Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего



Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего
Применение пептида ggf2 в лечении или профилактике сердечной недостаточности у млекопитающего

 


Владельцы патента RU 2536938:

АКОРДА ТЕРАПЬЮТИКС, ИНК. (US)

Изобретение относится к области биотехнологии. Охарактеризовано применение терапевтически эффективного количества пептида GGF2, содержащего домен, подобный эпидермальному фактору роста (EGF-подобный), в лечении или профилактике сердечной недостаточности у млекопитающего путем инъекции указанного пептида каждые 48 часов дозой, составляющей от приблизительно 0,001 мг/кг до приблизительно 10 мг/кг. Изобретение улучшает терапевтический эффект при введении нейрегулина с минимизацией любых потенциальных побочных эффектов. 13 з.п. ф-лы, 15 ил., 11 табл.

 

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Область изобретения относится к лечению сердечной недостаточности. Более конкретно, изобретение относится к улучшенному режиму дозирования, в соответствии с которым сохраняется и/или улучшается терапевтический эффект введения нейрегулина, такого как фактор роста глии 2 (GGF2) или его фрагмент, при минимизации любых потенциальных побочных эффектов.

ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ

Фундаментальной проблемой, связанной с введением лекарственных средств пациентам, является зависимость между переносимостью и эффективностью. Терапевтический индекс представляет собой диапазон, между тем, когда пациенту можно вводить эффективную дозу вещества, и дозой, при которой наблюдают нежелательные побочные эффекты. Как правило, чем больше различие между эффективной дозой и дозой, при которой начинаются побочные эффекты, тем более слабо действующим является вещество и больше вероятность, что его будет переносить пациент.

Сердечная недостаточность, особенно застойная сердечная недостаточность (CHF), представляет собой одну из лидирующих причин смерти в индустриализованных странах. Факторы, лежащие в основе застойной сердечной недостаточности, включают высокое артериальное давление, ишемическую болезнь сердца, воздействие кардиотоксических соединений, таких как антрациклиновые антибиотики, воздействие радиации, физическую травму и генетические дефекты, ассоциированные с повышенным риском сердечной недостаточности. Таким образом, CHF часто является результатом повышенной нагрузки на сердце вследствие гипертензии, повреждения миокарда вследствие хронической ишемии, инфаркта миокарда, вирусного заболевания, химической токсичности, радиации и других заболеваний, таких как склеродермия. Эти состояния приводят к прогрессирующему снижению насосной функции сердца. Сначала повышенная нагрузка, являющаяся результатом высокого артериального давления или утраты сократительной ткани, вызывает компенсаторную гипертрофию кардиомиоцитов и утолщение стенки левого желудочка, таким образом, увеличивая сократительную способность и поддерживая сердечную функцию. Однако с течением времени камера левого желудочка расширяется, систолическая насосная функция ухудшается, кардиомиоциты подвергаются апоптотической гибели клеток и функция сердечной мышцы прогрессивно ухудшается.

Нейрегулины (NRG) и рецепторы NRG составляют систему фактор роста - рецепторная тирозинкиназа для межклеточной передачи сигналов, которая вовлечена в органогенез и развитие клеток в нервной, мышечной, эпителиальной и других тканях (Lemke, Mol. Cell. Neurosci. 7:247-262, 1996 и Burden et al., Neuron 18:847-855, 1997). Семейство NRG состоит из четырех генов, кодирующих многие лиганды включающие подобные эпидермальному фактору роста (EGF), иммуноглобулиновые (Ig) и другие распознаваемые домены. Многие секретируемые и мембраносвязанные изоформы функционируют в качестве лиганда в этой системе передачи сигнала. Рецепторы лигандов NRG все являются представителями семейства рецепторов EGF (EGFR) и включают EGFR (или ErbB1), ErbB2, ErbB3 и ErbB4, у людей также известные под названиями от HER1 до HER4, соответственно (Meyer et al., Development 124:3575-3586, 1997; Orr-Urtreger et al., Proc. Natl. Acad. Sci. USA 90:1867-71, 1993; Marchionni et al., Nature 362:312-8, 1993; Chen et al., J. Comp. Neurol. 349:389-400, 1994; Corfas et al., Neuron 14:103-115, 1995; Meyer et al., Proc. Natl. Acad. Sci. USA 91:1064-1068, 1994; и Pinkas-Kramarski et al., Oncogene 15:2803-2815, 1997).

Четыре гена NRG, NRG-1, NRG-2, NRG-3 и NRG-4, картируются в различных хромосомных локусах (Pinkas-Kramarski et al., Proc. Natl. Acad. Sci. USA 91:9387-91, 1994; Carraway et al., Nature 387:512-516, 1997; Chang et al., Nature 387:509-511, 1997; и Zhang et al., Proc. Natl. Acad. Sci. USA 94:9562-9567, 1997), и в совокупности кодируют разнообразное множество белков NRG. Например, продукты гена NRG-1, включают группу приблизительно из 15 различных структурно родственных изоформ (Lemke, Mol. Cell. Neurosci. 7:247-262, 1996 и Peles and Yarden, BioEssays 15:815-824, 1993). Первые идентифицированные изоформы NRG-1 включали фактор дифференцировки Neu (NDF; Peles et al., Cell 69, 205-216, 1992 и Wen et al., Cell 69, 559-572, 1992), херегулин (HRG; Holmes et al., Science 256:1205-1210, 1992), индуктор активности рецептора ацетилхолина (ARIA; Falls et al., Cell 72:801-815, 1993) и факторы роста глии GGF1, GGF2, и GGF3 (Marchionni et al. Nature 362:312-8, 1993).

Ген NRG-2 идентифицирован посредством клонирования по гомологии (Chang et al., Nature 387:509-512, 1997; Carraway et al., Nature 387:512-516, 1997; и Higashiyama et al., J. Biochem. 122:675-680, 1997) и посредством геномных способов (Busfield et al., Mol. Cell. Biol. 17:4007-4014, 1997). кДНК NRG-2, также известны как полученный из нервной ткани и тимуса активатор ErbB-киназ (NTAK; инвентарный номер GenBank AB005060), дивергентный вариант нейрегулина (Don-1) и полученный из мозжечка фактор роста (CDGF; заявка PCT WO 97/09425). Экспериментальные данные демонстрируют, что, по-видимому, клетки, экспрессирующие ErbB4 или комбинацию ErbB2/ErbB4, демонстрируют очень сильный ответ на NRG-2 (Pinkas-Kramarski et al., Mol. Cell. Biol. 18:6090-6101, 1998). Также известно, что продукт гена NRG-3 (Zhang et al., выше) связывает и активирует рецепторы ErbB4 (Hijazi et al., Int. J. Oncol. 13:1061-1067, 1998).

В основной части всех форм NRG присутствует EGF-подобный домен, и он необходим для связывания и активации рецепторов ErbB. Установленные аминокислотные последовательности EGF-подобных доменов, кодируемых тремя генами, приблизительно на 30-40% идентичны (попарные сравнения). Кроме того, в NRG-1 и NRG-2, по-видимому, существуют по меньшей мере две субформы EGF-подобных доменов, которые могут обеспечивать различные виды биологической активности и тканеспецифического действия.

Клеточный ответ на NRG опосредован тирозиновыми киназами рецепторов NRG EGFR, ErbB2, ErbB3 и ErbB4 семейства рецепторов эпидермального фактора роста. Высокоаффинное связывание всех NRG опосредовано преимущественно ErbB3 или ErbB4. Связывание лигандов NRG ведет к димеризации с другими субъединицами ErbB и трансактивации посредством фосфорилирования по специфическим тирозиновым остаткам. В определенных экспериментальных условиях, по-видимому, почти все комбинации рецепторов ErbB могут формировать димеры в ответ на связывание изоформ NRG-1. Однако, по-видимому, ErbB2 является предпочтительным партнером по димеризации, который может играть важную роль в стабилизации комплекса лиганд-рецептор. Сам ErbB2 не связывает лиганд, но должен гетерогенно спариваться с одним из других подтипов рецепторов. ErbB3 обладает тирозинкиназной активностью, но является мишенью для фосфорилирования другими рецепторами. Известно, что экспрессия NRG-1, ErbB2 и ErbB4 необходима для образования трабекул миокарда желудочка в онтогенезе мыши

Нейрегулины стимулируют компенсаторный гипертрофический рост и ингибируют апоптоз миокардиоцитов, подвергаемых физиологическому стрессу. В соответствии с этими наблюдениями введение нейрегулина пригодно для предотвращения, минимизации или обратного развития застойного заболевания сердца, возникающего вследствие таких обуславливающих факторов, как гипертензия, ишемическая болезнь сердца и кардиотоксичность. См., например, патент США номер (USPN) 6635249, который в полном объеме включен в настоящее описание.

Ввиду высокого распространения сердечной недостаточности в общей популяции, продолжает существовать неудовлетворенная необходимость в предотвращении или минимизации прогрессирования этого заболевания, такая как препятствование потери сердечной функции или посредством улучшения сердечной функции.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение включает способ лечения или профилактики сердечной недостаточности у млекопитающего. Способ основан на неожиданном наблюдении того, что терапевтических эффектов пептида, который содержит домен, подобный эпидермальному фактору роста (EGF-подобный), можно достигать посредством режимов дозирования для введения нейрегулина, которые не поддерживают стационарного состояния, таких как посредством введения терапевтически эффективного количества пептида млекопитающему с интервалами введения через или на протяжении 48, 72, 96 или более часов. Таким образом, настоящий способ предусматривает интермиттирующее или прерывистое введение (каждые 48-96 часов или даже с большими интервалами) млекопитающему пептида, содержащего EGF-подобный домен, где EGF-подобный домен кодируется геном нейрегулина, и где введение пептида производят в количестве, эффективном для лечения или предотвращения сердечной недостаточности у млекопитающего. Режимы дозирования для введения нейрегулина, которые не поддерживают стационарных концентраций являются в равной степени эффективными, как и режимы дозирования с более частым введением, но без неудобства, затрат или побочных эффектов, которые могут являться следствием более частого введения. В рамках изобретения термин интермиттирующее или прерывистое введение включает режим дозирования с интервалами по меньшей мере 48 часов, 72 часа, 96 часов, 1 сутки, 2 суток, 3 суток, 4 суток, 5 суток, 6 суток, 7 суток, 8 суток, 9 суток, 10 суток, 11 суток, 12 суток, 13 суток, 14 суток, 1 неделю, 2 недели, 4 недели, 1 месяц, 2 месяца, 3 месяца, 4 месяца или их любые комбинацию или приращение, при условии, что интервал/режим составляет по меньшей мере 48 часов, 72 часов, 96 часов, 1 сутки, 2 суток, 3 суток, 4 суток, 5 суток, 6 суток, 7 суток, 8 суток, 9 суток, 10 суток, 11 суток, 12 суток, 13 суток, 14 суток, 1 неделю, 2 недели, 4 недели, 1 месяц, 2 месяца, 3 месяца, 4 месяца. В рамках изобретения термин интермиттирующее или прерывистое введение включает режим дозирования с интервалами не менее 48 часов, 72 часов, 96 часов, 1 суток, 2 суток, 3 суток, 4 суток, 5 суток, 6 суток, 7 суток, 8 суток, 9 суток, 10 суток, 11 суток, 12 суток, 13 суток, 14 суток, 1 недели, 2 недель, 4 недель, 1 месяца, 2 месяцев, 3 месяцев, 4 месяцев или их любые комбинацию или приращение, при условии, что интервал/режим составляют не менее 48 часов, 72 часов, 96 часов, 1 суток, 2 суток, 3 суток, 4 суток, 5 суток, 6 суток, 7 суток, 8 суток, 9 суток, 10 суток, 11 суток, 12 суток, 13 суток, 14 суток, 1 недели, 2 недель, 4 недель, 1 месяца, 2 месяцев, 3 месяцев, 4 месяцев.

В соответствии с настоящим изобретением, интермиттирующее или прерывистое введение млекопитающему пептида, содержащего EGF-подобный домен, где EGF-подобный домен кодируется геном нейрегулина, направлено на достижение схемы дозирования, где не поддерживаются стационарные концентрации вводимого пептида в узком диапазоне, таким образом, уменьшая вероятность того, что у млекопитающего разовьются неблагоприятные побочные эффекты, которые могут являться следствием поддержания уровней вводимого пептида выше физиологических в течение длительного срока. Например, побочные эффекты, ассоциированные с уровнями экзогенно вводимого NRG выше физиологических, включают гиперплазию оболочек нервов, гиперплазию молочных желез, почечную нефропатию, гипоспермию, повышение уровня печеночных ферментов, изменения сердечных клапанов и кожные изменения в участке инъекции.

В предпочтительном варианте осуществления настоящее изобретение относится к интермиттирующему режиму дозирования, который вызывает или допускает колебания сывороточных уровней пептида, содержащего EGF-подобный домен, кодируемого геном нейрегулина, и, таким образом, уменьшает возможность неблагоприятных побочных эффектов, ассоциированных с более частым введением пептида. Таким образом, интермиттирующий режим дозирования по настоящему изобретению обеспечивает млекопитающему терапевтический эффект, но не поддерживает стационарных терапевтических уровней пептида, содержащего EGF-подобный домен, кодируемый геном нейрегулина. Как понимают специалисты в данной области, существуют различные варианты осуществления изобретения для осуществления интермиттирующего дозирования; преимущества этих вариантов осуществления можно указывать различными способами, например, указанное введение не поддерживает стационарных терапевтических уровней указанного пептида, введение уменьшает возможность вредных побочных эффектов, ассоциированных с более частым введением пептида NRG, и т.п.

В конкретных вариантах осуществления изобретения, нейрегулин может представлять собой ген, продукт гена или его соответствующую подпоследовательность или фрагмент, содержащие, по существу состоящие или состоящие из: NRG-1, NRG-2, NRG-3 или NRG-4. В предпочтительном варианте осуществления подпоследовательность или фрагмент NRG по изобретению содержит домен, подобный эпидермальному фактору роста (EGF-подобный) или его гомолог. Как понимают специалисты в данной области, пептид, гомологичный пептиду EGF-подобного домена определяют посредством поиска структурной гомологии или посредством гомологичного пептида, действующего как действует EGF-подобный пептид в функциональных анализах, например, связывая и активируя рецепторы ErbB. Предпочтительно длина фрагмента составляет по меньшей мере 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 аминокислот. Пептид нейрегулина по изобретению в свою очередь может быть кодирован любым из этих генов нейрегулинов (или их подпоследовательностью). В более конкретном варианте осуществления пептид, используемый в способе, представляет собой рекомбинантный GGF2 человека или его фрагмент или подпоследовательность. Относительно последовательностей аминокислот и нуклеиновой кислоты полноразмерного GGF2 человека см. фигуры 8A-8D.

В одном из аспектов изобретения подходящие млекопитающие включают в качестве неограничивающих примеров мышей, крыс, кроликов, собак, обезьян или свиней. В одном из вариантов осуществления изобретения млекопитающее представляет собой человека.

В других вариантах осуществления изобретения сердечная недостаточность может являться следствием гипертензии, ишемической болезни сердца, воздействия кардиотоксического соединения (например, кокаина, спирта, антитела к ErbB2 или антитела к HER, такого как герцептин®, или антрациклинового антибиотика, такого как доксорубицин или дауномицин), миокардита, заболевания щитовидной железы, вирусной инфекции, гингивита, наркомании, алкоголизма, перикардита, атеросклероза, заболевания сосудов, гипертонической кардиомиопатии, острого инфаркта миокарда или предшествующего инфаркта миокарда, систолической дисфункции левого желудочка, операции коронарного шунтирования, голодания, воздействия радиации, нарушений питания или генетического дефекта.

В другом варианте осуществления изобретения, антитело к ErbB2 или к HER2, такое как герцептин®, вводят млекопитающему до, в течение или после введения антрациклина.

В других вариантах осуществления изобретения пептид вводят до воздействия кардиотоксического соединения, в течение воздействие указанного кардиотоксического соединения или после воздействия указанного кардиотоксического соединения; пептид вводят до или после диагностики застойной сердечной недостаточности у указанного млекопитающего. Способ по изобретению можно применять после того, как у указанного млекопитающего произошла компенсаторная гипертрофия сердца; способ по изобретению включает то, что исходом способа является сохранение гипертрофии левого желудочка или предотвращение прогрессирования истончения миокарда или ингибирование апоптоза кардиомиоцитов. В способе по изобретению пептид может содержать EGF-подобный домен, кодируемый геном нейрегулина, по существу состоять или состоять из него. Пептид по изобретению вводят до, в течение или после воздействия кардиотоксического соединения. В другом варианте осуществления пептид, содержащий EGF-подобный домен, вводят в течение двух или всех трех из этих периодов. В соответствии с настоящим изобретением пептид, содержащий EGF-подобный домен, кодируемый геном нейрегулина, вводят с интервалами каждые 48-96 часов. В одном из вариантов осуществления настоящего изобретения пептид, содержащий EGF-подобный домен, кодируемый геном нейрегулина представляет собой GGF2. В других вариантах осуществления изобретения пептид вводят до или после диагностики у млекопитающего застойной сердечной недостаточности. В еще одном варианте осуществления изобретения пептид вводят млекопитающему, у которого наблюдается компенсаторная гипертрофия сердца. В других конкретных вариантах осуществления изобретения введение пептида сохраняет гипертрофию левого желудочка, предотвращает прогрессирование истончения миокарда и/или ингибирует апоптоз кардиомиоцитов.

Варианты осуществления изобретения включают следующее: способ лечения сердечной недостаточности у млекопитающего, где указанный способ включает введение экзогенного пептида, содержащего домен, подобный эпидермальному фактору роста (EGF-подобный), указанному млекопитающему, где указанное введение с указанными интервалами уменьшает неблагоприятные побочные эффекты, ассоциированные с введением указанного экзогенного пептида указанному млекопитающему. Способ лечения сердечной недостаточности у млекопитающего, где указанный способ включает введение экзогенного пептида, содержащего домен, подобный эпидермальному фактору роста (EGF-подобный), указанному млекопитающему, где указанный EGF-подобный домен кодируется геном нейрегулина (NRG)-1 и указанный экзогенный пептид вводят указанному млекопитающему в терапевтически эффективном для лечения сердечной недостаточности количестве с интервалами по меньшей мере 48 часов, где указанное введение с указанными интервалами не поддерживает стационарных уровней указанного экзогенного пептида у указанного млекопитающего. Способ лечения сердечной недостаточности у млекопитающего, где указанный способ включает указанному млекопитающему введение экзогенного пептида, содержащего домен, подобный эпидермальному фактору роста (EGF-подобный), или его гомолог, и указанный экзогенный пептид вводят указанному млекопитающему в терапевтически эффективном для лечения сердечной недостаточности количестве с интервалами по меньшей мере или не менее чем 48 часов, где указанное введение с указанными интервалами допускает отклонения сывороточных концентраций указанного экзогенного пептида у указанного млекопитающего между дозами до фонового уровня или до уровней перед введением.

В рамках изобретения термин «неблагоприятный» или «вредный побочный эффект» относится к непредусмотренному и нежелательному следствию медицинского лечения. В отношении настоящего изобретения неблагоприятный или вредный побочный эффект, являющийся следствием введения экзогенного пептида, может включать одно или несколько из следующего: гиперплазия оболочки нерва, гиперплазия молочной железы, почечная нефропатия и кожные изменения в участке инъекции.

В рамках изобретения термин "отклонения сывороточных концентраций указанного экзогенного пептида у указанного млекопитающего между дозами до уровней перед введением" относится к различию между уровнями сывороточных концентраций до введения дозы экзогенного пептида.

В рамках изобретения термин "стационарные уровни" относится к уровню(ям) экзогенного средства (например, пептида), которого достаточно для достижения равновесия (в пределах диапазона колебаний между последующими дозами) между введением и выведением. "Поддержание стационарных терапевтических уровней" относится к поддержанию концентрации экзогенного средства на уровне, достаточном для обеспечения терапевтического эффекта у индивидуума или пациента.

КРАТКОЕ ОПИСАНИЕ РИСУНКОВ

На фигуре 1 представлена гистограмма, на которой представлена сердечная функция, иллюстрируемая изменениями во фракции выброса и фракции укорочения. Как указано, крысы обрабатывали GGF2 при 0,625 мг/кг или эквимолярным количеством EGF-подобного фрагмента (фрагмент; EGF-id) внутривенно (в/в) ежедневно (раз в сутки).

На фигуре 2 представлена линейная диаграмма, на которой представлена сердечная функция, выявляемая по изменениям во фракции выброса и фракции укорочения. Как указано, крыс обрабатывали GGF2 при 0,625 мг/кг или 3,25 мг/кг в/в раз в сутки.

На фигуре 3 представлена линейная диаграмма, на которой представлена сердечная функция, выявляемая по значительному улучшению конечного систолического объема в течение периода обработки. Как указано, крыс обрабатывали GGF2 при 0,625 мг/кг или 3,25 мг/кг в/в раз в сутки.

На фигуре 4 представлена линейная диаграмма, на которой представлена сердечная функция, выявляемая по изменениям во фракции выброса и фракции укорочения. Как указано, крыс обрабатывали GGF2 3,25 мг/кг внутривенно (в/в) раз в 24, 48 или 96 часов.

На фигуре 5 представлена линейная диаграмма, на которой представлена сердечная функция, выявляемая по изменениям электрокардиографической фракции выброса. Как указано, крыс обрабатывали носителем или 3,25 мг/кг GGF2 внутривенно (в/в), с BSA или без него.

На фигуре 6 линейная диаграмма, на которой представлен период полувыведения рекомбинантного GGF2 человека (rhGGF2) после в/в введения.

На фигуре 7 линейная диаграмма, на которой представлен период полувыведение рекомбинантного GGF2 человека (rhGGF2) после подкожного введения.

На фигурах 8A-D представлены последовательности нуклеиновой кислоты и аминокислот полноразмерного GGF2. Последовательность нуклеиновой кислоты обозначена SEQ ID NO: 1, а аминокислотная последовательность обозначена SEQ ID NO: 2.

На фигуре 9 представлены последовательности нуклеиновой кислоты и аминокислот подобного эпидермальному фактору роста (EGFL) домена 1. Последовательность нуклеиновой кислоты EGFL домена 1 в настоящем описании обозначена SEQ ID NO: 3, а аминокислотная последовательность EGFL домена 1 в настоящем описании обозначена SEQ ID NO: 4.

На фигуре 10 представлены последовательности нуклеиновой кислоты и аминокислот подобного эпидермальному фактору роста (EGFL) домена 2. Последовательность нуклеиновой кислоты EGFL домена 2 в настоящем описании обозначена SEQ ID NO: 5, а аминокислотная последовательность EGFL домена 2 в настоящем описании обозначена SEQ ID NO: 6.

На фигуре 11 представлены последовательности нуклеиновой кислоты и аминокислот подобного эпидермальному фактору роста (EGFL) домена 3. Последовательность нуклеиновой кислоты EGFL домена 3 в настоящем описании обозначена SEQ ID NO: 7, а аминокислотная последовательность EGFL домена 3 в настоящем описании обозначена SEQ ID NO: 8.

На фигуре 12 представлены последовательности нуклеиновой кислоты и аминокислот подобного эпидермальному фактору роста (EGFL) домена 4. Последовательность нуклеиновой кислоты EGFL домена 4 в настоящем описании обозначена SEQ ID NO: 9, а аминокислотная последовательность EGFL домена 4 в настоящем описании обозначена SEQ ID NO: 10.

На фигуре 13 представлены последовательности нуклеиновой кислоты и аминокислот подобного эпидермальному фактору роста (EGFL) домена 5. Последовательность нуклеиновой кислоты EGFL домена 5 в настоящем описании обозначена SEQ ID NO: 11, а аминокислотная последовательность EGFL домена 5 в настоящем описании обозначена SEQ ID NO: 12.

На фигуре 14 представлены последовательности нуклеиновой кислоты и аминокислот подобного эпидермальному фактору роста (EGFL) домена 6. Последовательность нуклеиновой кислоты EGFL домена 6 в настоящем описании обозначена SEQ ID NO: 13, а аминокислотная последовательность EGFL домена 6 в настоящем описании обозначена SEQ ID NO: 14.

На фигуре 15 представлена аминокислотная последовательность полипептида, содержащего подобный эпидермальному фактору роста (EGFL) домен, которая в настоящем описании обозначена SEQ ID NO: 21.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Авторы настоящего изобретения сделали неожиданное открытие, что прерывистое или интермиттирующее введение нейрегулина с соответствующим образом расположенными временными интервалами обеспечивает терапевтически эффективное количество нейрегулина пациенту и такая схема лечения пригодна для предотвращения, профилактики, улучшения, минимизации, лечения или обратного развития заболевания сердца, такого как застойная сердечная недостаточность.

Несмотря на общепринятую точку зрения и практику разработки в отношении составления режимов дозирования с поддержанием наиболее узкого диапазона стационарных концентраций, авторы настоящего изобретения в настоящем описании демонстрируют, что режимы дозирования для введение нейрегулина, которые не поддерживают стационарные концентрации в узком диапазоне, являются в равной степени эффективными, как и режимы дозирования с более частым введением. Кроме того, авторы настоящего изобретения продемонстрировали, что обработка индивидуума с сердечной недостаточностью нейрегулином с интервалами дозирования по меньшей мере 48 часов, 72 часа, 96 часов, 1 сутки, 2 суток, 3 суток, 4 суток, 5 суток, 6 суток, 7 суток, 8 суток, 9 суток, 10 суток, 11 суток, 12 суток, 13 суток, 14 суток, 1 неделя, 2 недели, 4 недели, 1 месяц, 2 месяца, 3 месяца, 4 месяца или их любая комбинация или приращение, при условии, что интервал/режим составляет по меньшей мере 48 часов, являются такими же эффективными, как и ежедневное дозирование.

Для оценки фармакокинетики экзогенного NRG, авторы настоящего изобретения показали, что период полувыведения нейрегулина при внутривенном введении составляет от 4 до 8 часов, а при подкожном введении составляет 11-15 часов. См., например, таблицы 1 и 2 и фигуры 6 и 7. Таким образом, дозирование при режимах не чаще чем каждые четвертые сутки не может поддерживать никаких детектируемых уровней в течение по меньшей мере трех суток между дозами. На основе этих результатов до настоящего изобретения нельзя было предсказать, что такие соотношения пиков/спадов будут коррелировать со стойким терапевтическим эффектом. Заслуживает внимания, что соединения с периодом полувыведения такого порядка, как правило, вводят в соответствии с частым режимом дозирования (например, ежедневные или многократные суточные дозы). Кроме того, на основе фармакокинетических данных доступных для GGF2 в соответствии с традиционными разработками можно предположить, что оптимальная обработка могла включать ежедневное подкожное дозирование.

В соответствии с общепринятой точкой зрения и практикой разработки другие медицинские лекарственные средства при CHF, как правило, вводят по меньшей мере на ежедневной основе. Полагают, что периодичность такого дозирования необходима потому, что CHF представляет собой хроническое состояние, как правило, вызываемое нарушенным сокращением и/или расслаблением сердца, а не острое состояние. У индивидуумов со слабым сердцем, приводящим к нарушенному расслаблению и CHF, медицинские лекарственные средства включают лекарственные средства, блокирующие образование или действие специфических нейрогормонов (например, ингибиторы ангиотензинпревращающего фермента (ингибиторы ACE), антагонисты рецепторов ангиотензина (ARB), антагонисты альдостерона и блокаторы бета-адренергических рецепторов). Эти и другие лекарственные средства в настоящее время представляют собой стандарт при лечении хронической CHF, так как показано, что они приводят к улучшенным симптомам, ожидаемой продолжительности жизни и/или к уменьшению числа госпитализаций. В условиях острых приступов или хронических симптомов пациентов часто лечат инотропными средствами (например, добутамин, дигоксин) для улучшения сердечной сократимости вместе с сосудорасширяющими средствами (например, нитраты, несиритид) и/или диуретиками (например, фуросемид) для уменьшения застоя. Пациентов с гипертензией и застойной сердечной недостаточностью лечат одним или несколькими антигипертензивными средствами, такими как бета-блокаторы, ингибиторы ACE и ARB, нитраты (динитрат изосорбида), гидралазин и блокаторы кальциевых каналов.

Таким образом, несмотря на обычную практику относительно лечения CHF, авторы настоящего изобретения продемонстрировали, что новый режим дозирования приводит к эффективному лечению CHF, при этом избегая нежелательных побочных эффектов. Не желая связываться с теорией, вероятно, что такое лечение нейрегулином усиливает насосную функцию сердца, стимулируя гипертрофию кардиомиоцитов и частично или полностью ингибируя дальнейшее разрушение сердца, подавляя апоптоз кардиомиоцитов.

В качестве дополнительной информации, основным принципом дозирования является определение эффективной циркулирующей концентрации и разработка режима дозирования для поддержания этих уровней. Для прогноза режима дозирования, который будет поддерживать стационарный уровень конкретного лекарственного средства, комбинируют Фармакокинетические (PK) и фармакодинамические (PD) исследования. Типичным планом является минимизация различия между Cмакс и Cмин и, таким образом, снижение побочных эффектов.

Лекарственные средства описывают по их "терапевтическому индексу" который представляет собой отношение токсической дозы или циркулирующих уровней к эффективной дозе или циркулирующим концентрациям. Когда терапевтический индекс является большим, существует широкий безопасный диапазон, в котором можно вводить эффективную дозу без приближения к токсическим уровням. Когда неблагоприятные эффекты происходят при концентрациях, очень близких к эффективным концентрациям, терапевтический индекс определяют как узкий, и лекарственное средство трудно вводить безопасно.

При разработке режимов дозирования PK/PD данные комбинируют с информацией о терапевтическом индексе для планирования дозы и частоты введения так, что соединение поддерживается у пациента (например, человека) при такой концентрации, которая выше эффективной концентрации и ниже токсической концентрации. Если эффективную концентрацию лекарственного средства нельзя поддерживать без индукции небезопасных эффектов, от лекарственного средства в течение разработки отказываются. Дополнительные замечания, относящиеся к разработке лекарственных средств можно найти в ряде источников, включая: Pharmacokinetics in Drug Development: Clinical Study Design and Analysis (2004, Peter Bonate and Danny Howard, eds.), который в полном объеме включен в настоящее описание.

Нейрегулины представляют собой факторы роста, родственные эпидермальным факторам роста, которые связываются с рецепторами erbB. Во многих моделях сердечной недостаточности, кардиотоксичности и ишемии показано, что они улучшают сердечную функцию. Также показано, что они защищают нервную систему в моделях инсульта, повреждения спинного мозга, воздействия нервно-паралитическое отравляющего вещества, повреждения периферических нервов и химической токсичности.

Однако показано, что поддержание избыточных уровней экзогенно вводимых нейрегулинов обладает неблагоприятными эффектами, включая гиперплазию оболочки нерва, гиперплазию молочной железы и почечную нефропатию. Эти эффекты наблюдали при ежедневном подкожном введении нейрегулина. См., например, таблицу 10.

Как указано в настоящем описании, подкожное введение исследовали вследствие более длительного периода полувыведения по сравнению с внутривенным введением и исходного убеждения, что поддержание постоянных уровней лиганда может быть полезным. Разработка режимов дозирования для уменьшения этих эффектов могла бы значительно увеличить возможность использования нейрегулинов в качестве лекарственных средств и именно к этому относится настоящее изобретение. Демонстрация того, что менее частое дозирование, при котором не сохраняются постоянные уровни, также является эффективным, обеспечила эту разработку.

Нейрегулины: Как указано выше, пептиды, кодируемые генами NRG-1, NRG-2, NRG-3 и NRG-4, содержат EGF-подобные домены, которые позволяют им связывать и активировать рецепторы ErbB. Holmes et al. (Science 256:1205-1210, 1992) показали, что для связывания и активации рецептора p185erbB2 достаточно одного EGF-подобного домена. Таким образом, для предотвращения или лечения застойной сердечной недостаточности в способах по изобретению можно использовать любой пептидный продукт, кодируемый геном NRG-1, NRG-2 или NRG-3, или любой подобный нейрегулинам пептид, например, пептид с EGF-подобным доменом, кодируемый геном или кДНК нейрегулина (например, EGF-подобный домен, содержащий субдомены пептида NRG-1 C-C/D или C-C/D', как описано в USPN 5530109, USPN 5716930 и USPN 7037888; или EGF-подобный домен, как описано в WO 97/09425). Содержание каждого из USPN 5530109; USPN 5716930; USPN 7037888 и WO 97/09425 в полном объеме включено в настоящее описание.

Факторы риска: факторы риска, увеличивающие вероятность развития застойной сердечной недостаточности у индивидуума хорошо известны. Они включают, но не ограничены ими, курение, ожирение, высокое артериальное давление, ишемическую болезнь сердца, заболевание сосудов, операцию коронарного шунтирования, инфаркт миокарда, систолическую дисфункцию левого желудочка, воздействие кардиотоксических соединений (спирт, лекарственные средства, такие как кокаин и антрациклиновые антибиотики, такие как доксорубицин и даунорубицин), вирусная инфекция, перикардит, миокардит, гингивит, заболевание щитовидной железы, воздействие радиации, генетические дефекты, для которых известно, что они увеличивают риск сердечной недостаточности (такие как дефекты, описанные в Bachinski and Roberts, Cardiol. Clin. 16:603-610, 1998; Siu et al., Circulation 8:1022-1026, 1999; и Arbustini et al., Heart 80:548-558, 1998), голодание, нарушения питания, такие как анорексия и булимия, сердечная недостаточность в семейном анамнезе и гипертрофия миокарда.

В соответствии с настоящим изобретением нейрегулины можно вводить интермиттирующим способом для достижения профилактики, такой как предотвращение или снижение скорости прогрессирования застойного заболевания сердца у индивидуумов, у которых выявлен риск заболевания. Например, введение нейрегулина пациенту с ранней компенсаторной гипертрофией обеспечивает поддержание состояния гипертрофии и предотвращает прогрессирование до сердечной недостаточности. Кроме того, индивидуумам, у которых идентифицирован риск заболевания, можно проводить кардиопротективную обработку нейрегулином до развития компенсаторной гипертрофии.

Введение нейрегулина пациентам со злокачественной опухолью до или в течение химиотерапии антрациклином или комбинированного лечения антрациклином/антителом к ErbB2 (антителом к HER2) (например, герцептином®) может предотвратить вхождение кардиомиоцитов пациента в апоптоз, таким образом, сохраняя сердечную функцию. Пациенты, которые уже страдают потерей кардиомиоцитов, также получают пользу от лечения нейрегулином, так как остающаяся миокардиальная ткань отвечает на воздействие нейрегулином, демонстрируя гипертрофический рост и увеличенную сократимость.

Лечение: нейрегулины и пептиды, содержащие EGF-подобные домены, кодируемые генами нейрегулинов, можно вводить пациентам или экспериментальным животным с фармацевтически приемлемым разбавителем, носителем или эксципиентом. Композиции по изобретению можно предоставлять в стандартной лекарственной форме.

Для предоставления подходящих составов или композиций и для введения таких композиций пациентам или экспериментальным животным используют обычную фармацевтическую практику. Хотя предпочтительным является внутривенное введение, можно использовать любой подходящий способ, например, парентеральное, подкожное, внутримышечное, чрескожное, внутрисердечное, интраперитонеальное, интраназальное, аэрозольное, пероральное или топическое (например, посредством прикладывания лейкопластыря, содержащего состав, способный проходить слой дермы и входить в кровоток) введение.

Терапевтические составы могут находиться в форме жидких растворов или суспензий; для перорального введения составы могут находиться в форме таблеток или капсул; а для интраназальных составов - в форме порошков, назальных капель или аэрозолей.

Способы, хорошо известные в данной области для получения составов, можно найти, например, в "Remington's Pharmaceutical Sciences". Составы для парентерального введения, например, могут содержать эксципиенты, стерильную воду или физиологический раствор, полиалкиленовые гликоли, такие как полиэтиленгликоль, масла растительного происхождения или гидрогенизированные нафталины. Другие потенциально пригодные системы парентеральной доставки для введения молекул по изобретению включают частицы из сополимера этилена-винилацетата, осмотические насосы, имплантируемые инфузионные системы и липосомы. Составы для ингаляции могут содержать эксципиенты, например, лактозу, или могут представлять собой водные растворы, содержащие, например, простой полиоксиэтилен-9-лауриловый эфир, гликохолат и дезоксихолат, или могут представлять собой масляные растворы для введения в форме назальных капель или в виде геля.

В дополнительном аспекте изобретение относится к соединениям по настоящему изобретению для применения в качестве фармацевтических средств, особенно для лечения или предотвращения указанных выше состояний и заболеваний. Также изобретение относится к применению соединений по настоящему изобретению для получения лекарственного средства для лечения или предотвращения одного из указанных выше состояний и заболеваний.

Относительно внутривенных инъекций уровни доз находятся в диапазоне приблизительно от 0,001 мг/кг, 0,01 мг/кг до по меньшей мере 10 мг/кг с регулярными временными интервалами по меньшей мере приблизительно от каждых 24, 36, 48 часов до приблизительно каждых 96 часов и в частности каждые 48, 72 или 96 часов или более, как указано в настоящем описании. В конкретном варианте осуществления уровни внутривенных инъекционных доз находятся в диапазоне приблизительно от 0,1 мг/кг до приблизительно 10 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов и, в частности, каждые 48, 72 или 96 часов или более, как указано в настоящем описании. В другом конкретном варианте осуществления уровни внутривенных инъекционных доз находятся в диапазоне приблизительно от 1 мг/кг до приблизительно 10 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов и, в частности, каждые 48, 72 или 96 часов или более, как указано в настоящем описании. В еще одном конкретном варианте осуществления уровни внутривенных инъекционных доз находятся в диапазоне приблизительно от 0,01 мг/кг до приблизительно 1 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов и, в частности, каждые 48, 72 или 96 часов или более, как указано в настоящем описании. В еще одном конкретном варианте осуществления уровни внутривенных инъекционных доз находятся в диапазоне приблизительно от 0,1 мг/кг до приблизительно 1 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов и, в частности, каждые 48, 72 или 96 часов или более, как указано в настоящем описании.

Относительно подкожных инъекций уровни доз находятся в диапазоне приблизительно от 0,01 мг/кг до по меньшей мере 10 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов и, в частности, каждые 48, 72 или 96 часов или более, как указано в настоящем описании. В конкретном варианте осуществления уровни инъекционных доз находятся в диапазоне приблизительно от 0,1 мг/кг до приблизительно 10 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов или более, как указано в настоящем описании, и, в частности, каждые 48, 72 или 96 часов. В другом конкретном варианте осуществления уровни инъекционных доз находятся в диапазоне приблизительно от 1 мг/кг до приблизительно 10 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов или более, как указано в настоящем описании, и, в частности, каждые 48, 72 или 96 часов. В еще одном конкретном варианте осуществления уровни инъекционных доз находятся в диапазоне приблизительно от 0,01 мг/кг до приблизительно 1 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов или более, как указано в настоящем описании, и, в частности, каждые 48, 72 или 96 часов. В еще одном конкретном варианте осуществления уровни инъекционных доз находятся в диапазоне приблизительно от 0,1 мг/кг до приблизительно 1 мг/кг с регулярными временными интервалами приблизительно от каждых 48 часов до приблизительно каждых 96 часов или более, как указано в настоящем описании, и, в частности, каждые 48, 72 или 96 часов.

Трансдермальные дозы, как правило, выбирают для обеспечения сходных или меньших уровней в крови, которые достигают с использованием инъекционных доз.

Соединения по изобретению можно вводить как единственное активное средство или их можно вводить в комбинации с другими средствами, включая другие соединения, демонстрирующими такую же или сходную терапевтическую активность и которые определены как безопасные и эффективные для такого комбинированного введения. Другие такие соединения, используемые для лечения CHF включают натрийуретический пептид головного мозга (BNP), лекарственные средства, блокирующие формирование или действие специфических нейрогормонов (например, ингибиторы ангиотензинпревращающего фермента (ингибиторы ACE), антагонисты рецепторов ангиотензина (ARB), антагонисты альдостерона и блокаторы бета-адренергических рецепторов), инотропные средства (например, добутамин, дигоксин) для улучшения сердечной сократимости, сосудорасширяющие средства (например, нитраты, несиритид) и/или диуретики (например, фуросемид) для уменьшения застоя, и одно или несколько антигипертензивных средств, таких как бета-блокаторы, ингибиторы ACE и ARB, нитраты (динитрат изосорбида), гидралазин и блокаторы кальциевых каналов.

Как указано выше, медицинское вмешательство, включающее лечение лекарственным средством требует выбора подходящего лекарственного средства и его доставки с соответствующим режимом дозирования. Соответствующий режим дозирования включает достаточную дозу, путь, частоту и длительность лечения. Основной задачей лечения лекарственным средством является достижение оптимальных концентраций лекарственных средств в участке действия так, чтобы обеспечить у проходящего лечение пациента преодоление патологического процесса, для которого необходимо лечение. В общем, базовые знания основ фармакокинетики лекарственных средств облегчают выбор соответствующих режимов дозирования. Однако для помощи лечащему врачу в определении эффективных и безопасных режимов дозирования выбранных лекарственных средств для медицинского лечения конкретных пациентов в данном контексте в качестве дополнительного средства можно использовать мониторинг терапевтического лекарственного средства (TDM).

Конечная концентрация и терапевтическое окно: определение оптимальной концентрации лекарственного средства варьирует в зависимости от фармакодинамических свойств конкретного лекарственного средства. Например, оптимальная терапия для зависимых от времени антибиотиков, подобных пенициллину, зависит от достижения отношений пиковых концентраций к MIC (минимальная ингибирующая концентрация) 2-4 и времени выше MIC, равному 75% от интервала дозирования. Для зависимых от концентрации антибиотиков, подобных, например, гентамицину, эффективность зависит от достижения отношений пиковых концентраций к MIC приблизительно 8-10. Вне зависимости от нюансов, связанных с введением конкретного лекарственного средства, лечение лекарственным средством преследует целью достижение конечных концентраций в плазме (которые часто отражают концентрации в участке действия) в пределах "терапевтического окна", которое предварительно определяли на основе фармакокинетического, фармакодинамического и токсического профилей лекарственного средства у видов-мишеней. Ширина этого окна для различных лекарственных средств и видов варьирует. Когда различие между минимальной эффективной концентрацией и минимальной токсической концентрацией мала (от 2 до 4 раз), терапевтическое окно обозначают как узкое. В отличие от этого, когда существует большое различие между эффективной и токсической концентрациями, лекарственное средство рассматривают, как имеющее широкое терапевтическое окно. Примером лекарственного средства с узким терапевтическим окном является дигоксин, у которого различие между средней и токсической концентрациями составляет 2 или 3 раза. С другой стороны амоксициллин имеет широкий терапевтический диапазон и передозировка у пациента, как правило, не связана с проблемами токсичности.

Вариабельность ответной реакции на лекарственные средства: указанная вариабельность у здоровых лиц одного и того же вида в отношении ответной реакции на лекарственное средство является обычной. Кроме того, болезненные состояния имеют способность воздействовать на системы и функции органов (например, почки, печени, содержание воды), которые в свою очередь могут воздействовать на ответную реакцию на лекарственное средство. Это в свою очередь способствует увеличенному различию в ответной реакции на лекарственное средство у больных индивидуумов, которым вводят лекарственное средство. Еще одна значимая проблема связана с введением более одного лекарственного средства за один раз, что приводит к фармакокинетическим взаимодействиям, которые могут приводить к изменениям ответной реакции на одно или оба лекарственные средства. Таким образом, физиологические (например, возраст), патологические (например, действие заболевания) и фармакологические (например, взаимодействие лекарственных средств) факторы могут изменять фармакокинетику лекарственных средств у животных. Увеличенная вариабельность у индивидуумов, являющаяся следствием этого, может приводить к неудаче лечения или токсичности у лекарственных средств с узким терапевтическим индексом.

Группа пациентов, которые могут извлечь пользу из режима лечения по настоящему изобретению, в достаточной степени различна, например, хорошими кандидатами являются пациенты с нарушенной функцией почек, так как продолжительные уровни белковых лекарственных средств часто ассоциированы с отложениями в клубочках почек. Таким образом, польза режима лечения, при котором не поддерживаются постоянные уровни в плазме, как описано в настоящем изобретении, у пациентов с поврежденной функцией почек, у которых любое уменьшение существующей функции может быть вредным, может быть очень существенной. Аналогично, короткое и интермиттирующее воздействие терапевтического средства, такого как GGF2, как описано в настоящем описании, может являться полезным у пациентов с типами опухолей, которые отвечают на постоянную и длительную стимуляцию фактором роста. Другими пациентами, которые могут извлечь конкретную пользу из интермиттирующего лечения, как описано в настоящем описании, являются пациенты со шванномами и другими периферическими нейропатиями. Преимуществом настоящего изобретения является то, что интермиттирующее дозирование может иметь значительные преимущества с отсутствием поддержания непрерывного связанного с побочными эффектами стимулирование различных тканей.

Подходящее расписание получения образцов крови с целью определения сывороточного уровня лекарственного средства, а также интерпретация полученного уровня требуют учета фармакокинетических свойств измеряемого лекарственного средства. В следующих абзацах определены термины, используемые в обсуждении этих свойств.

Период полувыведения: время, необходимое для снижения сывороточной концентрации, присутствующий в начале интервала, на 50%. Знание приблизительного времени полувыведения важно для практикующего врача, так как оно определяет оптимальный режим дозирования пероральными средствами, колебания сывороточной концентрации между дозами и время, необходимое для достижения стационарного состояния.

В кратком изложении, для GGF2 проведено несколько фармакокинетических исследований. Типичные периоды полувыведения GGF2 составляли от 4 до 8 часов для внутривенного (в/в) пути, тогда как период полувыведения подкожно (п/к) вводимого GGF2 составлял от 11 до 15 часов. Cмакс, AUC, Tмакс и T1/2 представлены в таблицах 1 и 2 ниже. Когда период полувыведения являлся слишком длительным для точного определения этими способами, вместо времени поставлен прочерк.

Таблица 1
Средние фармакокинетические параметры обеспечиваемой 125I-rhGGF2 радиоактивности в плазме крыс Mab Sprague-Dawley после однократной внутривенной или подкожной дозы 125I-rhGGF2
Группа 1 (n=2) Группа 2 (n=1)
Параметры Общая Осажд. TCA Общая Осажд. TCA
C макс (мкг экв/г) 0,3289 0,2953 0,0157 0,01
AUC 0-t (мкг экв-час/г) 1,27 0,01 0,27 0,17
AUC беск (мкг экв-час/г) 1,37 0,96 0,39 0,26
T макс (час) 0,08 0,08 6,0 6,0
Период полувыведения 6,37 6,11 13,20 14,66
Группа 1 - в/в Группа 2 - п/к
Таблица 2
Средние фармакокинетические параметры обеспечиваемой 125I-rhGGF2 радиоактивности в плазме крыс Mab Sprague-Dawley после однократной внутривенной или подкожной дозы 125I-rhGGF2
Группа 1 (n=2) Группа 2 (n=1)
Параметры Общая Осажд. TCA Общая Осажд. TCA
C макс (мкг экв/г) 0,2611 0,2291 0,0197 0,0034
AUC 0-t (мкг экв-час/г) 1,489 0,567 0,335 0,064
AUC беск (мкг экв-час/г) 1,667 0,62 - -
T макс (час) 0,89 0,08 12,0 12,0
Период полувыведения 7,75 7,96 - -
Группа 1 - в/в Группа 2 - п/к

Плазматические концентрации после введения представлены на фигурах 6 и 7 для в/в и п/к введения, соответственно. Как показано на фигурах 6 и 7, Cмакс, означает максимальную плазматическую концентрацию (максимальная концентрация, которую измеряют в плазме в любое время после введения); AUCбеск означает площадь под кривой зависимости концентрации от времени до бесконечности (где этот способ применяют для определения того, что анализ имеет пределы детекции); AUC0-t означает площадь под кривой плазматической концентрации (кривая зависимости от времени от момента времени ноль до последней измеряемой концентрации); AUC по любому способу означает оценку общего воздействия на животного; и Tмакс означает среднее время максимальной плазматической концентрации.

Как видно из таблиц и фигур, поддерживать стационарные терапевтические уровни любым из путей дозирования с дозированием каждые сутки, через сутки или каждые четвертые сутки невозможно. Через сутки и даже задолго до этого уровни становятся неизмеримыми, что отражено данными, приведенными в таблице 11.

Таблица 11
Фармакокинетические параметры для GGF2 после внутривенного введения*
Крысы
Доза (мг/кг) AUC0-∞ (час·нг/мл) AUC0-∞/Доза ((час·нг/мл)/мг/кг) AUC0-посл (час·нг/мл) AUC0-посл/Доза ((час·нг/мл)/мг/кг) CL (мл/мин/кг) t1/2 (час) Vss (мл/кг)
8 16100±20500 2010±2560 16800±22300 2100±2790 18,1±12,7 1,46± 1,84 1050±331
16 39600±9440 2470±590 38300±10000 2390±625 7,00±1,33 1,69± 0,430 532±145
Обезьяны
8 15900±1690 1980±212 15100±1730 1890±217 8,48±0,910 2,02±0,583 1110±113
*взятые из данных, полученных на основании плазматических концентраций GGF2, измеряемых посредством ELISA. Данные представлены как среднее ± SD.

Стационарное состояние: стационарные сывороточные концентрации представляют собой такие значения, которые повторяются при каждой дозе и представляют состояние равновесия между количеством вводимого лекарственного средства и количеством удаляемого в данный интервал времени. При долговременном дозировании любым лекарственным средством, двумя основными определяющими его средней стационарной сывороточной концентрации являются скорость, с которой вводят лекарственное средство и общий клиренс лекарственного средства у данного конкретного пациента.

Пиковая сывороточная концентрация: Точка максимума концентрации на кривой зависимости сывороточной концентрации от времени. Точное время пиковой сывороточной концентрации предсказать сложно, так как оно отражает сложные зависимости между скоростями введения и выведения.

Минимальная сывороточная концентрация: минимальная сывороточная концентрация, выявляемая в течение интервала дозирования. Минимальные концентрации теоретически присутствуют в периоде, непосредственно перед введением следующей дозы.

Всасывание: процесс, посредством которого лекарственное средство попадает в организм. Интраваскулярно вводимые лекарственные средства всасываются полностью, но внесосудистое введение приводит к различным степеням и скоростям всасывания. Зависимость между скоростью всасывания и скоростью удаления является основным определяющим фактором концентрации лекарственного средства в кровотоке.

Распределение: распределение системно доступного лекарственного средства из внутрисосудистого пространства во внесосудистые жидкости и ткани и, таким образом, к участкам нахождения рецепторов-мишеней.

Терапевтический диапазон: диапазон сывороточной концентраций лекарственного средства, ассоциированный с высокой степенью эффективности и низким риском дозозависимой токсичности. Терапевтический диапазон представляет собой статистическое понятие: существует диапазон концентраций, ассоциированный с терапевтическим ответом у большинства пациентов. Как следствие, некоторые пациенты демонстрируют терапевтический ответ при сывороточных уровнях ниже нижнего предела диапазона, тогда как другим для терапевтического эффекта необходимы сывороточные уровни, превышающие верхний предел.

Правильное расписание получения образцов важно, так как терапию лекарственным средством часто модифицируют на основе определений сывороточных концентраций. Фазы всасывания и распределения должны пройти полностью и перед получением образца должна достигаться стационарная концентрация. Уровни, полученные до установления стационарной концентрации, могут быть ложно низкими; увеличение дозировки на основе такого результата может приводить к получению токсических концентраций. Кроме того, при проведении сравнительных измерений важно, чтобы время получения образцов было согласованным.

Расписание получения образцов крови по отношению к дозировке является критическим для правильной интерпретации результатов определения сывороточной концентрации. Выбор времени, когда получают образец по отношению к введению лекарственного средства, должен основываться на фармакокинетических свойствах лекарственного средства, его лекарственной форме и клинических обоснованиях для оценки образца (например, оценка эффективности или выявление возможной токсичности, индуцируемой лекарственным средством). Для обычного мониторинга сывороточного уровня лекарственных средств с короткими периодами полувыведения для характеристики профиля сывороточной концентрации можно собирать образцы на стационарных пиках и спадах; для лекарственных средств с длительным периодом полувыведения, как правило, достаточно образцов на стационарном спаде.

Под "застойной сердечной недостаточностью" подразумевают нарушенную сердечную функцию, которая делает сердце неспособным к поддержанию нормального выброса крови в состоянии покоя или при нагрузке или к поддержанию нормального сердечного выброса в условиях нормального давления наполнения сердца. Показателем застойной сердечной недостаточности является фракция выброса левого желудочка приблизительно 40% или менее (для сравнения, фракция выброса приблизительно 60% является нормальной). Пациенты с застойной сердечной недостаточностью демонстрируют хорошо известные клинические симптомы и признаки, такие как тахипноэ, плевральный выпот, утомляемость в покое или при нагрузке, контрактильная дисфункция и отек. Застойную сердечную недостаточность легко диагностировать хорошо известными способами (см., например, "Consensus recommendations for the management of chronic heart failure". Am. J. Cardiol., 83(2A):1A-38-A, 1999).

Относительную тяжесть и прогрессирование заболевания оценивают хорошо известными способами, такими как физическое обследование, эхокардиография, радионуклидная визуализация, инвазивный гемодинамический мониторинг, магнитно-резонансная ангиография и тестирование с нагрузкой на беговой дорожке, объединенное с исследованиями захвата кислорода.

Под "ишемической болезнью сердца" подразумевают любое нарушение, являющееся результатом дисбаланса между потребностью миокарда в кислороде и достаточностью подачи кислорода. Большинство случаев ишемической болезни сердца являются результатом сужения коронарных артерий, как происходит при атеросклерозе или других сосудистых нарушениях.

Под "инфарктом миокарда" подразумевают процесс, посредством которого ишемическая болезнь приводит к образованию области с заменой миокарда рубцовой тканью.

Под "кардиотоксическим" подразумевают соединение, которое уменьшает сердечную функцию посредством прямого или опосредованного повреждения или уничтожения кардиомиоцитов.

Под "гипертензией" подразумевают артериальное давление, которое рассматривается профессиональными медиками (например, доктором или медицинской сестрой) как превышающее нормальное и обеспечивающее повышенный риск развития застойной сердечной недостаточности.

Под "лечением" подразумевают, что введение нейрегулина или подобного нейрегулину пептида статистически значимым образом замедляет или препятствует прогрессированию застойной сердечной недостаточности при лечении относительно прогрессирования заболевания, которое может происходить в отсутствие лечения. Для оценки прогрессирования заболевания можно использовать хорошо известные показатели, такие как фракция выброса левого желудочка, физическая работоспособность и другие клинические тесты, как перечислено выше, а также коэффициенты выживаемости и коэффициенты госпитализации. Замедляет ли или препятствует лечение прогрессирование заболевания статистически значимым образом или нет, можно определить хорошо известными в данной области способами (см., например, SOLVD Investigators, N. Engl. J. Med. 327:685-691, 1992 и Cohn et al., N. Engl. J Med. 339:1810-1816, 1998).

Под "предотвращением" подразумевают минимизацию или частичное или полное препятствование развитию застойной сердечной недостаточности у млекопитающего с риском развития застойной сердечной недостаточности (как определено в "Consensus recommendations for the management of chronic heart failure." Am. J. Cardiol., 83(2A):1A-38-A, 1999). Определение того, минимизирует ли или предотвращает введение нейрегулина или подобного нейрегулину пептид застойную сердечную недостаточность проводят известными способами, такими как описаны в SOLVD Investigators, выше и Cohn et al., выше.

Термин "терапевтически эффективное количество" предназначен для обозначения того количества лекарственного средства или фармацевтического средства, которое вызывает биологический или медицинский ответ в ткани, системе, у животного или человека, желаемый исследователем, ветеринаром, врачом или другим клиницистом. Терапевтическое изменение представляет собой изменение измеряемой биохимической характеристики в направлении, в котором ожидается облегчение рассматриваемого заболевания или состояния. Более конкретно "терапевтически эффективное количество" представляет собой количество, достаточное для уменьшения симптомов, ассоциированных с заболеванием или недомоганием, для нормализации функций организма при заболевании или нарушении, которые приводят к нарушению специфических функций организма, или для обеспечения улучшения одного или нескольких из клинически измеряемых параметров заболевания.

Термин "профилактически эффективное количество" предназначен для обозначения того количества фармацевтического лекарственного средства, которое предотвращает или снижает риск возникновения биологического или медицинского события, которое исследователь, ветеринар, врач или другой клиницист желает предотвратить в ткани, системе, у животного или человека.

Термин "терапевтическое окно" предназначен для обозначения диапазона доз между минимальным количеством для достижения терапевтического изменения и максимальным количеством, которое приводит к ответу, который представляет собой ответ, непосредственно перед токсичностью для пациента.

Под выражением "с риском застойной сердечной недостаточности" подразумевают индивидуума, который курит, является тучным (т.е., свыше 20% или более относительно его идеального веса), подвергается или будет подвергаться воздействию кардиотоксического соединения (такого как антрациклиновый антибиотик) или имеет (или имел) высокое артериальное давление, ишемическую болезнь сердца, инфаркт миокарда, генетический дефект, для которого известно, что он увеличивает риск сердечной недостаточности, сердечную недостаточность в семейном анамнезе, гипертрофию миокарда, гипертрофическую кардиомиопатию, систолическую дисфункцию левого желудочка, операцию коронарного шунтирования, сосудистое заболевание, атеросклероз, алкоголизм, перикардит, вирусную инфекцию, гингивит или нарушение питания (например, нервную анорексию или булимию), или является алкогольным или кокаиновым наркоманом.

Под выражением "снижающий прогрессирование истончения миокарда" подразумевают поддержание гипертрофии кардиомиоцитов желудочка так, что поддерживается или увеличивается толщина стенки желудочка.

Под выражением "ингибирует апоптоз миокарда" подразумевают, что обработка нейрегулином ингибирует гибель кардиомиоцитов по сравнению с необработанными кардиомиоцитами по меньшей мере на 10%, более предпочтительно - по меньшей мере на 15%, еще более предпочтительно - по меньшей мере на 25%, даже более предпочтительно - по меньшей мере на 50%, еще более предпочтительно - по меньшей мере на 75%, и наиболее предпочтительно - по меньшей мере на 90%.

Под "нейрегулином" или "NRG" подразумевают пептид, который кодируется генами или нуклеиновой кислотой (например, кДНК) NRG-1, NRG-2 или NRG-3 и связывает и активирует рецепторы ErbB2, ErbB3 или ErbB4 рецепторы или их комбинации.

Под "нейрегулином-1", "NRG-1", "херегулином", "GGF2" или "лигандом p185erbB2" подразумевают пептид, который связывается с рецептором ErbB2, когда он спарен с другим рецептором (ErbB1, ErbB3 или ErbB4), и кодируется геном лиганда p185erbB2, описанным в патенте США № 5530109; патенте США № 5716930 и патенте США № 7037888, которые все в полном объеме включены в настоящее описание в качестве ссылки.

Под "подобным нейрегулину пептидом" подразумевают пептид, который содержит EGF-подобный домен, кодируемый геном нейрегулина, и связывающий и активирующий ErbB2, ErbB3, ErbB4 или их комбинацию.

Под "доменом, подобным эпидермальному фактору роста" или "EGF-подобным доменом" подразумевают пептидный мотив, кодируемый генами NRG-1, NRG-2 или NRG-3, который связывает и активирует ErbB2, ErbB3, ErbB4 или их комбинации, и имеет структурное сходство со связывающим рецептор доменом EGF, как описано в Holmes et al., Science 256:1205-1210, 1992; патенте США № 5530109; патенте США № 5716930; патенте США № 7037888; Hijazi et al., Int. J. Oncol. 13:1061-1067, 1998; Chang et al., Nature 387:509-512, 1997; Carraway et al., Nature 387:512-516, 1997; Higashiyama et al., J Biochem. 122:675-680, 1997; и WO 97/09425). Относительно нуклеиновой и аминокислотной последовательностей, соответствующих доменам EGFL 1-6, кодируемых геном NRG-1, см. фигуры 9-14.

Под "антителом к ErbB2" или "антителом к HER2" подразумевают антитело, которое специфически связывается с внеклеточным доменом рецептора ErbB2 (у людей также известного как HER2) и предотвращает зависимую от ErbB2 (HER2) передачу сигнала, инициируемую связыванием нейрегулина.

Под "трансформированной клеткой" подразумевают клетку (или потомка клетки), в которую способами рекомбинантной ДНК или известными способами генотерапии вводят молекулу ДНК, кодирующую нейрегулин или пептид, содержащий EGF-подобный домен нейрегулина.

Под "промотором" подразумевают минимальную последовательность, достаточную для контроля транскрипции. Также по изобретению включены промоторные элементы, которых достаточно для осуществления зависимой от промотора экспрессии гена, регулируемой на основе типа клеток или физиологического статуса (например, гипоксические условия в сравнении с условиями с нормальным содержанием кислорода), или индуцируемые внешними сигналами или средствами; такие элементы могут находиться в 5' или 3' или внутренних областях природного гена.

Под "функционально связанным" подразумевают, что нуклеиновая кислота, кодирующая пептид (например, кДНК) и одна или несколько регуляторных последовательностей соединены таким способом, который обеспечивает экспрессию гена, когда с регуляторной последовательностью связаны соответствующие молекулы (например, белки активаторов транскрипции).

Под "экспрессирующим вектором" подразумевают генетически сконструированную плазмиду или вирус, получаемый, например, из бактериофага, аденовируса, ретровируса, поксвируса, вируса герпеса, или искусственную хромосому, которые используют для трансфекции кодирующей последовательности пептида (например, нейрегулина), функционально связанной с промотором, в клетку-хозяина так, что кодируемый пептид или пептид экспрессируется в клетке хозяине.

Если не определено иначе, все технические и научные термины, используемые в настоящем описании, имеют то же значение, как обычно понимает специалист в области, к которой принадлежит настоящее изобретение.

Обсуждение документов, действий, материалов, устройств, изделий и т.п. включено в настоящее описание только с целью предоставления контекста для настоящего изобретения. Не следует полагать или представлять, что любой или все из этих материалов составляли часть известного уровня техники или являлись общеизвестными в области, относящейся к настоящему изобретению, до даты приоритета каждого из пунктов формулы изобретения настоящей заявки.

Другие варианты осуществления

Хотя изобретение описано применительно к конкретным вариантам его осуществления, следует понимать, что возможны дополнительные модификации и эта заявка предназначена для рассмотрения любых вариантов, применений или адаптаций изобретения, в основном следующих из принципов изобретения, и включая такие отклонения от настоящего описания, находящиеся в известной или общепринятой практике в данной области, к которой принадлежит изобретение, и их можно применять к существенным признакам, указанным выше в настоящем описании, и они входят в объем прилагаемой формулы изобретения.

Следующие далее примеры должны помочь специалистам в данной области лучше понять изобретение и его принципы и преимущества. Следует понимать, что эти примеры иллюстрируют изобретение и не ограничивают его область.

ПРИМЕРЫ

Как указано выше в настоящем описании, нейрегулины представляют собой семейство факторов роста, структурно родственных эпидермальному фактору роста (EGF) и они необходимы для нормального развития сердца. Данные показывают, что нейрегулины представляют собой потенциальное лекарственное средство для лечения заболеваний сердца, включая сердечную недостаточность, инфаркт миокарда, химиотерапевтическую токсичность и вирусный миокардит.

Исследования, описываемые в настоящем описании, служили для определения дозирования в модели застойной сердечной недостаточности у крыс с лигированием левой передней нисходящей (LAD) артерии. Клонировали и продуцировали несколько вариантов сплайсинга нейрегулина. Фрагмент нейрегулина, состоящий из EGF-подобного домена (EGF-ld) из предыдущих публикаций (Liu et al., 2006), сравнивали с полноразмерным нейрегулином, известным как фактор роста глии 2 (GGF2), и EGF-подобным доменом с Ig-доменом (EGF-Ig). Самцов и самок крыс Sprague-Dawley подвержгали лигированию LAD артерии. Через 7 суток после лигирования крыс внутривенно (в/в) ежедневно обрабатывали нейрегулином. Сердечную функцию контролировали эхокардиографией.

В первом исследовании сравнивали 10 суток дозирования с эквимолярными количествами EGF-ld или GGF2 (для GGF2 они вычислены как 0,0625 и 0,325 мг/кг). В конце периода дозирования обработка GGF2 приводила к значимо большему (p<0,05) улучшению фракции выброса (EF) и фракции укорочения (FS), чем у EGF-ld. Во втором исследовании сравнивали 20 суток GGF2 с EGF-ld и EGF-Ig в эквимолярных концентрациях. Обработка GGF2 приводила к значимо улучшенным EF, FS и LVESD (p<0,01). EGF-ld или EGF-Ig улучшений физиологии сердца в течение этого периода не обеспечивали. В третьем исследовании сравнивали ежедневное (раз в 24 часа) дозирование, дозирование через сутки (раз в 48 час) и every дозирование каждые четвертые сутки (раз в 96 час) в течение 20 суток с использованием GGF2 (3,25 мг/кг). Все три режима обработки GGF2 приводили к значимым улучшениям физиологии сердца, включая EF, ESV и EDV, и эффекты поддерживались в течение 10 суток после завершения дозирования. Представленные в настоящем описании исследования подтверждают, что GGF2 является основным нейрегулиновым соединением и устанавливают оптимальные режимы дозирования для его введения.

Как показано в настоящем описании, в исследованиях по настоящему изобретению устанавливают относительную эффективность GGF2 по сравнению с опубликованными фрагменты нейрегулина (Liu et al., 2006), проводят исследование с целью определения оптимальной дозы и частоты дозы, и определяют, необходим ли эксципиент BSA, как сообщалось ранее.

Способы и материалы

Клонирование, экспрессия и очистка ДНК домена IgEGF (Ig154Y) GGF2 (EGF-Ig): домен IgEGF амплифицировали с существующей кДНК GGF2 и клонировали в вектор pet 15b (Novagen, каталожный № 69661-3) с использованием участков рестрикции NdeI и BamHI. Полученный белок представляет собой 21,89 кДа + ≈3кДа His-метки (= ≈ 25 кДа).

Последовательность ДНК клона IgEgf pet 15: подчеркнутые последовательности представляют собой праймеры, используемые для амплификации. Выделенные полужирным шрифтом последовательности представляют собой участки клонирования для вставки последовательности в вектор pet (NdeI и BamHI).

Ниже представлен конечный транслированный с вектора pet 15b белок. Часть вектора подчеркнута.

Экспрессия белка: Клон трансформировали в клетки B121 для экспрессии белка с использованием системы Overnight Express Autoinduction System (Novagen) в среде LB при 25°C в течение 24 часов.

Рефолдинг белка: Адаптировали набор Novagen Protein Refolding Kit, 70123-3.

Очистка белка: Колонки His TRAP - по инструкциям производителя

Вестерн-блоттинг: экспрессию белка оценивали вестерн-блоттингом. Результирующая полоса с His-меткой мигрирует приблизительно до 25 кДа.

Для разрешения белка использовали 4-20% гель criterion (Biorad) с последующим переносом на нитроцеллюлозную бумагу Protran (размер пор 0,1 мкм из Schliecher and Schull). Блот блокировли в 5% молоке в TBS-T (0,1%). Использовали первичное антитело (аффинно очищенное поликлональное Ab к EGF NRG 1-альфа/HRG1-альфа человека с каталожным № AF-296-NA из R&D systems) с разведением 1:1000 в 5% молоке в TBS-T 1 час при RT (также работает при 4°C в течение ночи). Использовали вторичные антитела кролика к антителам козы с HRP при разведении 1:10000 в 5% молоке в TBS-T в течение 1 часа при RT. Все отмывки проводили в TBS-T.

Протокол очистки Ig154Y: Культуры выращивают при 25°C в системе Overnight Express Autoinduction System 1 из Novagen (каталожный № 71300-4). Культуры центрифугируют и проводят экстракцию из осадка, растворяют и подвергают рефолдингу для получения Ig154Y перед проведением очистки.

Материалы для экстракции, растворения и рефолдинга:

10X отмывочный буфер: 200 мМ Tris-HCl, pH 7,5, 100 мМ ЭДТА, 10% Triton X-100

10X буфер для растворения: 500 мМ CAPS, pH 11,0

50X буфер для диализа: 1M Tris-HCl, pH 8,5

30% N-лаурилсаркозин - добавлять в виде порошка (Sigma 61739-5G)

1M DTT

Восстановленный глутатион (Novagen 3541)

Окисленный глутатион (Novagen 3542)

A. Лизис клеток и получение телец включения

- Клеточные осадки оттаивали и ресуспендировали в 30 мл 1X отмывочного буфера.

- К суспензии добавляли ингибиторы протеаз (25 мкл 10X на 50 мл), ДНКазу (200 мкл 1 мг/мл на 50 мл) и MgCl2 (500 мкл 1М на 50 мл).

- Клетки лизировали посредством обработки ультразвуком с охлаждением на льду.

- После обработки ультразвуком тельца включения собирали посредством центрифугирования при 10000g в течение 12 минут.

- Супернатант удаляли и осадок тщательно ресуспендировали в 30 мл 1X отмывочного буфера.

- Повторяли этап 4.

- Осадок тщательно ресуспендировали в 30 мл 1X отмывочного буфера.

- Тельца включения собирали посредством центрифугирования при 10000g в течение 10 минут.

B. Растворение и рефолдинг

- Из общей массы телец включения для обработки рассчитывали количество 1X буфера для растворения, необходимого для ресуспендирования телец включения c концентрацией 10-15 мг/мл. Если рассчитанный объем превышает 250 мл, используют 250 мл.

- При комнатной температуре получают рассчитанный объем 1X буфера для растворения, дополненный 0,3% N-лаурилсаркозином (если необходимо для дополнительной оптимизации можно использовать до 2%) (300 мг/100 мл буфера) и 1 мМ DTT.

- Добавляют рассчитанное количество 1X буфера для растворения из этапа 2 к тельцам включения и осторожно перемешивают. Большие частицы можно разрушать повторным пипетированием.

- Инкубируют в охлаждаемом шейкере при 25°C, 50-100 об/мин в течение 4-5 часов (или более если необходимо для дополнительной оптимизации).

- Отделяют от примесей центрифугированием при 10000g в течение 10 минут при комнатной температуре

- Переносят супернатант, содержащий растворенный белок в чистую пробирку.

C. Протокол диализа для рефолдинга белка

- Получают требуемый объем буфера для диализа растворенного белка. Диализ следует проводить по меньшей мере с 2 заменами буфера с объемом в 50 раз большим объема образца. Разводят 50X буфер для диализа до 1X до желаемого объема и дополняют 0,1 мМ DTT.

- Проводят диализ в течение по меньшей мере 4 часов при 4°C. Заменяют буфер и продолжают. Проводят диализ в течение дополнительных 4 или более часов.

- Получают дополнительный буфер для диализа, как определено на этапе 1, но не добавляют DTT.

- Продолжают диализ с двумя дополнительными заменами (минимум 4 часа каждая) с буфером для диализа без DTT.

D. Окислительно-восстановительный буфер для рефолдинга для стимуляции образования дисульфидных связей

- Получают буфер для диализа, содержащий 1 мМ восстановленный глутатион (1,2 г/4 л) и 0,2 мМ окисленный глутатион (0,48 г/4 л) в 1X буфере для диализа. Объем должен быть в 25 раз больше, чем объем образца растворенного белка. Охлаждают до 4°C.

- Проводят диализ подвергнутого рефолдингу белка из этапа 1 в течение ночи при 4°C.

Материалы для очистки

Все процедуры проводили при 4°C.

Химические вещества:

Гидрохлорид Trizma (Sigma T5941-500G)

5M раствор хлорида натрия (Sigma S6546-4L)

10 Н гидроксид натрия (JT Baker 5674-02)

Имидазол (JT Baker N811-06)

A. Очистка на колонке HISPrep FF 16/10 - 20 мл (GE Healthcare)

Буфер A: 20 мМ Tris-HCl + 500 мМ NaCl pH 7,5

Буфер B: Буфер A + 500 мМ имидазол pH 7,5

Уравновешивание колонки: буфер A - 5 объемов колонки, буфер B - 5 объемов колонки, буфер A - 10 объемов колонки

Вносят 20 мл образца на проход на 20 мл колонку при 0,5 мл/мин

Отмывают колонку 5 объемами колонки буфера A

Колонку элюируют 5 объемами колонки 280 мМ имидазола.

Очищают 10 объемами колонки 100% буфера B.

Уравновешивают 15 объемами колонки буфера A

Анализируют фракции с серебряным красителем SDS-page

Собирают фракции с Ig154Y

B. Удаление His-метки

Удаление His-метки проводят посредством набора Thrombin Cleavage Capture Kit из Novagen (каталожный № 69022-3). На основе предшествующего тестирования лучшими условиями являются комнатная температура в течение 4 часов с тромбином с 0,005 Ед фермента на мкл на каждые 10 мкг белка Ig154Y. Через четыре часа инкубации, добавляют 16 мкл взвеси агарозы со стрептавидином на единицу фермента тромбина. Перемешивают образец в течение 30 минут при комнатной температуре. Восстанавливают Ig154Y посредством фильтрации при центрифугировании или стерильной фильтрации (в зависимости от объема).

Полное расщепление определяют посредством вестерн-блоттинга с EGF и антителами к His.

C. Концентрирование Ig154Y

Доводят до желательной концентрации с применением 15 мл концентора Millipore Centriprep 3000 MWCO (Ultracel YM-3, 4320)

D. Хранение в конечном буфере

Хранят в 20 мМ Tris +500 мМ NaCl pH 7,5 и 1X PBS + 0,2% BSA.

Клонирование, экспрессия и очистка ДНК 156Q (EGF-Id) [домен EGF NRG1b2 (156Q)]: домен egf NRG1b2 клонировали с кДНК головного мозга человека и клонировали в вектор pet 15b (Novagen каталожный № 69661-3) с использованием участков рестрикции NdeI и BamHI. Полученный белок представляет собой 6,92 кДа + ≈3 кДа His-метки (= 9,35 кДа)

Последовательность ДНК клона NRG1b2 egf pet15

Подчеркнутые последовательности представляют собой участки клонирования (NdeI и BamHI)

Ниже представлен конечный транслированный с вектора pet 15b белок. Домен egf выделен зеленым цветом.

Рассчитанные pI/Mw: 7,69/9349,58.

Экспрессия белка

Клон трансформировали в клетки B121 для экспрессии белка с использованием системы Overnight Express Autoinduction System (Novagen) в среде LB при 25°C в течение 24 часов. Экспрессия в основном происходит в нерастворимые тельца включения.

Рефолдинг белка: Адаптировали набор Novagen Protein Refolding Kit, 70123-3.

Очистка белка: Белок помещали на анионобменную колонку DEAE при 2,5 мл/мин. Фрагмент EGF-ld остается в элюате, тогда как загрязняющие вещества связываются и элюируются при повышенной концентрации соли. Загрузочный и отмывочный буфет представляет собой 50 мМ Tris pH 7,9, а буфер для элюции представляет собой 50 мМ Tris pH 7,9 с 1M NaCl. Элюат собирают и концентрируют с применением Centriprep YM-3 из Millipore.

Вестерн-блоттинг: экспрессию белка оценивали вестерн-блоттингом. Результирующая полоса мигрирует приблизительно до 10 кДа.

Для разрешения белка использовали 4-20% гель criterion (Biorad) с последующим переносом на нитроцеллюлозную бумагу Protran (размер пор 0,1 мкм из Schliecher and Schull). Блот блокировли в 5% молоке в TBS-T (0,1%). Использовали первичное антитело (аффинно очищенное поликлональное Ab к EGF NRG 1-альфа/HRG1-альфа человека с каталожным № AF-296-NA из R&D systems) с разведением 1:1000 в 5% молоке в TBS-T 1 час при RT (также работает при 4°C в течение ночи). Использовали вторичные антитела кролика к антителам козы с HRP при разведении 1:10000 в 5% молоке в TBS-T в течение 1 часа при RT. Все отмывки проводили в TBS-T.

Протокол очистки для NRG-1560

Культуры выращивают при 25°C в системе Overnight Express Autoinduction System 1 из Novagen (каталожный № 71300-4). Присутствует очень небольшое количество растворимого NRG-156Q (EGF-ld). Культуры центрифугируют и проводят экстракцию из осадка, растворяют и подвергают рефолдингу для получения NRG-156Q перед проведением очистки.

Материалы для экстракции, растворения и рефолдинга:

10X отмывочный буфер: 200 мМ Tris-HCl, pH 7,5, 100 мМ ЭДТА, 10% Triton X-100

10X буфер для растворения: 500 мМ CAPS, pH 11,0

50X буфер для диализа: 1M Tris-HCl, pH 8,5

30% N-лаурилсаркозин - добавлять в виде порошка (Sigma 61739-5G)

1M DTT

Восстановленный глутатион (Novagen 3541)

Окисленный глутатион (Novagen 3542)

A. Лизис клеток и получение телец включения

- Оттаивают и ресуспендируют клеточный осадок в 30 мл 1X отмывочного буфера. Mix как необходимо для полного ресуспендирования.

- К суспензии добавляют ингибиторы протеаз (25 мкл 10X на 50 мл), ДНКазу (200 мкл 1 мг/мл на 50 мл) и MgCl2 (500 мкл 1 М на 50 мл).

- Клетки лизируют обработкой ультразвуком.

a. На всем протяжении всего этапа клетки охлаждают на льду.

b. С использованием прямоугольного наконечника проводят обработку ультразвуком в течение 30 секунд на уровне 6, 10 раз пока суспензия на стане менее вязкой. Между каждой обработкой ультразвуком суспензию оставляют охлаждаться на льду в течение 60 секунд. При обработке ультразвуком поддерживают объем не более 40 мл в 50 мл конической пробирке.

- По завершении переносят каждую суспензию в 250 мл центрифужные колбы с наклонными горлышками для использования с применением центрифуги F-16/250.

- Собирают тельца включения посредством центрифугирования при 10000g в течение 12 минут.

- Удаляют супернатант (сохраняют образец для анализа растворимого белка) и тщательно ресуспендируют осадок в 30 мл 1X отмывочного буфера.

- Повторяют центрифугирование как на этапе 4 и сохраняют осадок.

- Снова тщательно ресуспендируют осадок в 30 мл 1X отмывочного буфера.

- Собирают тельца включения посредством центрифугирования при 10000g в течение 10 минут. Супернатант сливают и удаляют последние следы жидкости, обстукивая перевернутую пробирку на бумажной салфетке.

B. Растворение и рефолдинг

- Из общей массы телец включения для обработки рассчитывали количество 1X буфера для растворения, необходимого для ресуспендирования телец включения c концентрацией 10-15 мг/мл. Если рассчитанный объем превышает 250 мл, используют 250 мл.

- При комнатной температуре получают рассчитанный объем 1X буфера для растворения, дополненный 0,3% N-лаурилсаркозином (если необходимо для дополнительной оптимизации можно использовать до 2%) (300 мг/100 мл буфера) и 1 мМ DTT.

- Добавляют рассчитанное количество 1X буфера для растворения из этапа 2 к тельцам включения и осторожно перемешивают. Большие частицы можно разрушать повторным пипетированием.

- Инкубируют в охлаждаемом шейкере при 25°C, 50-100 об/мин в течение 4-5 часов.

- Отделяют от примесей центрифугированием при 10000g в течение 10 минут при комнатной температуре

C. Протокол диализа для рефолдинга белка

- Получают требуемый объем буфера для диализа растворенного белка. Диализ следует проводить по меньшей мере с 2 заменами буфера с объемом в 50 раз большим объема образца. Разводят 50X буфер для диализа до 1X желаемым объемом и дополняют 0,1 мМ DTT.

- Проводят диализ в течение по меньшей мере 4 часов при 4°C. Заменяют буфер и продолжают. Проводят диализ в течение дополнительных 4 или более часов.

- Получают дополнительный буфер для диализа, как определено на этапе 1, но не добавляют DTT.

- Продолжают диализ с двумя дополнительными заменами (минимум 4 часа каждая) с буфером для диализа без DTT.

D. Окислительно-восстановительный буфер для рефолдинга для стимуляции образования дисульфидных связей

- Получают буфер для диализа, содержащий 1 мМ восстановленный глутатион (1,2 г/4 л) и 0,2 мМ окисленный глутатион (0,48 г/4 л) в 1X буфере для диализа. Объем должен быть в 25 раз больше, чем объем образца растворенного белка. Охлаждают до 4°C.

- Проводят диализ подвергнутого рефолдингу белка из этапа 1 в течение ночи при 4°C.

Материалы для очистки

Все процедуры проводили при 4°C.

Химические вещества:

Гидрохлорид Trizma (Sigma T5941-500G)

5M раствор хлорида натрия (Sigma S6546-4L)

10 Н гидроксид натрия (JT Baker 5674-02)

E. Очистка на анионной колонке DEAE HiPrep 16/10 - 20 мл (GE Healthcare)

Буфер A: 50 мМ Tris-HCl pH 8,0

Буфер B: 50 мМ Tris-HCl с 1M NaCl pH 8,0

Уравновешивание колонки: буфер A - 5 объемов колонки, буфер B - 5 объемов колонки, буфер A- 10 объемов колонки

- Вносят 50 мл образца на проход на 20 мл колонку при 2,0 мл/мин (NRG-156 (EGF-ld) находится в элюате).

- Отмывают 20 мл колонку 5 объемами колонки буфера A

20 мл колонка с градиентом до 100% B с 5 объемами колонки. Это проводят для элюции загрязняющих веществ.

- Очищают 10 объемами колонки 100% буфера B.

- Уравновешивают 15 объемами колонки буфера A

- Анализируют фракции с серебряным красителем SDS-page

- Собирают фракции с NRG-156Q (10 кДа)

F. Концентрирование NRG-156 (EGF-ld)

- Концентрируют с применением 15 мл концентратора Centriprep 3000 MWCO (Ultracel YM-3, 4320)

- Для определения концентрации используют модифицированный анализ белка по Лоури.

G. Удаление His-метки

Удаление His-метки проводят посредством набора Thrombin Cleavage Capture Kit из Novagen (каталожный № 69022-3). На основе предшествующего тестирования лучшими условиями являются комнатная температура в течение 4 часов с тромбином с 0,005 Ед фермента на мкл на каждые 10 мкг белка NRG-156Q (EGF-ld). Через четыре часа инкубации, добавляют 16 мкл взвеси агарозы со стрептовидином на единицу фермента тромбина. Перемешивают образец в течение 30 минут при комнатной температуре. Восстанавливают NRG-156Q посредством фильтрации при центрифугировании или стерильной фильтрации (в зависимости от объема).

Полное расщепление определяют посредством вестерн-блоттинга с EGF и антителами к His.

H. Хранение в конечном буфере

Хранили в 1X PBS с 0,2% BSA при 4°C.

Экспрессия и очистка GGF2

Для клонирования и основной информации по GGF2, см. USPN 5530109. Клеточная линия описана в USPN 6051401. Полное содержание каждого из USPN 5530109 и USPN 6051401 в полном объеме включено в настоящее описание в качестве ссылки.

Клеточная линия CHO-(Alpha2HSG)-GGF: Эту клеточную линию конструировали для получения достаточных количеств фетуина (alpha2HSG человека) с поддержанием высоких скоростей продукции rhGGF2 в бессывороточных условиях.

Клетки Cho (dhfr-) трансфицировали экспрессирующим вектором, представленным ниже (pSV-AHSG). Стабильные клетки растили в условиях отбора на ампициллине. Клеточную линию обозначили (dhfr-/α2HSGP). Затем клетки dhfr-/α2HSGP трансфицировали вектором pCMGGF2, представленным ниже, содержащим кодирующую последовательность GGF2 человека с использованием катионного липидного реагента DMRIE-C (Life Technologies #10459-014).

Стабильные и высокопродуцирующие клеточные линии получали по стандартным протоколам с применением метотрексата (100 нМ, 200 нМ, 400 нМ, 1 мкМ) через 4-6 недельные интервалы. Клетки постепенно отучали от содержащей сыворотку среды. Клоны выделяли способами стандартных лимитирующих разведений. Подробные описания требований сред находятся в указанных выше публикациях.

Для усиления транскрипции кодирующую последовательность GGF2 помещали после вставочной последовательности (MIS) EBV BMLF-1. См. диаграммы ниже.

Последовательность MIS (SEQ ID NO: 20)

Кодирующая последовательность GGF2 (SEQ ID NO: 1) -

Последовательность белка GGF2 (SEQ ID NO: 2) -

Получение GGF2: Одну пробирку с GGF2 с 2,2×106 клетками/мл оттаивали в 100 мл среды Acorda Medium 1 (см. таблицу 3) и размножали до получения достаточного количества для засевания контейнеров для получения. Клетки инокулировали в среду для получения Acorda Medium 2 (см. таблицу 4) c 1,0×105 клеток/мл в двухлитровые роллерные флаконы с вентиляционными отверстия. Роллерные флаконы поддерживали при 37°C в течение 5 суток, а затем температуру снижали до 27°C в течение 26 суток. В роллерных флаконах контролировали количество клеток и общий вид, но они не заполнялись. После достижения жизнеспособности ниже 10% клетки центрифугировали и кондиционированные среды собирали и проводили стерильную фильтрацию.

Таблица 3
Среда 1
Элемент Производитель Каталожный номер Конечная концентрация
CD-CHO Invitrogen 10743-029 - удалить 50 мл, затем добавить приведенные ниже компоненты
FeSO4•ЭДТА Sigma F-0518 1× (10 мл/л)
L-глутамин Cellgro 25-005-CI 4 мМ (20 мл/л)
Рекомбинантный инсулин человека Sigma 1-9278 290 Ед/л (1 мл/л)
Заменимые аминокислоты Cellgro 25-025-CI 1× (10 мл/л)
Пептон типа 4 Soybean-HySoy Sigma P0521 Порошок - получали 20X в CD-CHO (50 мл/л)
Гентамицин Invitrogen 15750-078 100 мкг (2 мл/л)
Таблица 4
Среда 2
Элемент Производитель Каталожный номер Конечная концентрация
CD-CHO Invitrogen 10743-029 50% (сначала -50 мл)
HyQ SFX-CHO HyClone SH 30187,02 50% (сначала -50 мл)
FeSO4•ЭДТА Sigma F-0518 1× (10 мл/л)
L-глутамин Cellgro 25-005-CI 4 мМ (20 мл/л)
Рекомбинантный инсулин человека Sigma 1-9278 290 Ед/л (1 мл/л)
Заменимые аминокислоты Cellgro 25-025-CI 1× (10 мл/л)
Пептон типа 4 Soybean-HySoy Sigma P0521 Порошок - получали 20X в CD-CHO (50 мл/л)
Гентамицин Invitrogen 15750-078 100 мкг (2 мл/л)

Протокол очистки GGF2

Все процедуры проводили при 4°C.

Химические вещества:

Ацетат натрия

Ледяная уксусная кислота (для доведения pH)

10 Н NaOH (для доведения pH)

NaCl

Сульфат натрия

L-аргинин (JT Baker, каталожный №: 2066-06)

Маннит (JT Baker, каталожный №: 2553-01)

Исходное вещество: супернатанты кондиционированных сред. Довести pH до 6,5.

Этап 1:

Захват - катионообменная хроматография

HiPrep SP 16/10 (Amersham Biosciences)

Уравновешивание колонки: буфер A - 5 объемов колонки, буфер B - 5 объемов колонки, буфер 15% B - 5 объемов колонки

Буфер A: 20 мМ Ацетат Na, pH 6,0

Буфер B: 20 мМ Ацетат Na, pH 6,0, 1M NaCl

Вносят образец при 2 мл/мин с непрерывным внесением в течение ночи если возможно. Связывание происходит лучше при непрерывном внесении.

Максимальная емкость для стартового образца: 5 мг GGF2/мл среды

Скорость потока: 3 мл/мин

Первая отмывка: 15% B, 10 объемов колонки

Вторая отмывка: 35% B, 10 объемов колонки

Элюция GGF2: 60% B, 8 объемов колонки

Отмывка колонки: 100% B, 8 объемов колонки

Буферы: Состав Проводимость Применение
15% B 20 мМ ацетат Na, pH 6,0, 150 мМ NaCl Предварительное уравновешивание
Первая отмывка
35% B 20 мМ ацетат Na, pH 6,0, 350 мМ NaCl Вторая отмывка
60% B 20 мМ ацетат Na, pH 6,0, 600 мМ NaCl Элюция GGF2
100% B 20 мМ ацетат Na, pH 6,0, 1000 мМ NaCl 88 мС/см Отмывка колонки

Этап 2:

Очистка - гель-фильтрационная хроматография

Сефакрил S200 26/60

Буфер для элюции: 20 мМ ацетат Na, 100 мМ сульфат натрия, 1% маннит, 10 мМ L-аргинин, pH 6,5

Проводимость буфера:

Образец: элюированный пул SP GGF2, концентрированный до ≈AU280 1,0

Скорость потока: 1,3 мл/мин

Пиковая элюция: при ≈0,36 объема колонки от начала введения образца

Этап 3: Удаление ДНК и эндотоксина - фильтрация через мембрану Intercept Q.

Буфер для предварительного уравновешивания: 20 мМ ацетат Na, 100 мМ сульфат натрия, 1% маннит, 10 мМ L-Аргинин, pH 6,5

Собирают элюат

Этап 4: Конечный состав и получение образца

К образцу добавляют дополнительного 90 мМ L-аргинина

Концентрируют

Подвергают стерильной фильтрации

Материал носителя/контроля, используемый в настоящем описании, представляет собой 0,2% бычий сывороточный альбумин (BSA), 0,1 M фосфат натрия, pH 7,6.

В этом эксперименте используют линии крыс CD®IGS [Crl:CD®(SD)/MYOINFARCT] и Naive Sprague Dawley. Эти линии получали из Charles River Laboratories. Возраст тестируемых животных составляет приблизительно 6-7 недель по прибытии, а масса составляет приблизительно 160-200 г в момент хирургического вмешательства. Фактический диапазон может варьировать, и он документирован в данных.

В исследование брали всех полученных животных Naive Sprague Dawley и их обозначали как группа 1. Животных, рассматриваемых как подходящих для исследования, до обработки взвешивали.

Всех полученных животных CD®IGS [Crl:CD®(SD)/MYOINFARCT] случайным образом распределяли по группам обработки (группы 2-5) с использованием простой процедуры рандомизации на основе рассчитанной фракции выброса на основе эхокардиографических исследований, проводимых на сутки 7 после хирургического вмешательства, проводимого в Charles River Laboratories. Проводили простую рандомизацию с получением в результате каждой группы обработки (группы 2-5), состоящей из подходящих количеств животных, в результате имеющей приблизительно равную среднюю групповую фракцию выброса (±3%) в группах 2-5.

Всех животных в группах 2-6 акклиматизировали в Charles River Laboratories в соответствии со Standard Operating Procedures этой лаборатории. Затем животных случайным образом распределяли на группы обработки. Всех не подвергнутых воздействию животных в группе 1 до их первичных эхокардиографических исследований акклиматизировали в течение приблизительно 24 часов после получения.

Животных индивидуально содержали в подвесных проволочного типа клетках из нержавеющей стали. Клетки с твердым дном в основном не использовали, так как грызуны являются копрофагами и поедание фекалий, содержащих выделенный тестируемый препарат и метаболические продукты, или поедание самой подкладки могут затруднить интерпретацию результатов исследования токсичности.

Обеспечивали флуоресцентное освещение посредством автоматического таймера в течение приблизительно 12 часов в сутки. Иногда, суточный цикл периодически прерывали из-за связанных с исследованиями действий. Контролировали температуру и влажность и их ежедневно записывали, и их поддерживали в максимально возможной степени от 17,78 до 26,11°C и от 30 до 70%, соответственно.

Основной рацион представлял собой Lab Diet® Certified Rodent Diet #5002, PMI Nutrition International, Inc для блоков. Если не указано иначе, этот рацион был доступен без ограничений. Каждый используемый код партии записывали в журнал исследования. Если не указано иначе, всех животных без ограничения обеспечивали водопроводной водой через автоматическую систему подачи воды.

ПЛАН ИССЛЕДОВАНИЯ

Таблица 5
GGF2 относительно фрагмента EGF-ld (Liu et al., 2006), дозируемые в течение 10 суток, начиная на сутки 7 после LAD
Группа Обработка Длительность жизни Доза Интервал дозирования† Моменты времени ECHO (после операции)
1 (n=5 самцов; n=5 самок) Контроль (Носитель) 17 суток после операции Только носитель 24 часа Сутки 6, 17
2 (n=6 M; n=6F) GGF2 17 суток после операции 0,0625 мг/кг 24 часа Сутки 6, 17
3 (n=6 самцов; n=6 самок) GGF2 17 суток после операции 0,625 мг/кг 24 часа Сутки 6, 17
4 (n=6 самцов; n=7 самок) EGF-ld 17 суток после операции Эквимолярная 24 часа Сутки 6, 17
5 (n=7 самцов; n=6 самок) EGF-ld 17 суток после операции Эквимолярная 24 часа Сутки 6, 17
Таблица 6
Повышенная доза GGF2 в сравнении с EGF-ld и EGF-Ig, дозируемые в течение 20 суток начиная на сутки 7 после LAD. 10 суток выведения
Группа Обработка Длительность жизни Доза Интервал дозирования† Моменты времени ECHO (после операции)
1 (n=5 самцов; n=5 самок) н.п.: совпадающие по возрасту контроли без обработки 30 суток после первичной ECHO н.п. н.п. ‡Сутки 1, 12, 22 и 32
2 (n=6 самцов; n=6 самок) Контроль (Носитель) 38 суток после операции Только носитель 24 часа *Сутки 7, 18, 28 и 38
3 (n=6 самцов; n=6 самок) GGF-2 38 суток после операции 0,625 мг/кг 24 часа *Сутки 7, 18, 28 и 38
4 (n=6 самцов; n=7 самок) GGF-2 38 суток после операции 3,25 мг/кг 24 часа *Сутки 7, 18, 28 и 38
5 (n=7 самцов; n=6 самок) EGF-ld 38 суток после операции Эквимолярная 24 часа *Сутки 7, 18, 28 и 38
6 (n=7 самцов; n=6 самок) EGF-Ig 38 суток после операции Эквимолярная 24 часа *Сутки 7, 18, 28 и 38
Таблица 7
Частота дозирования GGF2
Группа Обработка Длительность жизни Доза Интервал дозирования† Моменты времени ECHO (после операции)
1 (n=5 самцов; n=5 самок) н.п.: совпадающие по возрасту контроли без обработки 30 суток после первичной ECHO н.п. н.п. ‡Сутки 1, 12, 22 и 32
2 (n=6 самцов; n=6 самок) Контроль (Носитель) 38 суток после операции Только носитель 24 часа *Сутки 7, 18, 28 и 38
3 (n=6 самцов; n=6 самок) GGF-2 38 суток после операции 3,25 мг/кг 24 часа *Сутки 7, 18, 28 и 38
4 (n=6 самцов; n=7 самок) GGF-2 38 суток после операции 3,25 мг/кг 48 часа *Сутки 7, 18, 28 и 38
5 (n=7 самцов; n=6 самок) GGF-2 38 суток после операции 3,25 мг/кг 96 часа *Сутки 7, 18, 28 и 38
TA 1- Тестируемый препарат 1; M = самцы; F = самки.
Таблица 8
GGF2 с BSA и без него
Группа Обработка Длительность жизни Доза Интервал дозирования† Моменты времени ECHO (после операции)
1 (n=5 самцов; n=5 самок) н.п.: совпадающие по возрасту контроли без обработки 17 суток после операции н.п. н.п. Сутки 6 и 17
2 (n=6 самцов; n=6 самок) Контроль (Носитель) 17 суток после операции Только носитель 24 часа Сутки 6 и 17
3 (n=6 самцов; n=6 самок) GGF-2 + BSA 17 суток после операции 3,25 мг/кг 24 часа Сутки 6 и 17
4 (n=6 самцов; n=7 самок) GGF-2 without BSA 17 суток после операции 3,25 мг/кг 24 часа Сутки 6 и 17

ВВЕДЕНИЕ ТЕСТИРУЕМОГО И КОНТРОЛЬНОГО ПРЕПАРАТОВ

Путь введения

Тестируемые и контрольные препараты вводили посредством внутривенной инъекции. Животных, распределенных в группу 1, не обрабатывали носителем или тестируемыми препаратами; эти животные служили в качестве совпадающих по возрасту контролей без обработки. Частота, длительность и доза введения являлись такими, как описано в таблицах 5-8. Объем дозы составлял приблизительно 1 мл на кг.

Введение тестируемого препарата

Тестируемые и контрольные препараты вводили через хвостовую вену. Конкретные дозы основывались на самом последнем измерении массы тела. Если не указано иначе Sponsor дозу вводили посредством болюсной инъекции.

Получение тестовой системы

Хирургическое вмешательство - Лигирование левой передней нисходящей артерии

Хирургические вмешательства проводили в Charles River Laboratories, как описано в Charles River Laboratories Surgical Capabilities Reference Paper, Vol. 13, No. 1, 2005. В кратком изложении, в области грудной клетки проводят кранио-каудальный разрез, немного слева от грудинной кости, через кожу и грудные мышцы. Третье и четвертое ребра разрезают, и межреберные мышцы отделяют тупым способом. Быстро входят в полость грудной клетки и полностью раскрывают перикард. Сердце временно выводят на поверхность через разрез. Определяют легочный конус и левое ушко. Для пропускания участка шелковой нити 5-0 под левой передней нисходящей коронарной артерией используют малую кривую игл. Лигатуру связывают, и сердце снова помещают в грудную клетку. Воздух в грудной полости осторожно выдавливают, пока грудная стенка и кожный разрез не закроются. Животное приводят в сознание, используя приточно-вытяжную вентиляцию, и помещают в богатую кислородом среду.

Послеоперационное восстановление

В Charles River Laboratories проводили кратковременный послеоперационный мониторинг и введение соответствующих анальгетиков, как описано в Charles River Laboratories Surgical Capabilities Reference Paper, Vol. 13, No. 1, 2005.

Для оценки у животных признаков боли или инфекции проводили долговременный послеоперационный мониторинг. Ежедневный осмотр участка разреза продолжали в течение 7 суток после поступления животных. По мере необходимости осуществляли дополнительное лечение боли и проводили антимикробную терапию.

Таблица 9
Предусмотренные лекарственные средства и дозировки
ЛЕКАРСТВЕННОЕ СРЕДСТВО ИНТЕРВАЛ, ДОЗА И ПУТЬ ВВЕДЕНИЯ
ЕЖЕДНЕВНО ПОСЛЕ ОПЕРАЦИИ ECHO НА СУТКИ 1/7* ECHO НА СУТКИ 12/18* ECHO НА СУТКИ 22/28* ECHO НА СУТКИ 32/38* и вскрытие
Изофлуран В зависимости от эффекта, ингаляция В зависимости от эффекта, ингаляция В зависимости от эффекта, ингаляция В зависимости от эффекта, ингаляция
Бупренорфин 0,01 мг/кг, в/м (только по мере необходимости) - - - -
*- Сутки процедуры ECHO, определенные распределением животных в группы, как указано ниже

ОЦЕНКА ПРИ ПРИЖИЗНЕННОМ ИССЛЕДОВАНИИ

Наблюдения в клетках

Всех животных обследовали по меньшей мере дважды в сутки на заболеваемость, смертность, повреждения и доступность еды и воды. Любых животных с плохим состоянием здоровья определяли для дальнейшего наблюдения и возможного безболезненного умерщвления.

Масса тела

Массу тела измеряли и записывали по меньшей мере один раз до случайного распределения и раз в неделю в течение исследования.

Потребление пищи

Потребление пищи не измеряли, но отсутствие аппетита документировали.

Эхокардиографические исследования

У всех животных, распределенных в группу 1, эхокардиографические исследования проводили на сутки 1, 12, 22 и сутки 32 после поступления (сутки 0). У всех животных, распределенных в группы 2-5, эхокардиографические исследования проводили на сутки 7, 18, 28 и сутки 38 после хирургического вмешательства, проводимого в Charles River Laboratories (сутки 0).

Для эхокардиографической оценки, каждое животное анестезировали в соответствии с таблицей 5 и их мех с грудной клетки обрезали. На эхокардиографический передатчик наносили контактный гель и получали изображение для измерения сердечной функций на нескольких уровнях. Изображения получали у каждого животного в направлении короткой оси (на среднесосочковом уровне, или другом уровне в зависимости от расположения наблюдаемой посредством эхокардиографии области инфаркта).

Эхокардиографические параметры

ECHO изображения получали на уровне среднесосочковой мышцы или другом уровне, в зависимости от расположения наблюдаемой посредством эхокардиографии области инфаркта левого желудочка. Записывали M-режим и 2-D изображения и хранили на CD и/или MOD. Получаемые посредством ECHO измеряемые параметры включали: толщину стенки внутрижелудочковой перегородки (диастола); единицы = см; толщину стенки внутрижелудочковой перегородки (систола); единицы = см; внутреннее сечение левого желудочка (диастола); единицы = см; внутреннее сечение левого желудочка (систола); единицы = см; толщину стенки левого желудочка на папиллярном уровне (диастола); единицы = см; толщину стенки левого желудочка на папиллярном уровне (систола); единицы = см; конечный диастолический объем; единицы = мл; конечный систолический объем; единицы = мл; фракцию выброса; записываемую в виде процента; систолический объем; единицы = мл; и фракцию укорочения, %; записываемую в виде процента.

БЕЗБОЛЕЗНЕННОЕ УМЕРЩВЛЕНИЕ

Состояние агонии

Любое животное в состоянии агонии, как определяют в соответствии с Testing Facility Standard Operating Procedure, безболезненно умерщвляли из соображений гуманности. Всех животных, безболезненно умерщвляемых в конечной стадии болезни или найденных мертвыми, подвергали обычному вскрытию.

Способ безболезненного умерщвления

Безболезненное умерщвление проводили посредством инъекции насыщенного хлорида калия в полую вену в соответствии с одобренным способом гарантированной гибели, например кровопусканием.

Конечный исход

Всех животных, взятых в исследование, подвергали безболезненному умерщвлению в соответствии с планируемым для них вскрытием или, если необходимо, подвергали безболезненному умерщвлению в конечной стадии болезни.

РЕЗУЛЬТАТЫ

Исследование 1 - Обработка крыс GGF2 с концентрацией 0,625 мг/кг в/в раз в сутки приводила к значимому улучшению сердечной функции, как показано в настоящем описании по изменениям во фракции выброса и фракции укорочения. Фрагмент EGF-ld не приводил к такой же степени улучшения. См. таблицу 5.

Исследование 2 - Обработка крыс GGF2 с концентрацией 0,625 и 3,25 мг/кг в/в раз в сутки приводила к значимому улучшению сердечной функции, как показано в настоящем описании по изменениям во фракции выброса и фракции укорочения. В течение периода обработки также наблюдали значимые улучшения конечного систолического и конечного диастолического объемов. См. таблицу 6.

Результаты исследования 3 - Обработка крыс GGF2 с концентрацией 3,25 мг/кг в/в раз в 24, 48 или 96 часов приводила к значимому улучшению сердечной функции, как показано в настоящем описании по изменениям во фракции выброса и фракции укорочения. В течение периода обработки также наблюдали значимые улучшения конечного систолического и конечного диастолического объемов. См. таблицу 7.

В предыдущих публикациях (Liu et al.) показано, что для оптимальной стабильности и активности нейрегулина необходим белок-носитель, такой как BSA. GGF2 продемонстрировал стабильность без носителей, таких как BSA. Этот эксперимент планировали для тестирования того, является ли GGF2 стабильным и активным при режиме лечения без BSA. Через 10 суток обработки и содержащие BSA и не содержащие BSA составы с GGF2 приводили к улучшениям фракции выброса по сравнению с контролями с носителем, сходными с улучшениями, наблюдаемыми в предыдущих исследованиях. Таким образом, из этого исследования очевидно, что BSA или другой белок-носитель в составах с GGF2 для лечения CHF не требуются. См. таблицу 8.

Таблица 10
Патологические данные
Дозирование Гиперплазия оболочки (NSH) седалищного нерва NSH молочной железы Изменения участка инъекции/кожи Воздействие на сердце
Ежедневное п/к ++ ++ ++ +
Ежедневное в/в + + + +/-
в/в с интервалом 48 часов +/- - -
в/в с интервалом 96 часов - - - -
++ присутствует часто;
+ присутствует;
+/- наблюдают изредка,
- редко или не наблюдают

Как показано в таблице 10, интермиттирующее дозирование GGF2 снижает побочные эффекты, ассоциированные с избыточными уровнями экзогенно вводимого GGF2. Авторы настоящего изобретения обнаружили, что это открытие справедливо вне зависимости от того, вводят ли GGF2 внутривенно или подкожно.

Через сутки дозирования иногда наблюдают гиперплазию и воздействие на сердце. Авторы изобретения при менее частом дозировании этого не наблюдали.

Для более полного описания положения в области, к которой принадлежит изобретение в настоящей заявке указано несколько публикаций и патентных документов. Все публикации и патентные заявки, указанные в этом описании включены в настоящее описание в качестве ссылки в той же степени, как если бы каждая независимая публикация или патентная заявка была конкретно и индивидуально указана, как включенная в качестве ссылки.

1. Применение терапевтически эффективного количества GGF2, содержащего домен, подобный эпидермальному фактору роста (EGF-подобный), в лечении или профилактике сердечной недостаточности у млекопитающего путем инъекции млекопитающему терапевтически эффективного количества пептида GGF2 каждые 48 часов дозой, составляющей от приблизительно 0,001 мг/кг до приблизительно 10 мг/кг.

2. Применение по п.1, в котором инъецируемая доза пептида GGF2 составляет от приблизительно 0,01 мг/кг до приблизительно 10 мг/кг.

3. Применение по п.1, в котором инъецируемая доза пептида GGF2 составляет от приблизительно 0,1 мг/кг до приблизительно 10 мг/кг.

4. Применение по п.1, в котором инъецируемая доза пептида GGF2 составляет от приблизительно 1 мг/кг до приблизительно 10 мг/кг.

5. Применение по п.1, в котором инъецируемая доза пептида GGF2 составляет от приблизительно 0,01 мг/кг до приблизительно 1 мг/кг.

6. Применение по п.1, в котором инъецируемая доза пептида GGF2 составляет приблизительно 0,625 мг/кг.

7. Применение по п.1, в котором инъецируемая доза пептида GGF2 составляет приблизительно 3,25 мг/кг.

8. Применение по п.1, в котором инъекция терапевтически эффективного количества пептида GGF2 является внутривенной или подкожной инъекцией.

9. Применение по п.1, где указанное млекопитающее представляет собой человека.

10. Применение по п.1, где указанный пептид GGF2 представляет собой рекомбинантный GGF2 человека.

11. Применение по п.1, где пептид представляет собой:
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ (SEQ ID NO:22).

12. Применение по п.1, где пептид GGF2 представляет собой:
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELY (SEQ ID NO:21).

13. Применение по одному из пп.1-12, в котором инъекция является внутривенной.

14. Применение по одному из пп.1-12, в котором инъекция является подкожной.



 

Похожие патенты:

Изобретение относится к производным фенола формулы (1), где R1 представляет собой С1-С6 алкильную группу, С1-С6 алкинильную группу, С1-С6 галогеналкильную группу, С1-С6 алкилсульфанильную группу или атом галогена, R2 представляет собой циано группу или атом галогена, R3 представляет собой атом водорода, и Х представляет собой -S(=O)2.

Группа изобретений относится к композициям, содержащим вазоактивный интестинальный пептид (VIP) или его фрагменты, и к применению таких композиций в лечении фиброза аорты.

Настоящее изобретение относится к области фармацевтики и представляет собой фармацевтическую композицию для парентерального введения, включающую субмикронные частицы сложного эфира докозагексаеновой кислоты, диспергированные в водной фазе с использованием смеси по меньшей мере двух сурфактантов, выбранных из а) по меньшей мере одного полиоксиэтиленового эфира жирной кислоты и b) по меньшей мере одного производного фосфолипида, а также способ получения указанной фармацевтической композиции.

Настоящее изобретение относится к области иммунологии. Предложен слитый белок - антагонист Notch1, который состоит из Fc-области человека, слитой с EGF-подобным повтором 1-13 Notch1 или EGF-подобным повтором 1-24 Notch1.

Изобретение относится к новым соединениям общей формулы (1), которые обладают сродством к µ-опиоидному рецептору и ORL1-рецептору. Изобретение также относится к применению этих соединений для получения лекарственных средств, которые могут быть использованы при лечении страха, стресса и связанных со стрессом синдромов, депрессий, эпилепсии, болезни Альцгеймера, старческого слабоумия, общих познавательных дисфункций, нарушений обучения и памяти (как ноотроп), синдромов отмены, злоупотребления алкоголем и/или наркотиками и/или злоупотребления медикаментами и/или алкогольной, наркотической, медикаментозной зависимости и др.

Изобретение относится к би- и полициклическим замещенным изохинолину и изохинолинонам формулы (I), или к его стереоизомерным и/или таутомерным формам и/или к его фармацевтически приемлемым солям, где R1 представляет собой ОН; R3, R4, R5 и R8 представляют собой Н; R7 представляет собой галоген или (C1-C6) алкил; R6 представляет собой один (С1-С4) алкилен, присоединенный к циклоалкильному кольцу, в котором (С1-С4)алкилен образует вторую связь с другим атомом углерода циклоалкильного кольца с образованием бициклической кольцевой системы, где в бициклической кольцевой системе один атом углерода замещен группой, независимо выбираемой из О, S или SO2; или если m и s равны 2 или m равно 3 и s равно 1, R6 представляет собой группу СН2-СН-(СН2)2, которая через одну группу СН2 присоединена к циклоалкильному кольцу, а две другие группы СН2 присоединены к различным атомам углерода циклоалкильного кольца, и если m равно 3 и s равно 3, R6 представляет собой две метиленовые группы, присоединенные к различным атомам углерода циклоалкильного кольца, где метиленовые группы или группа СН2-СН-(СН2)2 присоединены к атомам углерода циклоалкильного кольца и образуют систему адамантана формулы , где L может быть присоединен к любому вторичному или третичному атому углерода, или R6 вместе с R11 и атомом N образуют (С5) гетероциклоалкил, который соединен с циклоалкильным остатком в виде спироциклической кольцевой системы, где бициклическая кольцевая система, или система адамантана, или содержащая (С5) гетероциклоалкил кольцевая система представляют собой незамещенные или необязательно замещенные заместителем R9; R9 представляет собой (C1-C6)алкил, (С2-С6)алкенил, (С6)арил или циклопропил; R11 и R12 независимо друг от друга представляют собой Н или (C1-C6)алкилен-(C6)арил; n равно 0 или 1; m равно 2 или 3; s равно 1, 2 или 3; L представляет собой О; его стереоизомерные и/или таутомерные формы и/или его фармацевтически приемлемые соли.

Изобретение относится к области биотехнологии, конкретно к получению пептида, являющегося миметиком ApoA-I, и может быть использовано в медицине. Указанный пептид характеризуется последовательностью Lys-Leu-Lys-Gln-Lys-Leu-Ala-Glu-Leu-Leu-Glu-Asn-Leu-Leu-Glu-Arg-Phe-Leu-Asp-Leu-Val-Inp (SEQ ID NO: 16).

Изобретение относится к экспериментальной биологии, медицине и может быть использовано для изучения вопросов профилактики кардиопатии. Для этого в первый день эксперимента моделируют кардиопатию однократным подкожным введением крысам равнодолевой смеси нативного яичного альбумина и полного адъюванта Фрейнда.

Изобретение относится к фармацевтической промышленности и медицине. Предлагается применение гидорхлорида тpeo-3-фенилглутаминовой кислоты следующей структурной формулы: в качестве средства, обладающего кардиопротекторными, антиагрегантными, антикоагулянтными и мембранопротекторными свойствами в условиях стрессорного воздействия.

Изобретение относится к новому соединению сальвианоловой кислоты Л с общей формулой (I), к его фармацевтически приемлемым солям и гидролизуемым эфирам, причем соединение сальвианоловой кислоты Л имеет одну пару протонов двойной связи транс-формы и один протон однозамещенной двойной связи; причем соединение сальвианоловой кислоты Л предназначено для лечения сердечно-сосудистых заболеваний, захвата свободных радикалов и/или предупреждения чрезмерного окисления.
Изобретение относится к области медицины, конкретно к фармакологии, средству коррекции нарушений сперматогенеза, вызванных цитостатическим воздействием. Предложено применение конъюгата гранулоцитарного колониестимулирующего фактора, иммобилизированного на низкомолекулярном полиэтиленгликоле, полученного с помощью нанотехнологии электронно-лучевого синтеза - воздействия потока ускоренных электронов с энергией 2,5 МэВ, поглощенной дозой 2-10 кГр и скоростью набора 1,65 кГр/ч в качестве средств для коррекции отдаленных последствий нарушений сперматогенеза при цитостатическом воздействии.

Изобретение относится к фармацевтической промышленности и представляет собой туалетную бумагу с лечебно-профилактическими свойствами, включающую бумажную основу с введенными в нее лекарственными препаратами в виде наночастиц равномерно в весь ее объем в соотношении их массы к массе бумаги от 1:50 до 1:1000, причем в качестве лекарственных препаратов, введенных в сухую бумажную основу, используются либо комплекс из Hamamelis Virginiana в виде настойки или в гомеопатических разведениях 3-6-С, Aesculus Hyppocastanum в виде настойки или в разведениях 3-6-С и Acidum Nitricum в разведениях 6-12-С, либо комплекс из Hamamelis Virginiana в виде настойки или в разведениях 3-6-С, Aesculus Hyppocastanum в виде настойки или в разведениях 3-6-С, Acidum Nitricum в разведениях 6-12-С и ромашки (Matricaria Chamomilla) в виде настойки или в разведениях 3-6-С.

Изобретение относится к фактору роста фибробластов 21 (FGF21), более конкретно к производным соединений FGF21, имеющим ковалентно присоединенное связующее альбумина формулы A-B-C-D-E-, и их фармацевтическому применению, в частности, для лечения диабета, дислипидемии, ожирения, сердечно-сосудистых заболеваний, метаболического синдрома и/или неалкогольной жировой болезни печени (НАЖБП).

Группа изобретений относится к медицине, а именно к косметологии, и может быть использована для лечения старения кожи. Для чего используют средство, содержащее основной фактор роста фибробластов (bFGF) как единственный активный ингредиент, которое вводится внутрикожно или подкожно в место рубца, или в окружающую его часть, например келоида, гипертрофического рубца и рубцовой контрактуры; кроме того, средство также предназначено для лечения одного или более видов старения кожи, выбранных из следующего перечня: морщины на коже, обвисшая кожа, грубая кожа, истончение кожи и снижение упругоэластичности кожи из-за разрыва дермальных тканей или снижения функций фибробластовых клеток.
Изобретение относится к области биотехнологии и медицины. Предложена композиция, содержащая стволовые клетки из амниотической жидкости человека с фенотипом CD73+/CD90+/CD105+/CK19+, питательную среду, эритропоэтин, эпидермальный фактор роста и коллаген, взятые в эффективном количестве.

Группа изобретений относится к медицине и может быть использована для лечения субъекта, имеющего медленно заживающую, плохо заживающую, неполностью заживающую, раскрывающуюся или хроническую рану.
Группа изобретений относится к области биотехнологии. Предложен способ очистки фактора, способствующего заживлению ран, представляющего собой фактор роста гепатоцитов (HGF).

Изобретение относится к области генной инженерии, конкретно к созданию мутеинов рецептора фактора роста фибробластов (FGFR), и может быть использовано в медицине. Полипептид мутеина кислотной зоны внеклеточного домена (ECD) рецептора FGFR4 представляет собой химеру кислотной зоны FGFR4 ECD или вариант длинного кислотного бокса FGFR4 и имеет большее количество кислотных остатков в линкерной зоне D1-D2, чем FGFR4 ECD дикого типа.
Изобретение относится к медицине, а именно к травматологии и ортопедии, позволяет изготавливать биологически активный препарат из аутокрови для ускорения процессов регенерации тканей организма.

Изобретение относится к области биотехнологии, конкретно к получению аналогов панкреатического полипептида человека, и может быть использовано в медицине. Предложенные аналоги отличаются от нативного панкреатического полипептида человека заменами аминокислот по одному или более остатков, причем в положении 0 снабжены дополнительной аминокислотой, представляющей собой Gly.
Изобретение относится к медицине, в частности к экспериментальной фармакологии и офтальмологии, и может быть использовано для профилактики ишемических состояний сетчатки. Способ включает моделирование патологии сетчатки и профилактику ее введением лабораторному животному рекомбинантного эритропоэтина в качестве прекондиционирующего агента. Эритропоэтин вводят однократно в 1-й день эксперимента внутрибрюшинно в дозе 50 МЕ/кг, за 30 минут до моделирования патологии. Способ приводит к выраженной коррекции ишемии сетчатки за счет механизма открытия АТФ-зависимых К+-каналов и последующего индуцирования механизмов метаболической адаптации при реализации эффекта прекондиционирования. 1 пр., 1 табл.
Наверх