а гетероциклические группы могут содержать один или несколько гетероатомов, выбранных из группы, включающей азот, кислород и серу, один или несколько атомов водорода в радикальных группах В могут быть заменены замещающими группами R5 (такими, как указано в формуле изобретения), L обозначает ковалентную связь, X обозначает группу -O-, R2 отсутствует или обозначает один или несколько заместителей, выбранными из F и (C1-C4)-алкильного радикала, R3 и R4 независимо друг от друга обозначают (C1-C10)-алкильные, (C3-C14)-циклоалкильные, (C4-C20)-циклоалкилалкильные, (C2-C19)-циклогетероалкильные, (C3-C19)-циклогетероалкилалкильные, (C6-C10)-арильные, (C7-C20)-арилалкильные, (C1-С9)-гетероарильные, (С2-C19)-гетероарилалкильные радикалы, или R3 и R4 вместе с азотом, с которым они связаны, могут образовывать четырех-десятичленное насыщенное, ненасыщенное или частично ненасыщенное гетероциклическое соединение, которое может дополнительно содержать один или несколько гетероатомов из числа -O-, -S(O)n-, =N- и -NR8-, остальные радикалы являются такими, как указано в формуле изобретения.

Изобретение относится к хиназолиноновым соединениям формулы (I) и его фармацевтически приемлемым солям, в которой n равно от 0 до 3 и R1 имеет определения, указанные в формуле изобретения.

Изобретение относится к новым дигидроинденамидам, выбранным из соединений, соответствующих общей формуле II, или их фармацевтически приемлемым солям. Соединения ингибируют активность протеинкиназ, выбранных из Abl, c-Kit и PDGFR, и могут найти применение для лечения заболеваний, связанных с нарушением активности указанных протеинкиназ, например лейкемии и других видов рака.

Изобретение относится к соединениям формулы (I), где A означает морфолинил, 1,4-оксазепамил, пиперидинил, пирролидинил или азетидинил, который связан по N; R1 означает C1-C6-алкильную группу; R2 означает бициклическую арильную группу, выбранную из 1H-индолила, 1H-пирроло[3,2-b]пиридила, хинолила, нафтила, 1H-пирроло[2,3-b]пиридила, 5H-пирроло[3,2-d]пиримидинила, 7H-пирроло[2,3-d]пиримидинила, бензо[b]тиофенила, имидазо[1,2-а]пиридила, бензо[b]тиазолила, 5Н-пирроло[2,3-b]пиразинила и хиноксалинила, которая может быть замещена R4; R3 означает водород или атом галогена; R4 означает C1-C6-алкильную группу, C1-C6-галогеналкильную группу, OR1A, галоген, -(CH2)aOH, CN, NHCOR1A, SO2R1A или NHSO2R1A; R5 означает C1-C6-алкильную группу, -(CH2)aOH, -(CH2)aOR1B, галоген или CONH2; когда p является множественным числом, R5 может быть одинаковым или различным, или R5 может быть объединен с другим R5; каждый из R1A и R1B независимо означает C1-C6-алкильную группу; a равно 0, 1 или 2; n равно 1 или 2; p равно 0, 1, 2, 3, 4 или 5.

Изобретение относится к производным имидазола общей формулы (I) или к его фармацевтически приемлемой соли, где R1 означает галоген, С1-6-алкил или С1-6-алкокси; R2 означает С1-6-алкил; R3 означает водород, С1-6-алкил; Q означает -N= или -CH=; R4 представляет собой группу формулы IIa или IIb, где X, Y и Z независимо представляют собой -СН= или -N=, и причем только один из X или Y может быть атомом азота; R5 и R6 независимо представляют собой водород, С1-6-алкил, С1-6-гидроксиалкил, С1-6-алкоксиалкил, -(СН2)m-(СО)O-C1-6-алкил, -(CH2)m-S(O)2-C1-6-алкил, -(СН2)m-С(O)-NR′R′′ и где m=1 и R′ и R″ независимо представляют собой водород или С1-6-алкил.

Описывается конкретный перечень разнообразных новых азаазуленовых соединений, содержащих 6,5-конденсированный гетероцикл индольного типа, бензимидазольного типа, пуринового типа, 3Н-имидазо[4,5-b]пиридин, 3Н-имидазо[4,5-с] пиридин т.д., которые могут быть изображены общей формулой (I). где R1 - =О; R2- Н или диэтиламиноС2-4алкил; R3-R7 - Н; другие переменные в этой формуле (I) отражены в конкретных структурных формулах описываемых соединений.

Изобретение относится к соединениям формулы (I), где A обозначает шестичленный арильный радикал или пятичленный гетероарильный радикал, который содержит один гетероатом, выбранный из кислорода и серы, один или несколько атомов водорода в упомянутых арильных или гетероарильных радикалах могут быть заменены замещающими группами R1, которые независимо друг от друга выбирают из группы, включающей: F, Cl, Br, I, (C1-C10)-алкил-, (C1-C10)-алкокси-, -NR13R14; В обозначает радикал с моно- или конденсированными бициклическими кольцами, выбранный из группы, включающей: шести-десятичленные арильные радикалы, пяти-десятичленные гетероарильные радикалы и девяти-четырнадцатичленные циклогетероалкиларильные радикалы, где циклогетероалкильные звенья могут быть насыщенными или частично ненасыщенными, а гетероциклические группы могут содержать один или несколько гетероатомов, выбранных из группы, включающей азот, кислород и серу, один или несколько атомов водорода в радикальных группах В могут быть заменены замещающими группами R5 (такими, как указано в формуле изобретения), L обозначает ковалентную связь, X обозначает группу -O-, R2 отсутствует или обозначает один или несколько заместителей, выбранными из F и (C1-C4)-алкильного радикала, R3 и R4 независимо друг от друга обозначают (C1-C10)-алкильные, (C3-C14)-циклоалкильные, (C4-C20)-циклоалкилалкильные, (C2-C19)-циклогетероалкильные, (C3-C19)-циклогетероалкилалкильные, (C6-C10)-арильные, (C7-C20)-арилалкильные, (C1-С9)-гетероарильные, (С2-C19)-гетероарилалкильные радикалы, или R3 и R4 вместе с азотом, с которым они связаны, могут образовывать четырех-десятичленное насыщенное, ненасыщенное или частично ненасыщенное гетероциклическое соединение, которое может дополнительно содержать один или несколько гетероатомов из числа -O-, -S(O)n-, =N- и -NR8-, остальные радикалы являются такими, как указано в формуле изобретения.

Настоящее изобретение относится к новым алкил [2-(2-{5-[4-(4-{2-[1-(2-метоксикарбониламино-ацетил)-пирролидин-2-ил]-3Н-имидазол-4-ил}-фенил)-бута-1,3-диинил]-1Н-имидазол-2-ил}-пирролидин-1-ил)-2-оксо-этил]-карбаматам или их нафталин-1,5-дисульфонатам, которые обладают свойствами ингибитора белка NS5A и могут быть использованы для профилактики и лечения вирусных заболеваний, вызываемых вирусами гепатита С (HCV) и гепатита GBV-C.

Настоящее изобретение относится к новым производным индола и бензоморфолина формулы (I), или его фармацевтически приемлемой соли, где R1 представляет собой C1-6-алкил или С1-3алкил, замещенный С3-7циклоалкилом; R2 представляет собой галогено; R3 представляет собой водород; n равно 2; X представляет собой -СН2СН2-O или -СН=СН-; Y представляет собой -О- или -CR4(OH)-; R4 представляет собой водород или С1-3 алкил.

Изобретение относится к 5-членным гетероциклическим соединениям общей формулы (I), их пролекарствам или фармацевтически приемлемым солям, обладающим ингибирующей ксантиноксидазу активностью.

Изобретение относится к N-[2,4-диоксо-6-(тетрагидрофуран-2-ил)-7-трифторметил-1,4-дигидро-2H-хиназолин-3-ил]метансульфонамиду и N-[6-(1-изопропоксиэтил)-2,4-диоксо-7-трифторметил-1,4-дигидро-2H-хиназолин-3-ил]метансульфонамиду, которые обладают антагонистической активностью в отношении рецептора АМРА.

Изобретение относится к новым соединениям формулы I: цис-COOR-XCH-(СН2)a-СН=СН-(СН2)b-СН3, в которой (а) и (b) могут принимать любое значение от 0 до 14, (X) выбирают из: ОН, NH2, СН3, F, F3C, HS, O-СН3, PO4(СН2-СН3)2 и СН3СОО, и (R) представляет собой натрий (Na), применяемым для профилактики и/или терапевтического лечения ожирения, гипертензии и/или рака.
Наверх