Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения



Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения
Антитела, связывающиеся с лизилоксидазоподобным ферментом-2 (loxl2), и способы их применения

 


Владельцы патента RU 2549684:

ДЖИЛИД БАЙОЛОДЖИКС, ИНК. (US)

Изобретение относится к области биохимии, в частности к выделенному моноклональному анти-LOXL2 антителу или его антиген-связывающему фрагменту, а также к конъюгатам, их содержащим. Раскрыта фармацевтическая композиция для лечения заболевания, связанного с ангиогенезом, фиброза, опухоли или метастазов, включающая вышеуказанное выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент в эффективном количестве. Также изобретение относится к способу определения наличия и/или уровней LOXL2 в биологическом образце, к способу ингибирования активности LOXL2, к способу ослабления роста экспрессирующей LOXL2 опухоли у субъекта, нуждающегося в этом, к способу подавления ангиогенеза у субъекта, нуждающегося в этом, к способу подавления фиброзного заболевания у субъекта, нуждающегося в этом, а также к способу мониторинга реакции субъекта на терапию против LOXL2 с использованием вышеуказанного антитела или его антиген-связывающего фрагмента и вышеуказанного конъюгата. Изобретение позволяет эффективно лечить заболевания, связанные с LOXL2. 11 н. и 17 з.п. ф-лы, 6 ил., 6 табл., 9 пр.

 

Уровень техники

Рак является серьезной проблемой общественного здравоохранения в США и других развитых странах. В настоящее время одна из четырех смертей в США приходится на рак. Противораковая терапия заключается в лечении химиотерапевтическими препаратами, чтобы уничтожить раковые клетки. Однако часть раковых клеток бывает устойчива к лекарственной терапии и выживает, повторно заселяя исходные места и удаленные от них области метастазирования, что приводит к заметным рецидивам заболевания и смертности. Полагают, что многие опухолевые клетки карциномы, обладающие повышенной инвазивностью и способностью к метастазированию и измененной лекарственной устойчивостью, подвергаются морфологической трансформации, включающей ЕМТ или сходной с ЕМТ (эпителиально-мезенхимальный переход). Клетки, подвергающиеся ЕМТ, теряют нормальные адгезивные свойства эпителиальных клеток и подвергаются ряду изменений, включающих утрату экспрессии Е-кадгерина и экспрессию маркеров мезенхимы, повышение подвижности, усиление инвазивности и повышение устойчивости к клеточной смерти.

Ферменты типа лизилоксидазы были очищены из курицы, крысы, мыши, быка и человека. Все известные лизилоксидазные ферменты содержат общий каталитический домен длиной примерно в 205 аминокислот, локализованный в С-концевой части белка и содержащий активный центр фермента. Активный центр содержит медь-связывающий центр, который включает консервативную последовательность аминокислот, содержащую 4 остатка гистидина, координирующие атом Cu(II). Активный центр также содержит кофактор лизилтирозилхинон (LTQ), образованный внутримолекулярной ковалентной связью между остатком лизина и остатком тирозина (Lys314 и Tyr349 у лизилоксидазы крысы и Lys320 и Tyr355 у лизилоксидазы человека, соответственно). Окружающая остаток тирозина последовательность, образующая кофактор LTQ, также является консервативной среди лизилоксидазных ферментов. Каталитический домен также содержит 10 консервативных остатков цистеина, участвующих в образовании 5 дисульфидных связей. Каталитический домен также включает фибронектин-связывающий домен. Наконец, в каталитическом домене содержится аминокислотная последовательность, подобная домену рецепторов факторов роста и цитокинов, содержащему 4 остатка цистеина.

Сущность изобретения

Настоящим изобретением предусмотрены антитела, которые специфически связываются с полипептидом LOXL2, а также предусмотрены содержащие их композиции. Антитела могут применяться в различных способах лечения и диагностики, которые также предусмотрены.

Соответственно, настоящее изобретение включает, среди прочего, следующие воплощения.

1. Выделенное антитело к лизилоксидазоподобному ферменту-2 (LOXL2), которое специфически связывается с эпитопом, определяемым аминокислотами 325-434 из последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1.

2. Выделенное антитело из воплощения 1, в котором эпитоп включает аминокислоты из последовательности TPAMGLQKK (SEQ ID NO:2).

3. Выделенное антитело из воплощения 1, в котором антитело ингибирует энзиматическую активность полипептида LOXL2.

4. Выделенное антитело из воплощения 1, в котором антитело не ингибирует энзиматическую активность полипептида LOXL2.

5. Выделенное антитело из воплощения 1, в котором антитело связывается с эпитопом со сродством от 107 М-1 до 1012 М-1.

6. Выделенное антитело из воплощения 1, в котором антитело содержит тяжелую цепь, причем тяжелая цепь антитела принадлежит к изотипу IgG1, IgG2, IgG3 или IgG4.

7. Выделенное антитело из воплощения 1, в котором связывающий агент помечен детектируемой меткой.

8. Выделенное антитело из воплощения 1, в котором антитело представляет собой Fv, scFv, Fab, F(ab′)2 или Fab′.

9. Выделенное антитело из воплощения 1, в котором антитело является гуманизированным.

10. Выделенное антитело из воплощения 1, в котором антитело является химерным.

11. Выделенное антитело из воплощения 1, в котором антитело содержит ковалентно связанную молекулу, выбранную из группы, состоящей из непептидных синтетических полимеров, липидов, жирных кислот, полисахаридов, углеводов или контрастных средств.

12. Выделенное антитело из воплощения 11, в котором синтетический полимер представляет собой полимер поли(этиленгликоля).

13. Выделенное антитело из воплощения 1, в котором антитело иммобилизовано на твердой подложке.

14. Выделенное антитело из воплощения 1, в котором антитело содержит противораковое химиотерапевтическое средство, ковалентно или нековалентно связанное с антителом.

15. Набор для лечения заболеваний, связанных с LOXL2, включающий композицию, содержащую выделенный LOXL2-связывающий агент из воплощения 1 и фармацевтически приемлемый носитель или эксципиент.

16. Набор из воплощения 15, в котором заболевание, связанное с LOXL2, представляет собой рак, метастазы, ангиогенез или фиброз.

17. Набор из воплощения 15, в котором LOXL2-связывающий агент включает детектируемую метку, терапевтическое средство или то и другое.

18. Способ диагностики заболеваний, связанных с LOXL2, включающий:

определение уровня LOXL2 в образце от субъекта путем контактирования данного образца с выделенным антителом из воплощения 1,

причем изменение уровня LOXL2 в образце по сравнению с контрольным образцом указывает на наличие заболевания, связанного с LOXL2.

19. Способ из воплощения 18, в котором заболевание, связанное с LOXL2, представляет собой рак, метастазы, ангиогенез или фиброз.

20. Способ из воплощения 19, в котором повышение уровня LOXL2 в образце по сравнению с контрольным образцом указывает на наличие опухоли или ее метастазов либо увеличение опухоли или рост метастазов.

21. Способ из воплощения 20, в котором контрольный образец взят у субъекта в более раннее время или из непораженной ткани того же типа либо это образец от другого индивида.

22. Способ из воплощения 18, в котором антитело помечено детектируемой меткой.

23. Способ ингибирования активности LOXL2 путем контактирования образца или клеточной ткани с выделенным антителом из воплощения 1.

24. Способ из воплощения 23, в котором контактирование происходит in vitro или ex vivo.

25. Способ из воплощения 23, в котором контактирование происходит in vivo.

26. Способ из воплощения 23, в котором ингибирование LOXL2 ослабляет заболевание у субъекта из группы, состоящей из опухолевого роста, ангиогенеза или фиброза.

27. Способ ослабления опухолевого роста у субъекта, включающий введение субъекту антитела из воплощения 1.

28. Способ из воплощения 27, в котором опухоль представляет собой первичную опухоль или метастазирующую опухоль.

29. Способ из воплощения 27, в котором опухоль представляет собой твердую опухоль.

30. Способ подавления ангиогенеза у субъекта, включающий введение субъекту антитела из воплощения 1.

31. Способ подавления фиброзного заболевания у субъекта путем введения субъекту антитела из воплощения 1.

32. Способ мониторинга реакции субъекта на терапию против LOXL2 путем детектирования уровня и/или активности LOXL2 с помощью антитела из воплощения 1.

Краткое описание фигур

На фиг.1 представлена аминокислотная последовательность белка LOXL2 человека (SEQ ID NO:1). Отмечена сигнальная последовательность пептида (аминокислоты 1-25), четыре богатые цистеином домена фагоцитарного рецептора (SRCR) и каталитический домен. SRCR1 состоит из аминокислот 58-159, SRCR2 состоит из аминокислот 188-302, SRCR3 состоит из аминокислот 325-425, SRCR4 состоит из аминокислот 435-544 и каталитический домен состоит из аминокислот 548-774.

На фиг.2А представлена схема белка LOXL2 человека, на которой отмечены домены SRCR1, SRCR2, SRCR3 и SRCR4. Также отмечен каталитический домен (отмечен как "LOX-подобный домен") и указано расположение эпитопного тега туе и тега для очистки His6 (отмечен как "6×His"), которые присутствуют в некоторых синтетических конструкциях LOXL2. Под схемой представлены части последовательности, представленные коллекцией доменных полипептидов, которые использовались в экспериментах по картированию, изложенных в примере 4. Также см. таблицу 2.

На фиг.2 В представлены аминокислотные последовательности полипептидов, приведенных схематически на фиг.2А.

На фиг.3 представлены результаты экспериментов ELISA, которые проводились для оценки связывания АВ0023 с различными лизилоксидазными белками человека (лизилоксидазой, которая на рисунке обозначена "LOXFL"; LOXL1, LOXL2, LOXL3 и LOXL4). Использовались различные концентрации антитела АВ0023 против LOXL2 при 1 мкг/мл белка мишени. Только LOXL2 связывается с антителом.

На фиг.4 представлено выравнивание аминокислотных последовательностей доменов SRCR4 из LOXL2 человека, LOXL3 человека и LOXL4 человека.

На фиг.5 представлено выравнивание аминокислотных последовательностей каталитических доменов белков LOXL2 от человека (Н), мыши (М), крысы (R) и макаки Cynomolgus (С). Те остатки у белков мыши, крысы и макаки, которые отличаются от таковых у белка человека, подчеркнуты. Два остатка, по которым изменение хотя бы одной аминокислоты в последовательности крысы до таковой у человека способствует связыванию белка крысы с антителом АВ0030, указаны звездочками над последовательностью.

На фиг.6 представлены аминокислотные последовательности вариабельных участков тяжелой и легкой цепей (VH и VL, соответственно) АВ0023 и полные аминокислотные последовательности тяжелой и легкой цепей АВ0024.

Определения

В настоящем изобретении термин "лизилоксидазный фермент (фермент типа лизилоксидазы)" относится к представителям семейства белков, которые катализируют окислительное дезаминирование ε-аминогрупп остатков лизина и гидроксилизина, которое приводит к превращению пептидил-лизина в пептидил-α-аминоадипиновый-δ-полуальдегид (аллизин) и выделению стехиометрических количеств аммиака и перекиси водорода:

Эта реакция чаще всего протекает внеклеточно, на остатках лизина в коллагене и эластине. Остатки альдегида аллизина реакционноспособны и могут спонтанно конденсироваться с другими остатками аллизина и лизина, вызывая перекрестное сшивание молекул коллагена с образованием коллагеновых волокон.

Лизилоксидазные ферменты были очищены из курицы, крысы, мыши, быка и человека. Все известные лизилоксидазные ферменты содержат общий каталитический домен длиной примерно в 205 аминокислот, локализованный на С-концевой части белка и содержащий активный центр фермента. Активный центр содержит медь-связывающий центр, который включает консервативную последовательность аминокислот, содержащую 4 остатка гистидина, координирующие атом Cu(II). Активный центр также содержит кофактор лизилтирозилхинон (LTQ), образованный внутримолекулярной ковалентной связью между остатком лизина и остатком тирозина (Lys314 и Tyr349 у лизилоксидазы крысы и Lys320 и Tyr355 у лизилоксидазы человека, соответственно). Окружающая остаток тирозина последовательность, образующая кофактор LTQ, также является консервативной среди лизилоксидазных ферментов. Каталитический домен также содержит 10 консервативных остатков цистеина, участвующих в образовании 5 дисульфидных связей. Каталитический домен также включает фибронектин-связывающий домен. Наконец, в каталитическом домене содержится аминокислотная последовательность, подобная домену рецепторов факторов роста и цитокинов, содержащему 4 остатка цистеина.

Первым выделенным и охарактеризованным представителем этого семейства ферментов была лизилоксидаза (ЕС 1.4.3.13), также известная как белок-лизин-6-оксидаза, белок-L-лизин:кислород-6-оксидоредуктаза (дезаминирующая) или LOX. Например, см. Harris et al., Biochim. Biophys. Acta 341: 332-344 (1974); Rayton et al, J. Biol. Chem. 254: 621-626 (1979); Stassen, Biophys. Acta 438: 49-60 (1976).

Впоследствии были открыты и другие лизилоксидазные ферменты. Эти белки стали называть "LOX-подобными" или "LOXL." Все они содержат общий каталитический домен, описанный выше, и обладают сходной ферментативной активностью окислительной лизиндезаминазы.

Сейчас известно, что у человека и мыши существует 5 различных лизилоксидазных ферментов: LOX и четыре родственных LOX или LOX-подобных белка: LOXL1 (его также называют "лизилоксидазоподобным," "LOXL" или "LOL"), LOXL2 (также называют "LOR-1"), LOXL3 и LOXL4. Гены, кодирующие пять различных лизилоксидазных ферментов, располагаются на разных хромосомах. Например, см. Molnar et al. (2003) Biochim Biophys Acta. 1647: 220-24; Csiszar (2001), Prog. Nucl. Acid Res. 70: 1-32; WO 01/83702, опубликованный 8 ноября 2001, и Патент США No. 6,300,092, каждый из которых включен путем ссылки. LOX-подобный белок, названный LOXC, имеющий некоторое сходство с LOXL4, но с другим профилем экспрессии, был выделен из мышиной линии клеток ЕС: Ito et al. (2001) J. Biol. Chem. 276: 24023-24029. Два лизилоксидазных фермента, DmLOXL-1 и DmLOXL-2, были выделены из Drosophila.

Хотя все лизилоксидазные ферменты имеют общий каталитический домен они отличаются друг от друга, в частности, по N-концевым участкам. Четыре LOXL-белка удлинены с N-конца по сравнению с LOX. Так, если препроLOX человека (т.е. первичный продукт трансляции до отщепления сигнальной последовательности, см. ниже) содержит 417 аминокислотных остатков, то LOXL1 содержит 574, LOXL2 - 638, LOXL3 - 753 и LOXL4 - 756 остатков.

Внутри своих N-концевых участков LOXL2, LOXL3 и LOXL4 содержат четыре повтора богатого цистеином домена фагоцитарных рецепторов (SRCR). Эти домены не представлены в LOX или LOXL1. Домены SRCR обнаружены в секретируемых трансмембранных белках или в белках внеклеточного матрикса, причем известно, что они опосредуют связывание лиганда у ряда секретируемых и рецепторных белков: Hoheneste et al. (1999) Nat. Struct. Biol. 6: 228-232; Sasaki et al. (1998) EMBO J. 17: 1606-1613. Наряду с доменами SRCR, LOXL3 содержит сигнал ядерной локализации в N-концевом участке. Богатый пролином домен, по-видимому, уникален для LOXL1: Molnar et al. (2003) Biochim. Biophys. Acta 1647: 220-224. Различные лизилоксидазные ферменты также различаются по профилю гликозилирования.

Термины "антитело" и "иммуноглобулин" охватывают антитела или иммуноглобулины любого изотипа, фрагменты антител, сохраняющие специфическое связывание с антигеном, в том числе фрагменты Fab, Fv, scFv и Fd, химерные антитела, гуманизированные антитела, одноцепочечные антитела и слитые белки, содержащие антиген-связывающую часть и «неантительный» белок. Антитела могут быть помечены детектируемой меткой, например, радиоизотопом, ферментом, образующим детектируемый продукт, флуоресцентным белком и т.п. Антитела также могут быть конъюгированы с другими молекулами, как-то членами специфически связывающихся пар, например, биотином (член специфически связывающейся пары биотин-авидин) и др. Антитела также могут быть связаны с твердой подложкой, включая, без ограничения, полистиреновые чашки или шарики и т.п. Термин также охватывает Fab′, Fv, F(ab′)2 и/или другие фрагменты антител, сохраняющие специфическое связывание с антигеном, и моноклональные антитела. Антитело может быть моновалентным или бивалентным.

"Фрагменты антител" содержат части целого антитела, к примеру, антиген-связывающий или вариабельный участок целого антитела. Примеры фрагментов антител включают фрагменты Fab, Fab′, F(ab′)2 и Fv; диатела; линейные антитела (Zapata et al., Protein Eng. 8 (10): 1057-1062 (1995)); молекулы одноцепочечных антител; и мультиспецифичные антитела, полученные из фрагментов антител. Расщепление антител папаином дает два идентичных антиген-связывающих фрагмента, называемых "Fab"-фрагментами, каждый с одним антиген-связывающим сайтом, и остаточный "Fc"-фрагмент, название которого отражает его способность к кристаллизации. Обработка пепсином дает Р(ab')2-фрагмент, содержащий два антиген-связывающих сайта и все еще способный вызывать перекрестное сшивание антигена.

"Fv" составляет наименьший фрагмент антител, который содержит полный сайт распознавания и связывания антигена. Этот участок состоит из димера вариабельного домена одной тяжелой и одной легкой цепи, тесно связанных нековалентными связями. Именно в этой конфигурации взаимодействуют три участка CDR каждого вариабельного домена, составляя антиген-связывающий сайт на поверхности димера VH-VL. Все вместе эти шесть участков CDR придают антителу специфичность связывания антигена. Однако даже единичный вариабельный домен (или половина Fv, содержащая только три из шести участков CDR, специфичных для антигена) обладает способностью к распознаванию и связыванию антигена, хотя и с меньшим сродством, чем полный сайт связывания.

“Fab”-фрагмент также содержит константный домен легкой цепи и первый константный домен (CH1) тяжелой цепи. Fab-фрагменты отличаются от Fab′-фрагментов добавлением нескольких остатков на карбоксильном конце домена CH1 тяжелой цепи, в том числе одного или нескольких цистеинов из шарнирного участка антител. Fab′-SH обозначает такие Fab′-фрагменты, в которых остатки цистеина в константных доменах содержат свободную тиоловую группу. Р(ab')2-фрагменты антител первоначально были получены в виде пары Fab′-фрагментов, содержащих между ними шарнирные цистеины. Известны и другие химические конъюгаты фрагментов антител.

"Легкие цепи" антител (иммуноглобулинов) из любого вида позвоночных могут относиться к одному из двух четко различающихся типов, называемых каппа и лямбда, исходя из аминокислотной последовательности их константных доменов. В зависимости от аминокислотной последовательности константного домена тяжелых цепей иммуноглобулины могут относиться к различным классам. Существует пять основных классов иммуноглобулинов: IgA, IgD, IgE, IgG и IgM, а некоторые из них могут дополнительно подразделяться на подклассы (изотипы), например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2.

Одноцепочечные фрагменты антител "Fv" или "sFv" содержат домены VH и VL антител, причем эти домены находятся в одной полипептидной цепи. В некоторых воплощениях полипептид Fv дополнительно содержит полипептидный линкер между доменами VH и VL, который дает возможность sFv образовать требуемую для связывания антигена структуру. См. обзор по sFv: Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore, eds., Springer-Verlag, New York, pp.269-315 (1994).

Термин "диатела" относится к небольшим фрагментам антител с двумя антиген-связывающими сайтами, которые содержат вариабельный домен тяжелой цепи (VH), соединенный с вариабельным доменом легкой цепи (VL) в одной и той же полипептидной цепи (VH-VL). При использовании линкера, слишком короткого, чтобы позволить спаривание между двумя доменами на одной и той же цепи, домены вынуждены спариваться с комплементарными доменами другой цепи, создавая при этом два антиген-связывающих сайта. Диатела более подробно описаны, к примеру, в ЕР 404,097; WO 93/11161; и Hollinger et al., Proc. Natl. Acad. Sci. USA, 90: 6444-6448 (1993).

В настоящем изобретении термин "сродство" относится к константе равновесия для обратимого связывания двух агентов и выражается в виде константы диссоциации (Kd). Сродство антител к специфическим антигенам может быть по меньшей мере в 2 раза больше, в 3 раза больше, в 4 раза больше, в 5 раз больше, в 6 раз больше, в 7 раз больше, в 8 раз больше, в 9 раз больше, в 10 раз больше, в 20 раз больше, в 30 раз больше, в 40 раз больше, в 50 раз больше, в 60 раз больше, в 70 раз больше, в 80 раз больше, в 90 раз больше, в 100 раз больше или в 1000 или больше раз больше, чем сродство антител к посторонним аминокислотным последовательностям. Сродство антитела к белку-мишени может составлять, к примеру, от 100 нМ до 0,1 нМ, от 100 нМ до 1 пМ или от 100 нМ до 1 фМ или больше. В настоящем изобретении термин "авидность" относится к устойчивости комплекса из двух или нескольких агентов к диссоциации после разбавления. Термины "иммунореактивный" и "предпочтительно связывается" применяются взаимозаменяемым образом в отношении антител и/или антиген-связывающих фрагментов.

Термин "связывание" относится к прямой ассоциации между двумя молекулами благодаря, к примеру, ковалентным, электростатическим, гидрофобным и ионным взаимодействиям и/или водородным связям, включая такие взаимодействия, как солевые мостики и водные мостики. Рассматриваемое антитело против LOXL2 (например, антитело против LOXL2 или его антиген-связывающий фрагмент) специфически связывается с эпитопом на полипептиде LOXL2. Неспецифическое связывание может относиться к связыванию со сродством менее чем 10-7 М, например, связыванию со сродством 10-6 М, 10-5 М, 10-4 М и т.д.

В настоящем изобретении термин "CDR" или "определяющий комплементарность участок" служит для обозначения несмежных антиген-связывающих центров, находящихся в вариабельных участках полипептидов тяжелой и легкой цепи. Эти конкретные участки были описаны в Kabat et al., J. Biol. Chem. 252: 6609-6616 (1977);

Kabat et al., U.S. Dept. of Health and Human Services, "Sequences of proteins ofimmunological interest" (1991); Chothia et al., J. Mol. Biol. 196: 901-917 (1987); и MacCallum et al., J. Mol. Biol. 262: 732-745 (1996), а их определения включают перекрывающиеся или подгруппы аминокислотных остатков при сравнении их друг с другом. Тем не менее, применение любого из этих определений в отношении CDR антител или привитых антител либо их вариантов должно быть в рамках термина, определенного и используемого нами. Аминокислотные остатки, охватывающие участки CDR, определенные в каждой из вышеприведенных работ, для сравнения приведены ниже в таблице 1.

Таблица 1
Определение участков CDR
Kabat1 Chothia2 MacCallum3
CDR1 VH 31-35 26-32 30-35
CDR2 VH 50-65 53-55 47-58
CDR3 VH 95-102 96-101 93-101
CDR1 VL 24-34 26-32 30-36
CDR2 VL 50-56 50-52 46-55
CDR3 VL 89-97 91-96 89-96
1 Нумерация остатков по номенклатуре Kabat et al., supra
2 Нумерация остатков по номенклатуре Chothia et al., supra
3 Нумерация остатков по номенклатуре MacCallum et al., supra

В настоящем изобретении термин "каркас" в применении к вариабельной области антител служит для обозначения всех аминокислотных остатков вне участков CDR в пределах вариабельной области антител. Каркас вариабельной области обычно представляет собой прерывистую аминокислотную последовательность длиной примерно 100-120 аминокислот, но к нему относятся только те аминокислоты, которые находятся вне участков CDR. В настоящем изобретении термин "каркасный участок" служит для обозначения тех участков каркаса, которые разделены участками CDR.

"Выделенное" антитело представляет собой антитело, которое было идентифицировано и отделено и/или выделено из компонентов своего естественного окружения. Примесными компонентами естественного окружения являются материалы, которые будут мешать диагностическому или терапевтическому применению антитела, и могут включать ферменты, гормоны и другие белковые или небелковые вещества. В некоторых воплощениях выделенное антитело подвергается очистке (1) более, чем на 95% от массы антитела, определенной методом Лоури, к примеру, более, чем на 99% по массе, (2) до степени, достаточной для получения по меньшей мере 15 остатков N-концевой или внутренней аминокислотной последовательности, например, с помощью центрифужного секвенатора, или (3) до гомогенности методом SDS-PAGE в восстановительных или не восстановительных условиях с окрашиванием Кумасси голубым или серебром. Выделенные антитела включают и антитела in situ внутри рекомбинантных клеток, так как по меньшей мере один компонент естественного окружения антитела отсутствует. Но обычно выделенные антитела получают посредством как минимум одной стадии очистки.

Термин "консервативная аминокислотная замена" относится к группированию аминокислот на основе определенных общих свойств. Функциональный способ определения общих свойств индивидуальных аминокислот заключается в анализе нормализованных частот аминокислотных изменений между соответствующими белками гомологичных организмов (Schuiz G.E. and R.H.Schirmer, Principles of Protein Structure, Springer-Verlag). В соответствии с таким анализом можно определить такие группы аминокислот, в которых аминокислоты внутри группы предпочтительно заменяют друг друга и поэтому больше всего похожи друг на друга по своему влиянию на общую структуру белка (Schuiz G.E. and R.H.Schirmer, Principles of Protein Structure, Springer-Verlag). Примеры определенных таким образом групп аминокислот включают:

(i) группу заряженных, состоящую из Glu, Asp, Lys, Arg и His,

(ii) группу положительно заряженных, состоящую из Lys, Arg и His,

(iii) группу отрицательно заряженных, состоящую из Glu и Asp,

(iv) группу ароматических, состоящую из Phe, Tyr и Trp,

(v) группу с азотным кольцом, состоящую из His и Trp,

(vi) группу больших алифатических неполярных, состоящую из Val, Leu и Не,

(vii) группу слегка полярных, состоящую из Met и Cys,

(viii) группу с небольшими остатками, состоящую из Ser, Thr, Asp, Asn, Gly, Ala, Glu, Gin и Pro,

(ix) группу алифатических, состоящую из Val, Leu, He, Met и Cys, и

(x) группу небольших гидроксильных, состоящую из Ser и Thr. "Гомология", "идентичность" или "сходство" относится к сходству последовательности между двумя пептидами или между двумя молекулами нуклеиновой кислоты. Гомологичность и идентичность может определяться сравнением положений в каждой последовательности, которые можно выровнять в целях сравнения. Когда эквивалентное положение в сравниваемых последовательностях занято одним и тем же основанием или аминокислотой, тогда молекулы идентичны по этому положению; когда эквивалентный сайт занят остатками сходных аминокислот (например, сходным по пространственной и/или электронной природе), тогда молекулы можно назвать гомологичными (сходными) по этому положению. Степень гомологичности/сходства является функцией от числа идентичных или сходных аминокислот в положениях, общих для сравниваемых последовательностей. У последовательности, которая "не родственна" или "не гомологична", степень идентичности с контрольной последовательностью составляет менее 40% или менее 25%. При сравнении двух последовательностей отсутствие остатков (аминокислот или нуклеиновых кислот) или наличие дополнительных остатков также снижает степень идентичности или гомологичности/сходства.

Термином "гомологичность" описывается математическое сравнение сходства последовательностей, которое используется для идентификации генов или белков со сходными функциями или мотивами. Контрольная аминокислотная (белковая) последовательность (например, приведенная здесь последовательность) может использоваться в качестве "запрашиваемой последовательности" для проведения поиска по публичным базам данных, к примеру, для идентификации других представителей семейства, родственных последовательностей или гомологов. Такой поиск может проводиться при помощи программ NBLAST и XBLAST (версия 2.0) из Altschul et al. (1990) J. Mol. Biol. 215: 403-10. Поиск BLAST по нуклеотидам может проводиться с помощью программы NBLAST, счет=100, длина слов=12, для получения нуклеотидных последовательностей, гомологичных контрольной нуклеиновой кислоте. Поиск BLAST по аминокислотам может проводиться с помощью программы XBLAST, счет=50, длина слов=3, для получения аминокислотных последовательностей, гомологичных контрольной аминокислотной последовательности. Для получения совмещений с пробелами в целях сравнения можно использовать Gapped BLAST, как описано в Altschul et al. (1997) Nucleic Acids Res. 25 (17): 3389-3402. При использовании программ BLAST и Gapped BLAST можно использовать параметры по умолчанию из соответствующих программ (например, XBLAST и BLAST) (см. www.ncbi.nlm.nih.gov).

В настоящем изобретении "идентичность" означает содержание идентичных нуклеотидных или аминокислотных остатков по соответствующим положениям в двух или нескольких последовательностях при выравнивании последовательностей на максимальное совпадение, т.е. с учетом пробелов и вставок. Идентичность можно легко рассчитать известными способами, в том числе теми, что описаны в Computational Molecular Biology, Lesk A.M., ed., Oxford University Press, New York, 1988; Biocomputing:

Informatics and Genome Projects, Smith D.W., ed., Academic Press, New York, 1993;

Computer Analysis of Sequence Data, Part I, Griffin A.M. and Griffin H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje G., Academic Press, 1987; Sequence Analysis Primer, Gribskov M. and Devereux J., eds., M Stockton Press, New York, 1991; и Carillo H. and Lipman D., SIAM J. Applied Math., 48: 1073 (1988). Способы определения идентичности разработаны так, чтобы они давали наибольшее совпадение между тестируемыми последовательностями. Более того, способы определения идентичности кодифицированы в общедоступных компьютерных программах. Компьютерные методы определения идентичности между двумя последовательностями включают, без ограничения, пакет программ GCG (Devereux J. et al., Nucleic Acids Research 12 (1): 387 (1984)), BLASTP, BLASTN и FASTA (Altschul S.F. et al, J. Mol. Biol. 215: 403-410 (1990); и Altschul et al., Nuc. Acids Res. 25: 3389-3402 (1997)). Программа BLAST X общедоступна из NCBI и других источников (BLAST Manual, Altschul S. et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul S. et al., J. Mol. Biol. 215: 403-410 (1990). Для определения идентичности также можно использовать хорошо известный алгоритм Smith-Waterman.

Термин "существенно идентичный" означает идентичность между первой аминокислотной последовательностью, содержащей достаточное или минимальное количество аминокислотных остатков, (i) идентичных или (ii) представляющих консервативные замены выровненных с ними аминокислотных остатков во второй аминокислотной последовательности с тем, что первая и вторая аминокислотные последовательности могут иметь общий структурный домен и/или общую функциональную активность. К примеру, аминокислотные последовательности, содержащие общий структурный домен, идентичный LOXL2 по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%, именуются существенно или достаточно идентичными полипептиду LOXL2. В контексте нуклеотидных последовательностей термин "существенно идентичная" применяется для обозначения того, что последовательность первой нуклеиновой кислоты содержит достаточное или минимальное число нуклеотидов, идентичных выровненных с ними нуклеотидам в последовательности второй нуклеиновой кислоты с тем, что первая и вторая нуклеотидные последовательности кодируют полипептид, обладающий общей функциональной активностью, или кодируют общий структурный домен полипептидов или общую функциональную активность полипептидов.

Используемые здесь термины "обработка", "лечение", и т.п., обращаются к получению желаемого фармакологического и/или физиологического эффекта. Эффект может быть профилактическим в терминах полного или частичного предотвращения заболевания или его симптома и/или может быть терапевтическим в терминах частичного или полного излечения заболевания и/или неблагоприятного эффекта, связанного с болезнью. "Лечение", используемое здесь, включает любое лечение заболевания у млекопитающих, например, человека, и включает: (а) предотвращение заболевания у субъекта, который может быть предрасположен к болезни, но все еще такой диагноз у него не был поставлен; (b) ингибирование заболевания, т.е. блокирование его развития; и (с) облегчение заболевания, т.е. вызывая его регресс.

Термины "индивид", "субъект", "хозяин" и "пациент", которые используются взаимозаменяемым образом, относятся к млекопитающим, в том числе крысам, мышам, приматам, людям, собакам, кошкам, копытным (например, лошадям, быкам, овцам, свиньям, козам) и т.д.

"Терапевтически эффективное количество" или "эффективное количество" означает такое количество соединения (например, рассматриваемого антитела), которое при введении млекопитающему или другому субъекту для лечения заболевания достаточно для осуществления лечения заболевания. "Терапевтически эффективное количество" варьирует в зависимости от антитела, заболевания и его тяжести и от возраста, веса и т.д. у подлежащего лечению субъекта.

"Биологический образец" охватывает различные типы образцов, получаемые у индивида, которые могут использоваться в диагностических анализах и при мониторинге. Определение охватывает кровь и другие жидкие образцы биологического происхождения, образцы твердых тканей типа биоптатов либо полученные из них культуры тканей или клетки и их потомство. Определение также включает образцы, которые подвергались какой-либо обработке после их получения, как-то обработке реагентами, солюбилизации или обогащению определенными компонентами, такими как полинуклеотиды. Термин "биологический образец" охватывает и клинические образцы, а также включает клетки в культуре, клеточные супернатанты, лизаты клеток, сыворотку, плазму, биологическую жидкость и образцы тканей.

Перед тем, как перейти к дальнейшему описанию настоящего изобретения, следует иметь в виду, что данное изобретение не ограничивается конкретными описанными в нем воплощениями, так как они, конечно, могут варьировать. Также нужно иметь в виду, что применяемая здесь терминология предназначается только для описания конкретных воплощений, но не для ограничения, поскольку сфера действия настоящего изобретения должна ограничиваться только прилагаемой формулой изобретения.

Если приводится диапазон значений, то нужно иметь в виду, что каждое промежуточное значение, до десятых долей единицы из нижнего предела, если только из контекста четко не следует иное, между верхней и нижней границей этого диапазона и любые другие указанные или промежуточные значения в указанном диапазоне охватываются раскрытыми воплощениями. Верхняя и нижняя границы этих меньших диапазонов могут независимо входить в меньшие диапазоны, и они тоже охватываются изобретением, если только они конкретно не исключены из указанного диапазона. Если же указанный диапазон включает одну или обе границы, то исключающие их диапазоны также включены в изобретение.

Если не указано иначе, все используемые здесь технические и научные термины имеют те же значения, которые обычно подразумеваются специалистами в области данной заявки. Все приведенные здесь публикации включены сюда путем ссылки для изложения и описания тех способов и/или материалов, в связи с которыми эти публикации приводятся.

Следует отметить, что в настоящем описании и в прилагаемой формуле изобретения формы единственного числа включают в себя значения множественного числа, если только из контекста четко не следует иное. Следует отметить, что формула изобретения может быть составлена таким образом, чтобы она исключала любые необязательные элементы. При этом данное заявление должно служить априорным основанием для использования такой исключающей терминологии, как "исключительно", "только" и др. в связи с указанием элементов формулы либо для использования "отрицательных" ограничений.

Приведенные здесь публикации представлены исключительно для их изложения до срока подачи настоящей заявки. При этом ничто не должно истолковываться как признание того, будто настоящий объект изобретения не может предвосхищать аналогичные публикации в силу более раннего чем они изобретения. Кроме того, приведенные даты публикаций могут отличаться от действительных дат публикаций, которые могут нуждаться в независимом подтверждении.

Раскрытие сущности изобретения

В настоящем описании представлены агенты, связывающие полипептид лизилоксидазоподобного фермента-2 (LOXL2), т.е. антитела, которые специфически связываются с полипептидом LOXL2, а также представлены содержащие их композиции. Связывающие агенты могут применяться в различных способах лечения и диагностики, которые также представлены.

В настоящем описании представлен выделенный агент, связывающий полипептид лизилоксидазоподобного фермента-2 (LOXL2) (т.е. антитело против LOXL2), который специфически связывается с эпитопом LOXL2, причем эпитоп LOXL2 определяется аминокислотами в аминокислотной последовательности, представленной на фиг.1 (SEQ ID NO:1).

В некоторых воплощениях эпитоп, с которым связывается данное антитело против LOXL2, может определяться: 1) аминокислотами из числа аминокислот 303-547 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; 2) аминокислотами из числа аминокислот 303-425 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; 3) аминокислотами из числа аминокислот 325-434 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; 4) аминокислотами из числа аминокислот 303-434 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; 5) аминокислотами из числа аминокислот 426-547 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; или 6) аминокислотами из числа аминокислот 435-547 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1. Эпитоп, с которым связывается данное антитело против LOXL2, может включать аминокислоты из последовательности TPAMGLQKK (SEQ ID NO:2).

Эпитоп, с которым связывается данное антитело против LOXL2, может включать аминокислоты из последовательности VWGMVCGQNWGIVEAMWCRQLGLGFASNAF QETWYWHG (SEQ ID NO:3).

В некоторых воплощениях данный выделенный LOXL2-связывающий агент ингибирует энзиматическую активность полипептида LOXL2. В некоторых воплощениях ингибирование является неконкурентным. В некоторых воплощениях данный выделенный LOXL2-связывающий агент не ингибирует энзиматическую активность полипептида LOXL2. В некоторых воплощениях данный выделенный LOXL2-связывающий агент конкурирует с антителом АВ0023 за связывание с эпитопом LOXL2. В некоторых воплощениях данный выделенный LOXL2-связывающий агент не конкурирует с антителом АВ0023 за связывание с эпитопом LOXL2.

В некоторых воплощениях эпитоп, с которым связывается данное антитело против LOXL2, может определяться: 1) аминокислотами из числа аминокислот 58-324 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; 2) аминокислотами из числа аминокислот 58-159 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; 3) аминокислотами из числа аминокислот 58-187 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; 4) аминокислотами из числа аминокислот 160-302 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1; или 5) аминокислотами из числа аминокислот 188-302 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1. В некоторых воплощениях агент ингибирует энзиматическую активность полипептида LOXL2. В некоторых воплощениях ингибирование является неконкурентным. В некоторых воплощениях агент не ингибирует энзиматическую активность полипептида LOXL2.

В некоторых воплощениях эпитоп, с которым связывается данное антитело против LOXL2, может определяться: 1) аминокислотами из числа аминокислот 546-744 в аминокислотной последовательности, представленной на фиг.1 и приведенной в SEQ ID NO:1. В некоторых воплощениях агент ингибирует энзиматическую активность полипептида LOXL2. В некоторых воплощениях ингибирование является неконкурентным. В некоторых из этих воплощений агент не ингибирует энзиматическую активность полипептида LOXL2.

В любом из вышеприведенных воплощений данный связывающий агент связывает эпитоп со сродством от 107 М-1 до 1012 М-1. В любом из вышеприведенных воплощений данный связывающий агент содержит тяжелую цепь иммуноглобулина, причем тяжелая цепь антитела может относиться к изотипу IgG1, IgG2, IgG3 или IgG4. В любом из вышеприведенных воплощений данный связывающий агент может быть помечен детектируемой меткой. В любом из вышеприведенных воплощений данное антитело может представлять собой Fv, scFv, Fab, Р(ab')2 или Fab′. Данное антитело может быть гуманизированным или химерным.

В любом из вышеприведенных воплощений данный связывающий агент может быть модифицированным. Например, данный связывающий агент или данное антитело: 1) содержит ковалентно связанный непептидный синтетический полимер; 2) содержит полимер полиэтиленгликоль; 3) содержит ковалентно связанную молекулу липида или жирной кислоты; 4) содержит ковалентно связанную молекулу полисахарида или углевода; 5) содержит контрастный агент; 6) иммобилизован на твердой подложке; 7) представляет собой одноцепочечное антитело Fv (scFv); 8) представляет собой мультимеризованный scFv; или 9) содержит противораковое химиотерапевтическое средство, ковалентно или не ковалентно связанное с антителом.

В настоящем описании представлен набор для лечения заболеваний, связанных с LOXL2, включающий: композицию, содержащую выделенный LOXL2-связывающий агент, как описано здесь; и фармацевтически приемлемый носитель или эксципиент. В некоторых воплощениях связанное с LOXL2 заболевание представляет собой опухоль, метастазы, ангиогенез или фиброз. В некоторых воплощениях LOXL2-связывающий агент содержит детектируемую метку, терапевтическую молекулу или то и другое. В некоторых воплощениях композиция свободна от пирогенов. В некоторых воплощениях композиция лиофизилизована.

В настоящем описании представлен способ диагностики заболеваний, связанных с LOXL2, включающий: определение уровня LOXL2 в образце от субъекта путем контактирования образца с данным выделенным LOXL2-связывающим агентом, причем изменение уровня LOXL2 в образце по сравнению с контрольным образцом указывает на наличие заболевания, связанного с LOXL2. В некоторых воплощениях связанное с LOXL2 заболевание представляет собой опухоль, метастазы, ангиогенез или фиброз. В некоторых воплощениях увеличение уровня LOXL2 в образце по сравнению с контрольным образцом указывает на присутствие опухоли или ее метастазов либо на увеличение опухоли или рост метастазов. В некоторых воплощениях контрольным образцом является образец, взятый у субъекта в более ранний момент времени или из непораженной ткани того же типа, либо образец от другого индивида. В некоторых воплощениях, LOXL2 -связывающий агент помечен детектируемой меткой.

В настоящем описании представлен способ ингибирования LOXL2 путем контактирования образца, клеток или ткани с данным LOXL2-связывающим агентом, т.е. антителом против LOXL2 или его антиген-связывающим фрагментом, или путем введения данного LOXL2-связывающего агента субъекту. В некоторых воплощениях связывание такого агента с LOXL2 ингибирует энзиматическую активность LOXL2. В некоторых воплощениях контактирование происходит in vitro или ex vivo. В некоторых воплощениях контактирование происходит in vivo. В некоторых воплощениях ингибирование LOXL2 уменьшает опухолевый рост и/или метастазирование у субъекта. В некоторых воплощениях ингибирование LOXL2 ослабляет ангиогенез у субъекта. В некоторых воплощениях ингибирование LOXL2 ослабляет фиброз у субъекта.

В настоящем описании представлен способ уменьшения опухолевого роста у субъекта, включающий введение субъекту данного связывающего агента против LOXL2. В некоторых воплощениях опухоль представляет собой первичную опухоль или метастатическую опухоль. В некоторых воплощениях опухоль представляет собой твердую опухоль.

В настоящем описании представлен способ ингибирования ангиогенеза у субъекта, включающий введение субъекту выделенного связывающего агента против LOXL2.

В настоящем описании представлен способ ингибирования фиброзного заболевания у субъекта, включающий введение субъекту выделенного связывающего агента против LOXL2.

В любом из вышеуказанных способов лечения введение или контактирование может осуществляться парентерально. В любом из вышеуказанных способов лечения способ может дополнительно включать совместное введение второго терапевтического средства. Второе терапевтическое средство может представлять собой терапевтическое биологическое (например, антитело) или химиотерапевтическое средство.

В настоящем описании представлен способ мониторинга реакции субъекта на введение ему связывающего агента против LOXL2 путем детектирования уровня и/или активности LOXL2.

В любом из вышеуказанных способов связывающий агент против LOXL2 может быть помечен детектируемой меткой или конъюгирован, ковалентно либо нековалентно, с терапевтической молекулой.

LOXL2-связывающие агенты

В настоящем описании представлены агенты, которые связываются с одним участком в полипептиде LOXL2, которые обычно именуются "агенты, связывающие полипептид LOXL2", "LOXL2-связывающие агенты" или "связывающие агенты против LOXL2". Связывающие агенты против LOXL2 включают связывающие агенты, которые связываются с участком LOXL2, и связывающие агенты, которые ингибируют энзиматическую активность LOXL2. Такие ингибиторные связывающие агенты включают агенты, которые действуют как конкурентные ингибиторы или как неконкурентные ингибиторы. Подходящими LOXL2-связывающими агентами являются антитела против LOXL2 (или их антиген-связывающие фрагменты).

В настоящем описании представлены антитела, которые специфически связывают LOXL2. Такие антитела также именуются "антитела против LOXL2." Данные антитела против LOXL2 специфически связываются с эпитопом, находящимся в части LOXL2, как описано более подробно ниже.

"Эпитоп" в настоящем изобретении означает смежные или несмежные аминокислотные остатки в полипептиде LOXL2, которые способствуют связыванию между полипептидом LOXL2 и связывающим агентом против LOXL2. Эпитопы, с которыми связывается связывающий агент против LOXL2 типа антител против LOXL2, включают линейные эпитопы (например, эпитопы, образованные смежными участками аминокислот) и конформационные эпитопы (например, эпитопы, образованные несмежными участками аминокислот). Эпитопы, с которыми связывается связывающий агент против LOXL2 типа антител против LOXL2, также именуются "эпитопами LOXL2". Эпитоп LOXL2 (например, остатки в полипептиде LOXL2, составляющие эпитоп) может иметь общую длину от 3 аминокислот до 15 аминокислот или больше, например, эпитоп LOXL2 может иметь общую длину в 3 аминокислоты (а.к.), 4 а.к., 5 а.к., 6 а.к., 7 а.к., 8 а.к., 9 а.к., 10 а.к., 11 а.к., 12 а.к., 13 а.к., 14 а.к., 15 а.к., 20 а.к., 25 а.к., 30 а.к., 40 а.к. или 50 а.к. Как отмечено выше, аминокислоты, составляющие эпитоп LOXL2, могут быть смежными или могут быть несмежными.

Как показано на фиг.1, не подвергнутый процессингу полипептид LOXL2 содержит, в порядке от N-конца к С-концу: a) сигнальный пептид; b) первый богатый цистеином домен фагоцитарных рецепторов (SRCR), именуемый SRCR1; c) второй домен SRCR, именуемый SRCR2; d) третий домен SRCR, именуемый SRCR3; е) четвертый домен SRCR, именуемый SRCR4; и f) каталитический домен. SRCR1 и SRCR2 соединяются 28 аминокислотами; SRCR2 и SRCR3 соединяются 22 аминокислотами; а SRCR3 и SRCR4 соединяются 9 аминокислотами, при этом соединяющие их аминокислоты именуются "соединительными" аминокислотами или "линкерами". Зрелая (или прошедшая процессинг) форма LOXL2 образуется из не подвергнутой процессингу формы при расщеплении между SRCR2 и SRCR3 с высвобождением полипептида, содержащего сигнальную последовательность, SRCR1 и SRCR2. Таким образом, зрелая, процессированная форма LOXL2 содержит, в порядке от N-конца к С-концу: i) SRCR3; ii) линкер; iii) SRCR4; iv) линкер; и v) каталитический домен.

Полипептид LOXL2 содержит последовательность аминокислот, которая по меньшей мере на 90%, на 95%, на 98%, на 99% или 100% идентична аминокислотной последовательности непрерывного отрезка от 400 аминокислот (а.к.) до 450 а.к., от 450 а.к. до 500 а.к., от 500 а.к. до 550 а.к., от 550 а.к. до 600 а.к., от 600 а.к. до 650 а.к., от 650 а.к. до 700 а.к., от 700 а.к. до 750 а.к. или от 750 а.к. до 774 а.к. из аминокислотной последовательности, представленной на фиг.1 (SEQ ID NO:1). В настоящем изобретении "полипептид LOXL2" включает полипептид LOXL2 человека.

В некоторых воплощениях полипептид LOXL2 содержит последовательность аминокислот, которая по меньшей мере на 90%, на 95%, на 98%, на 99% или 100% идентична последовательности аминокислот 1-774 аминокислотной последовательности, представленной на фиг.1 (SEQ ID NO:1).

В некоторых воплощениях полипептид LOXL2 содержит, в порядке от N-конца к С-концу: i) SRCR3; ii) линкер; iii) SRCR4; iv) линкер; и v) каталитический домен; а его аминокислотная последовательность по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична последовательности аминокислот 325-774 аминокислотной последовательности, представленной на фиг.1 (SEQ ID NO:1).

В некоторых воплощениях полипептид LOXL2 содержит, в порядке от N-конца к С-концу: i) SRCR1; ii) линкер; iii) SRCR2; iv) линкер; SRCR3; v) линкер; vi) SRCR4; vii) линкер; и каталитический домен; а его аминокислотная последовательность по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична последовательности аминокислот 58-774 аминокислотной последовательности, представленной на фиг.1 (SEQ ID NO:1).

Непроцессированные и зрелые формы полипептида LOXL2, представленные на фиг.1, по аминокислотной последовательности примерно на 55% идентичны непроцессированным и зрелым формам LOXL3 человека и LOXL4 человека. Участок SRCR3-4 полипептида LOXL2, представленного на фиг.1, по аминокислотной последовательности на 58-60% идентичен участкам SRCR3-4 в LOXL3 человека и LOXL4 человека. Участок SRCR3 полипептида LOXL2, представленного на фиг.1, по аминокислотной последовательности примерно на 64% идентичен участкам SRCR3 в LOXL3 человека и LOXL4 человека. Участок SRCR4 полипептида LOXL2, представленного на фиг.1, по аминокислотной последовательности на 55-57% идентичен участкам SRCR4 в LOXL3 человека и LOXL4 человека. Участок SRCR1-2 полипептида LOXL2, представленного на фиг.1, по аминокислотной последовательности на 45-48% идентичен участкам SRCR1-2 в LOXL3 и LOXL4 человека. Участок SRCR1 полипептида LOXL2, представленного на фиг.1, по аминокислотной последовательности на 57-59% идентичен участкам SRCR1 в LOXL3 человека и LOXL4 человека. Участок SRCR2 полипептида LOXL2, представленного на фиг.1, по аминокислотной последовательности на 39-44% идентичен участкам SRCR2 в LOXL3 человека и LOXL4 человека. Каталитический домен полипептида LOXL2, представленного на фиг.1, по аминокислотной последовательности на 65-67% идентичен каталитическим доменам LOXL3 человека и LOXL4 человека.

В некоторых воплощениях рассматриваемое антитело против LOXL2 проявляет ингибирующую активность в отношении LOXL2, например, в некоторых воплощениях данное антитело против LOXL2 ингибирует энзиматическую активность полипептида LOXL2. В некоторых воплощениях данное антитело против LOXL2 уменьшает опухолевый рост и метастазирование. Таким образом, например, в некоторых воплощениях, данное антитело против LOXL2: 1) специфически связывается с эпитопом на участке LOXL2; 2) ингибирует энзиматическую активность полипептида LOXL2; и 3) уменьшает опухолевый рост и/или метастазирование. В некоторых воплощениях данное антитело против LOXL2: 1) специфически связывается с эпитопом на участке LOXL2; но практически не ингибирует энзиматичекую активность полипептида LOXL2 и практически не снижает опухолевый рост и/или метастазирование.

В некоторых воплощениях рассматриваемое антитело против LOXL2 ингибирует энзиматическую активность LOXL-2 по меньшей мере на 5%, на 10%, на 15%, на 20%, на 25%, на 30%, на 40%, на 50%, на 60%, на 70%, на 80%, на 90% или больше по сравнению с энзиматической активностью полипептида LOXL2 в отсутствие агента.

Рассматриваемое антитело против LOXL2 должно, в некоторых воплощениях, ингибировать энзиматическую активность полипептида LOXL2 со значением концентрации полумаксимального ингибирования (IC50) от 1 нМ до 500 нМ или менее 1 нМ. Например, в некоторых воплощениях, в которых данное антитело против LOXL2 ингибирует энзиматическую активность полипептида LOXL2, антитело против LOXL2 ингибирует энзиматическую активность со значением IC50 от 1 нМ до 10 нМ, от 10 нМ до 50 нМ, от 50 нМ до 100 нМ, от 100 нМ до 150 нМ, от 150 нМ до 200 нМ, от 200 нМ до 250 нМ, от 250 нМ до 300 нМ, от 300 нМ до 350 нМ, от 350 нМ до 400 нМ, от 400 нМ до 450 нМ или от 450 нМ до 500 нМ. В некоторых воплощениях, в которых данное антитело против LOXL2 ингибирует энзиматическую активность полипептида LOXL2, антитело против LOXL2 ингибирует энзиматическую активность со значением IC50 менее 1 нМ.

Будет ли связывающий агент против LOXL2 ингибировать энзиматическую активность LOXL2, можно оценить любым подходящим способом, описанным здесь или известным в этой области. Примеры способов, подходящих для определения эффекта рассматриваемого антитела против LOXL2 на энзиматическую активность полипептида LOXL2, представлены в примерах. Данное антитело против LOXL2 может ингибировать энзиматическую активность полипептида LOXL2, действуя на коллагеновый субстрат (например, коллаген I типа).

В некоторых воплощениях рассматриваемое антитело против LOXL2 практически не ингибирует энзиматическую активность полипептида LOXL2. Например, в некоторых воплощениях данное антитело против LOXL2 ингибирует энзиматическую активность полипептида LOXL2 в любой заметной степени, хотя бы менее чем на 10%, менее чем на 5%, менее чем на 2%, менее чем на 1% по сравнению с энзиматической активностью полипептида LOXL2 в отсутствие антитела против LOXL2. Таким образом, в приведенном ниже обсуждении, если говорится, что данное антитело против LOXL2 не проявляет "ингибирования" энзиматической активности полипептида LOXL2, или если говорится, что данное антитело против LOXL2 "не ингибирует" энзиматическую активность полипептида LOXL2, то антитело против LOXL2 ингибирует энзиматическую активность полипептида LOXL2 в любой заметной степени, хотя бы менее чем на 10%, менее чем на 5%, менее чем на 2%, менее чем на 1% по сравнению с энзиматической активностью полипептида LOXL2 в отсутствие антитела против LOXL2.

В некоторых воплощениях рассматриваемое антитело уменьшает опухолевый рост и/или метастазирование. В некоторых воплощениях данное антитело снижает частоту метастазов относительно таковой в отсутствие антитела, а при дальнейшем тестировании ингибирует рост метастатических опухолей. Ингибирование опухоли может быть количественно измерено любым удобным способом измерения. Встречаемость метастазов можно оценить, изучая относительно распространение (например, количество затронутых систем органов) и относительную массу опухолей в этих органах. Рост метастазов можно установить путем микроскопического или макроскопического анализа, как положено.

Метастазирование опухолей может снижаться примерно на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% или больше. В некоторых воплощениях антитела можно оценивать в сравнении с другими антителами или соединениями, не снижающими энзиматическую активность LOXL2. Тестируемые антитела можно вводить во время прививки опухоли, после установления роста первичной опухоли или после образования местных и/или удаленных метастазов. Однократное или множественное введение тестируемого антитела может проводиться любым удобным способом введения, включая, без ограничения, внутривенное, внутрибрюшинное, внутриопухолевое, подкожное и внутрикожное.

Рассматриваемое антитело против LOXL2 проявляет высокое сродство связывания с эпитопом в полипептиде LOXL2. Например, данное антитело связывается с эпитопом в полипептиде LOXL2 со сродством по меньшей мере 10-7 М, по меньшей мере 10-8 М, по меньшей мере 10-9 М, по меньшей мере 10-10 М, по меньшей мере 10-11 М, по меньшей мере 10-12 М или более 10-12 М. Данное антитело связывается с эпитопом, присутствующем в полипептиде LOXL2, со сродством от 10-7 М до 10-8 М, от 10-8 М до 10-9 М, от 10-9 М до 10-10 М, от 10-10 М до 10-11 М или от 10-11 М до 10-12 М или более 10-12.

Например, в некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с полипептидом LOXL2 (например, с полипептидом LOXL2 человека) с константой диссоциации (Kd), равной или меньше 100 нМ, меньше 10 нМ, меньше 1 нМ, меньше 0,5 нМ, меньше 0,1 нМ, меньше 0,01 нМ или меньше 0,005 нМ, измеренной при температуре 4°С, 25°С, 37°С или 42°С.

В некоторых воплощениях рассматриваемое антитело против LOXL2 относится к изотипу IgG1, IgG2, IgG3 или IgG4. В некоторых воплощениях данное антитело против LOXL2 относится к изотипу IgG4. В некоторых воплощениях антитело содержит замену Ser на Pro по аминокислоте 241 в тяжелой цепи, например, см. Angal et al. (1993) Molec. Immunol. 30:105.

LOXL2-связывающие агенты, которые связываются с эпитопом на участке SRCR3-линкер-SRCR4

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом на участке SRCR 3-линкер- SRCR 4, при этом такой участок именуется "SRCR3-4." Участок SRCR3-4 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-547, аминокислотам 303-544 или аминокислотам 303-547 в SEQ ID NO:1. Так например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-547, аминокислотам 303-544 или аминокислотам 303-547 в SEQ ID NO:1.

Рассматриваемое антитело против LOXL2 в некоторых случаях может конкурировать за связывание с антителом АВ0023, как описано в WO 2009/035791 и US 2009/0053224, и/или АВ0024, аналогом антитела АВ0023, которое включает каркасные (FR) последовательности человека, как описано в WO 2009/035791 и US 2009/0053224. Антитела АВ0023 и АВ0024, описанные в WO 2009/035791 и US 2009/0053224, именуются здесь "АВ0023" и "АВ0024", соответственно. В некоторых воплощениях данное антитело против LOXL2: а) специфически связывается с эпитопом внутри SRCR3-4; и ii) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4. Аминокислотные последовательности АВ0023 и АВ0024 представлены на фиг.6.

Рассматриваемое антитело против LOXL2, которое конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, будет в некоторых воплощениях связываться с тем же эпитопом, что и АВ0023 и АВ0024. Данное антитело против LOXL2, которое конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, в некоторых воплощениях будет связываться с эпитопом, перекрывающимся с тем эпитопом, с которым связываются АВ0023 и АВ0024. Данное антитело против LOXL2, которое конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, в некоторых воплощениях будет связываться с эпитопом, не перекрывающимся с тем эпитопом, с которым связываются АВ0023 и АВ0024; такое ингибирование может быть вызвано, к примеру, пространственным (стерическим) препятствием связыванию АВ0023 или АВ0024 со своими эпитопами, когда рассматриваемое антитело против LOXL2 уже связано со своим эпитопом на участке SRCR3-4, или аллостерическим изменением эпитопа, связываемого АВ0023 и АВ0024, вызванным связыванием анти-LOXL2 со своим эпитопом.

Как отмечено выше, в некоторых воплощениях рассматриваемое антитело против LOXL2 ингибирует энзиматическую активность полипептида LOXL2. Так, в некоторых воплощениях данное антитело против LOXL2: a) специфически связывается с эпитопом внутри SRCR3-4; и b) ингибирует энзиматическую активность LOXL2. В некоторых воплощениях данное антитело против LOXL2: a) специфически связывается с эпитопом внутри SRCR3-4; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4. В других воплощениях данное антитело против LOXL2: а) специфически связывается с эпитопом внутри SRCR3-4; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

В определенных воплощениях антитело АВ0023 и антитело АВ0024 специально исключаются.

В других воплощениях рассматриваемое антитело против LOXL2: а специфически связывается с эпитопом внутри SRCR3-4; и ii) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

В некоторых воплощениях рассматриваемое антитело против LOXL2 содержит область VH и область VL, причем: 1) область VH содержит один, два или три участка CDR вариабельной области тяжелой цепи, содержащих аминокислотную последовательность, которая на 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична CDR вариабельной области тяжелой цепи АВ0023; и 2) область VL содержит один, два или три участка CDR вариабельной области легкой цепи, содержащих аминокислотную последовательность, которая на 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична CDR вариабельной области легкой цепи АВ0023.

Эпитопы на участке линкер-SRCR3-линкер-SRCR4-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-544, аминокислотам 303-545, аминокислотам 303-546 или аминокислотам 303-547 в SEQ ID NO:1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-544, аминокислотам 303-545, аминокислотам 303-546 или аминокислотам 303-547 в SEQ ID NO:1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98% на 99% или на 100% идентична аминокислотам 303-544, аминокислотам 303-545, аминокислотам 303-546 или аминокислотам 303-547 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-544, аминокислотам 303-545, аминокислотам 303-546 или аминокислотам 303-547 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-544, аминокислотам 303-545, аминокислотам 303-546 или аминокислотам 303-547 в SEQ ID NO:1; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-544, аминокислотам 303-545, аминокислотам 303-546 или аминокислотам 303-547 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-544, аминокислотам 303-545, аминокислотам 303-546 или аминокислотам 303-547 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы на участке SRCR3-линкер-SRCR4

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-545, аминокислотам 325-546 или аминокислотам 325-547 в SEQ ID NO:1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-545, аминокислотам 325-546 или аминокислотам 325-547 в SEQ ID NO:1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-545, аминокислотам 325-546 или аминокислотам 325-547 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-545, аминокислотам 325-546 или аминокислотам 325-547 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98% на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-545, аминокислотам 325-546 или аминокислотам 325-547 в SEQ ID NO:1; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-545, аминокислотам 325-546 или аминокислотам 325-547 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-544, аминокислотам 325-545, аминокислотам 325-546 или аминокислотам 325-547 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы на участке линкер-SRCR3-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри участка SRCR3 (но не SRCR4). Участок SRCR3 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-425, аминокислотам 303-425, аминокислотам 303-434 или аминокислотам 325-434 в SEQ ID NO:1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-425, аминокислотам 303-425, аминокислотам 303-434 или аминокислотам 325-434 в SEQ ID NO:1.

а) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-425, аминокислотам 303-425, аминокислотам 303-434 или аминокислотам 325-434 в SEQ ID NO:1; и Ь) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-425, аминокислотам 303-425, аминокислотам 303-434 или аминокислотам 325-434 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-425, аминокислотам 303-425, аминокислотам 303-434 или аминокислотам 325-434 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-425, аминокислотам 303-425, аминокислотам 303-434 или аминокислотам 325-434 в SEQ ID NO:1; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-425, аминокислотам 303-425, аминокислотам 303-434 или аминокислотам 325-434 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-425, аминокислотам 303-425, аминокислотам 303-434 или аминокислотам 325-434 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы на участке линкер-SRCR3

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-425 в SEQ ID NO:1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-425 в SEQ ID NO:1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-425 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-425 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98% на 99% или на 100% идентична аминокислотам 303-425 в SEQ ID NO:1; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-425 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-425 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы на участке 8КСК3-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-434 в SEQ ID NO:1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-434 в SEQ ID NO:1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-434 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-434 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-434 в SEQ ID NO:1; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-434 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 325-434 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы на участке линкер-SRCR3-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98% на 99% или на 100% идентична аминокислотам 303-434 в SEQ ID NO:1.

а) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98% на 99% или на 100% идентична аминокислотам 303-434 в SEQ ID NO:1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-434 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-434 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-434 в SEQ ID NO:1; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-434 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 303-434 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы на участке линкер-SRCR4-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 426-544, аминокислотам 426-545, аминокислотам 426-546 или аминокислотам 426-547 в SEQ ID NO:1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 426-544, аминокислотам 426-545, аминокислотам 426-546 или аминокислотам 426-547 в SEQ ID NO:1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 426-544, аминокислотам 426-545, аминокислотам 426-546 или аминокислотам 426-547 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 426-544, аминокислотам 426-545, аминокислотам 426-546 или аминокислотам 426-547 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 426-544, аминокислотам 426-545, аминокислотам 426-546 или аминокислотам 426-547 в SEQ ID NO:1; и Ь) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 426-544, аминокислотам 426-545, аминокислотам 426-546 или аминокислотам 426-547 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 426-544, аминокислотам 426-545, аминокислотам 426-546 или аминокислотам 426-547 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы на участке SRCR4-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри участка SRCR4 (но не SRCR3). Участок SRCR4 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 435-544, аминокислотам 435-545, аминокислотам 435-546 или аминокислотам 435-547 в SEQ ID NO:1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 435-544, аминокислотам 435-545, аминокислотам 435-546 или аминокислотам 435-547 в SEQ ID NO:1.

а) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 435-544, аминокислотам 435-545, аминокислотам 435-546 или аминокислотам 435-547 в SEQ ID NO:1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 435-544, аминокислотам 435-545, аминокислотам 435-546 или аминокислотам 435-547 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 435-544, аминокислотам 435-545, аминокислотам 435-546 или аминокислотам 435-547 в SEQ ID NO:1; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 435-544, аминокислотам 435-545, аминокислотам 435-546 или аминокислотам 435-547 в SEQ ID NO:1; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 435-544, аминокислотам 435-545, аминокислотам 435-546 или аминокислотам 435-547 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом с которым связывается антитело АВ0023; или iii) связывается с эпитопом не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 435-544, аминокислотам 435-545, аминокислотам 435-546 или аминокислотам 435-547 в SEQ ID NO:1; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы на линкере между SRCR3 и SRCR4

В некоторых случаях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом, который включает аминокислоты в районе линкера между SRCR3 и SRCR4. Участок линкера между SRCR3 и SRCR4 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична следующей аминокислотной последовательности: TPAMGLQKK (SEQ ID NO:2). Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:2.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:2; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:2; b) ингибирует энзиматическую активность LOXL2;

и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98% на 99% или на 100% идентична SEQ ID NO:2; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:2; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:2; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:2; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

Эпитопы в пределах аминокислот 459-497 LOXL2

В некоторых случаях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом в пределах аминокислот 459-497 SRCR4. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом в пределах последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотной последовательности:

VWGMVCGQNWGIVEAMWCRQLGLGFASNAFQETWYWHG (SEQ ID NO:3). а) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:3; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:3; b) ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

c) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:3; b) ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

d) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:3; и b) не ингибирует энзиматическую активность LOXL2.

e) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:3; b) не ингибирует энзиматическую активность LOXL2; и с) конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4, например, i) связывается с тем же эпитопом, что и антитело АВ0023; ii) связывается с эпитопом, перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023; или iii) связывается с эпитопом, не перекрывающимся с тем эпитопом, с которым связывается антитело АВ0023.

f) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична SEQ ID NO:3; b) не ингибирует энзиматическую активность LOXL2; и с) не конкурирует с антителом АВ0023 и/или антителом АВ0024 за связывание с эпитопом внутри SRCR3-4.

В определенных воплощениях специально исключаются антитела, связывающиеся с эпитопом в пределах аминокислотной последовательности VWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHG (SEQ ID NO:3).

LOXL2-связывающие агенты, которые связываются с эпитопом на участке SRCR1-2

В некоторых воплощениях LOXL2-связывающий агент типа рассматриваемого антитела против LOXL2 специфически связывается с эпитопом на участке SRCR1-линкер-SRCR2, при этом такой участок именуется "SRCR1-2." Участок SRCR1-2 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-302 или 58-324 в аминокислотной последовательности, представленной на фиг.1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-302 или 58-324 в аминокислотной последовательности, представленной на фиг.1.

Эпитопы на участке SRCR1-линкер-SRCR2-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-324 в аминокислотной последовательности, представленной на фиг.1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-324 в аминокислотной последовательности, представленной на фиг.1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-324 в аминокислотной последовательности, представленной на фиг.1; и b) не ингибирует энзиматическую активность LOXL2.

Эпитопы на участке SRCR1

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом на участке SRCR1 (но не SRCR2). Участок SRCR1 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-159 в аминокислотной последовательности, представленной на фиг.1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-159 в аминокислотной последовательности, представленной на фиг.1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-159 в аминокислотной последовательности, представленной на фиг.1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-159 в аминокислотной последовательности, представленной на фиг.1; и b) не ингибирует энзиматическую активность LOXL2.

Эпитопы на участке SRCRl-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом на участке SRCR1-линкер. Участок SRCR1-линкер может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-187 в аминокислотной последовательности, представленной на фиг.1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-187 в аминокислотной последовательности, представленной на фиг.1.

а) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98% на 99% или на 100% идентична аминокислотам 58-187 в аминокислотной последовательности, представленной на фиг.1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-187 в аминокислотной последовательности, представленной на фиг.1; и b) не ингибирует энзиматическую активность LOXL2.

Эпитопы на участке SRCR2

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом на участке SRCR2 (но не SRCR1). Участок SRCR2 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 188-302 в аминокислотной последовательности, представленной на фиг.1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 188-302 в аминокислотной последовательности, представленной на фиг.1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 188-302 в аминокислотной последовательности, представленной на фиг.1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 188-302 в аминокислотной последовательности, представленной на фиг.1; и b) не ингибирует энзиматическую активность LOXL2.

Эпитопы на участке линкер-8КСК2

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом на участке линкер-SRCR2. Участок линкер-SRCR2 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 160-302 в аминокислотной последовательности, представленной на фиг.1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 160-302 в аминокислотной последовательности, представленной на фиг.1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 160-302 в аминокислотной последовательности, представленной на фиг.1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 160-302 в аминокислотной последовательности, представленной на фиг.1; и b) не ингибирует энзиматическую активность LOXL2.

Эпитопы на участке SRCR2-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом на участке SRCR2-линкер. Участок SRCR2-линкер может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 188-324 в аминокислотной последовательности, представленной на фиг.1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 188-324 в аминокислотной последовательности, представленной на фиг.1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 188-324 в аминокислотной последовательности, представленной на фиг.1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 188-324 в аминокислотной последовательности, представленной на фиг.1; и b) не ингибирует энзиматическую активность LOXL2.

Эпитопы на участке линкер-SRCR2-линкер

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом на участке линкер-8КСК2-линкер. Участок линкер-SRCR2-линкер может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 160-324 в аминокислотной последовательности, представленной на фиг.1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 160-324 в аминокислотной последовательности, представленной на фиг.1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 160-324 в аминокислотной последовательности, представленной на фиг.1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 160-324 в аминокислотной последовательности, представленной на фиг.1; и b) не ингибирует энзиматическую активность LOXL2.

Эпитопы на участке SRCR1-линкер-SRCR2

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом на участке SRCR1-линкер-SRCR2. Участок SRCR1-линкер-SRCR2 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-302 в аминокислотной последовательности, представленной на фиг.1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-302 в аминокислотной последовательности, представленной на фиг.1.

а) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-302 в аминокислотной последовательности, представленной на фиг.1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 58-302 в аминокислотной последовательности, представленной на фиг.1; и b) не ингибирует энзиматическую активность LOXL2.

LOXL2-связывающие агенты, которые связываются с эпитопом в пределах каталитического домена

В некоторых воплощениях рассматриваемое антитело против LOXL2 специфически связывается с эпитопом в пределах каталитического домена полипептида LOXL2. Каталитический домен полипептида LOXL2 может содержать последовательность аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 546-774 в SEQ ID NO:1. Так, например, в некоторых воплощениях данное антитело против LOXL2 специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 546-774 в SEQ ID NO:1.

a) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 546-774 в SEQ ID NO:1; и b) ингибирует энзиматическую активность LOXL2.

b) В некоторых воплощениях рассматриваемое антитело против LOXL2: а) специфически связывается с эпитопом внутри последовательности аминокислот, которая по аминокислотной последовательности по меньшей мере на 90%, на 95%, на 98%, на 99% или на 100% идентична аминокислотам 546-774 в SEQ ID NO:1; и b) не ингибирует энзиматическую активность LOXL2.

В определенных воплощениях специально исключаются антитела, связывающиеся с эпитопом, содержащим тирозин 593 (Y593) и/или гистидин 739 (Н739) в SEQ ID NO:1.

Модификации

Рассматриваемое антитело против LOXL2 может содержать одну или несколько модификаций, как описано ниже.

В некоторых воплощениях данное антитело может содержать свободную тиоловую (-SH) группу на С-конце, при этом свободная тиоловая группа может использоваться для присоединения антитела ко второму полипептиду (например, другому антителу, включая данное антитело), каркасу, носителю и т.п. В некоторых воплощениях данное антитело содержит одну или несколько не встречающихся в природе аминокислот. В некоторых воплощениях не встречающиеся в природе аминокислоты содержат карбонильную группу, ацетильную группу, аминооксигруппу, гидразиновую группу, гидразидную группу, семикарбазидыую группу, азидную группу или алкиновую группу. Например, см. Патент США No. 7,632,924, где описаны типичные не встречающиеся в природе аминокислоты. Внедрение неприродных аминокислот может обеспечивать присоединение к полимеру, второму полипептиду, каркасу и т.п. Например, можно получить данное антитело, соединенное с водорастворимым полимером, при реакции водорастворимого полимера (например, ПЭГ), содержащего карбонильную группу, с рассматриваемым антителом, содержащим неприродную аминокислоту, содержащую аминоокси, гидразиновую, гидразидную или семикарбазидную группу. С другой стороны, можно получить данное антитело, соединенное с водорастворимым полимером, при реакции рассматриваемого антитела, содержащего алкинсодержащую аминокислоту, с водорастворимым полимером (например, ПЭГ), содержащим молекулу азида; в некоторых воплощениях азидная или алкиновая группа соединяется с молекулой ПЭГ амидной связью. "Не встречающаяся в природе аминокислота" означает такую аминокислоту, которая не является одной из 20 распространенных аминокислот или пиролизином или селеноцистеином. Другие термины, которые могут применяться как синонимы термину "не встречающаяся в природе аминокислота" - это "не природная аминокислота", "неприродная аминокислота", аминокислота не природного происхождения" и различные их варианты с написанием через дефис и без него. Термин "не встречающаяся в природе аминокислота" также включает, без ограничения, аминокислоты, возникающие при модификации (например, пост-трансляционной модификации) аминокислот природного происхождения (в том числе 20 распространенных аминокислот и пиролизина или селеноцистеина), но сами они не встраиваются трансляционным комплексом в растущую полипептидную цепь. Примеры таких не встречающихся в природе аминокислот включают, без ограничения, N-ацетилглюкозаминил-L-серин, N-ацетилглюкозаминил-L-треонин и O-фосфотирозин.

В некоторых воплощениях рассматриваемое антитело связано (например, ковалентно связано) с полимером (например, полимером, не являющимся полипептидом). Подходящими полимерами являются, например, биосовместимые полимеры и водорастворимые биосовместимые полимеры. Подходящими полимерами являются синтетические полимеры и полимеры природного происхождения. Подходящими полимерами являются, например, замещенные или незамещенные линейные или разветвленные полиалкиленовые, полиалкениловые или полиоксиалкиленовые полимеры либо разветвленные или неразветвленные полисахариды, например, гомо- или гетерополисахариды. Подходящими полимерами являются, например, сополимеры этилена и винилового спирта (широко известные под общим названием EVOH или под торговой маркой EVAL); полибутилметакрилат; поли(гидроксивалерат); поли(L-молочная кислота); поликапролактон; поли(лактид-ко-гликолид); поли(гидроксибутират); поли(гидроксибутират-ко-валерат); полидиоксанон; полиортоэфиры; полиангидриды; поли(гликолевая кислота); поли(D,L-молочная кислота); поли(гликолевая кислота-ко-триметиленкарбонат); полифосфоэфиры; полифосфоэфиры уретана; поли(аминокислоты); цианоакрилаты; поли(триметиленкарбонат); поли(иминокарбонат); сополимеры простых и сложных эфиров (например, сополимеры поли(этиленоксида)-поли(молочной кислоты) (PEO/PLA)); полиалкиленоксалаты; полифосфазены; такие биомолекулы, как фибрин, фибриноген, целлюлоза, крахмал, коллаген и гиалуроновая кислота; полиуретаны; силиконы; полиэфиры; полиолефины; сополимеры полиизобутилена и этилен-альфа-олефинов; акриловые полимеры и сополимеры; винилгалидные полимеры и сополимеры типа поливинилхлорида; поливиниловые простые эфиры типа поливинилметиловых эфиров; поливинилиденгалиды типа поливинилиденфторида и поливинилиденхлорида; полиакрилонитрил; поливинилкетоны; поливиниловые ароматические полимеры типа полистирена; поливиниловые сложные эфиры типа поливинилацетата; такие сополимеры виниловых мономеров друг с другом и с олефинами, как сополимеры этилен-метилметакрилата, сополимеры акрилонитрила-стирола, ацетонитрил-бутадиенстиреновые (ABS) смолы и сополимеры этилена-винилацетата; полиамиды типа Nylon 66 и поликапролактама; алкидные смолы; поликарбонаты; полиоксиметилены; полиимиды; полиэфиры; эпоксидные смолы; полиуретаны; вискоза; триацетат вискозы; целлюлоза; ацетат целлюлозы; бутират целлюлозы; ацетат-бутират целлюлозы; целлофан; нитрат целлюлозы; пропионат целлюлозы; эфиры целлюлозы; аморфный тефлон; поли(этиленгликоль); и карбоксиметилцеллюлоза.

Подходящими синтетическими полимерами являются незамещенные и замещенные линейные или разветвленные поли(этиленгликоли), поли(пропиленгликоли), поли(винилалкоголи) и их производные, например, замещенный поли(этиленгликоль) типа метоксиполи(этиленгликоля) и его производные. Подходящими природными полимерами являются, например, альбумин, амилоза, декстран, гликоген и их производные.

Средняя молекулярная масса подходящих полимеров может составлять от 500 Да до 50000 Да, например, от 5000 Да до 40000 Да или от 25000 до 40000 Да. Например, в некоторых воплощениях, в которых рассматриваемое антитело содержит полимер поли(этиленгликоль) (ПЭГ) или метоксиполи(этиленогликоль), этот ПЭГ или метоксиполи(этиленгликоль) может иметь молекулярную массу в пределах от 0,5 килодальтон (кДа) до 1 кДа, от 1 кДа до 5 кДа, от 5 кДа до 10 кДа, от 10 кДа до 25 кДа, от 25 кДа до 40 кДа или от 40 кДа до 60 кДа.

Как отмечалось выше, в некоторых воплощениях рассматриваемое антитело ковалентно связано с полимером ПЭГ. В некоторых воплощениях рассматриваемый мультимер scFv ковалентно связан с полимером ПЭГ, например, см. Albrecht et al. (2006) J. Immunol. Methods 310:100. Способы и реагенты, пригодные для ПЭГилирования белков, хорошо известны и они приводятся, например, в Пат. США No. 5,849,860. Подходящие для конъюгирования с белком ПЭГ обычно растворимы в воде при комнатной температуре и имеют общую формулу R(O-СН2-СН2)nO-R, где R - водород или защитная группа типа алкильной или алканольной группы, а n - целое число от 1 до 1000. Если R является защитной группой, то обычно он содержит от 1 до 8 атомов углерода.

Конъюгируемый с рассматриваемым антителом ПЭГ может быть линейным. Конъюгируемый с рассматриваемым белком ПЭГ также может быть разветвленным. Разветвленные производные ПЭГ включают, к примеру, описанные в Пат. США No. 5,643,575, "звездчатые ПЭГи" и многолучевые ПЭГи типа описанных в каталоге Shear-water Polymers, Inc. "Polyethylene Glycol Derivatives 1997-1998". Звездчатые ПЭГ описаны в данной области, включая, например. Патент США No. 6,046,305.

Рассматриваемое антитело может быть гликозилировано, например, может содержать ковалентно связанную молекулу углевода или полисахарида. Гликозилирование антител обычно бывает N-связанным или O-связанным. N-связанное означает присоединение молекулы углевода к боковой цепи остатка аспарагина. Трипептидные последовательности аспарагин-Х-серин и аспарагин-Х-треонин, где Х - любая аминокислота за исключением пролина, являются последовательностями распознавания для энзиматического присоединения молекулы углевода к боковой цепи аспарагина. Так, наличие любой из этих трипептидных последовательностей в полипептиде создает потенциальный сайт гликозилирования. O-связанное гликозилирование означает присоединение одного из Сахаров N-ацетилгалактозамина, галактозы или ксилозы к гидроксиаминокислоте, чаще всего серину или треонину, хотя может использоваться и 5-гидроксипролин или 5-гидроксилизин.

Добавление сайтов глизилирования в антитела удобно осуществляется путем изменения аминокислотной последовательности таким образом, чтобы она содержала одну или несколько из вышеописанных трипептидных последовательностей (для N-связанных сайтов гликозилирования). Изменение также может осуществляться путем добавления или замещения на один или несколько остатков серина или треонина в последовательности исходного антитела (для 0-связанных сайтов гликозилирования). Аналогичным образом удаление сайтов гликозилирования может осуществляться путем изменения аминокислот в нативных сайтах гликозилирования антител.

Рассматриваемое антитело в некоторых воплощениях должно содержать "рентгеноконтрастную" метку, например, метку, которую можно легко визуализировать, к примеру, с помощью рентгеновских лучей. Рентгеноконтрастные материалы хорошо известны специалистам в данной области. Наиболее распространенными рентгеноконтрастными материалами являются соли йода, брома или бария. Также известны и другие рентгеноконтрастные материалы, которые включают, без ограничения, органические производные висмута (например, см. Пат. США No. 5,939,045), рентгеноконтрастные мультиуретаны (см. Пат. США No. 5,346,981), висмуторганические композиты (например, см. Пат. США No. 5,256,334), рентгеноконтрастные мультимерные комплексы бария (например, см. Пат. США No. 4,866,132) и др.

Рассматриваемое антитело может быть ковалентно связано со второй молекулой (например, липидом, полипептидом, отличным от данного антитела, синтетическим полимером, углеводом и т.п.) при помощи, к примеру, глутаральдегида-гомобифункционального сшивающего реагента или гетеробифункционального сшивающего реагента. Глутаральдегид сшивает полипептиды через их аминогруппы. Гомобифункциональные сшивающие реагенты (например, гомобифункциональный имидоэфир, гомобифункциональный N-гидроксисукцинимидиловый (NHS) эфир или гомобифункциональный реагирующий с сульфгидрилами сшивающий реагент) содержат две или несколько идентичных реагирующих молекул и могут использоваться в одностадийных реакциях, в которых сшивающий реагент добавляется в раствор, содержащий смесь подлежащих сшиванию полипептидов. Гомобифункциональный NHS-эфир и имидоэфиры сшивают аминосодержащие полипептиды. При слегка щелочном рН имидоэфиры реагируют только с первичными аминами с образованием имидоамидов и не влияют на общий заряд сшитого полипептида. Гомобифункциональные реагирующие с сульфгидрилами сшивающие реагенты включают бисмалеимидгексан (ВМН), 1,5-дифтор-2,4-динитробензол (DFDNB) и 1,4-ди-(3′,2′-пиридилдитио)пропионамидобутан (DPDPB).

Гетеробифункциональные сшивающие реагенты содержат одну или несколько различных реагирующих группировок (например, реагирующую с аминами группировку и реагирующую с сульфгидрилами группировку) и сшиваются с одним из полипептидов через реагирующую с аминами группировку или реагирующую с сульфгидрилами группировку, а затем реагируют с другим полипептидом через непрореагировавшую группировку. Существует множество гетеробифункциональных галоацетильных сшивающих реагентов, а также пиридилдисульфидных сшивающих реагентов. Карбодиимиды являются классическим примером гетеробифункциональных сшивающих реагентов для конъюгирования карбоксилов с аминами, что дает амидную связь.

Рассматриваемое антитело может быть иммобилизовано на твердой подложке. Подходящие подложки хорошо известны в данной области и содержат, в частности, коммерчески доступные колоночные материалы, полистиреновые шарики, латексные шарики, магнитные шарики, коллоидные металлические частицы, стеклянные и/или силиконовые чипы и поверхности, нитроцеллюлозные полоски, нейлоновые мембраны, листы, дурациты, лунки планшетов (например, многолуночных планшетов), пластиковые пробирки и т.п. Твердая подложка может включать любые из целого ряда веществ, включая, например, стекло, полистирен, поливинилхлорид, полипропилен, полиэтилен, поликарбонат, декстран, нейлон, амилозу, натуральную или модифицированную целлюлозу, полиакриламид, агарозу и магнетит. Подходящие способы иммобилизации антител на твердой подложке хорошо известны и включают, без ограничения, ионные, гидрофобные, ковалентные взаимодействия и т.п. Твердые подложки могут быть растворимыми или нерастворимыми, например, в водном растворе. В некоторых воплощениях подходящая твердая подложка обычно нерастворима в водном растворе.

Рассматриваемое антитело в некоторых воплощениях должно содержать детектируемую метку. Подходящими детектируемыми метками являются любые композиции, детектируемые спектроскопическими, фотохимическими, биохимическими, иммунохимическими, электрическими, оптическими или химическими средствами. Подходящими детектируемыми метками являются, без ограничения, магнитные шарики (например, Dynabeads™), флуоресцентные красители (например, флуоресцеин изотиоцианат, техасский красный, родамин, зеленый флуоресцентный белок, красный флуоресцентный белок, желтый флуоресцентный белок и др.), радиоактивные метки (например, 3Н, 125I, 35S, 14C или 32Р), ферменты (например, пероксидаза хрена, щелочная фосфатаза, люцифераза и другие широко используемые в ферментном иммуносорбентном анализе (ELISA)) и колориметрические метки типа коллоидного золота или цветных стеклянных или пластиковых (например, полистиреновых, полипропиленовых, латексных и др.) шариков.

В некоторых воплощениях рассматриваемое антитело содержит контрастное вещество или радиоизотоп, при этом контрастное вещество или радиоизотоп должно подходить для применения в интраскопии, например, при проведении интраскопии на людях. Неограничивающие примеры меток включают такие радиоизотопы, как 123I (йод), 18F (фтор), 99Tc (технеций), 111In (индий) и 67Ga (галлий), и такие контрастные вещества, как гадолиний (Gd), диспрозий и железо. Также доступны радиоактивные изотопы Gd (153Gd), которые пригодны для интраскопии на других млекопитающих, кроме человека. Данное антитело может быть помечено стандартными методами. Например, данное антитело может быть йодировано с помощью хлорамина Т или 1,3,4,6-тетрахлор-3α,6α-дифенилгликоурила. При фторировании в данное антитело фтор вводится реакцией замещения ионов фтора. См. обзоры по синтезу белков с такими радиоизотопами: Muller-Gartner H., TIB Tech., 16: 122-130 (1998); и Saji H., Crit. Rev. Ther. Drug Carrier Syst, 16 (2): 209-244 (1999). Данное антитело также может быть помечено контрастным веществом при помощи стандартных методов. Например, данное антитело может быть помечено Gd путем конъюгирования с антителом низкомолекулярных хелатов Gd типа Gd-диэтилентриаминпентауксусной кислоты (GdDTPA) или Gd-тетраазациклододекантетрауксусной кислоты (GdDOTA). См. Caravan et al., Chem. Rev. 99: 2293-2352 (1999); и Lauffer et al., J. Magn. Reson. Imaging, 3: 11-16 (1985). Данное антитело может быть помечено Gd, к примеру, путем конъюгирования с антителом хелатов полилизин-Gd. Например, см. Curtet et al.. Invest. Radiol., 33 (10): 752-761 (1998). С другой стороны, данное антитело может быть помечено Gd путем инкубирования парамагнитных полимеризованных липомосом, содержащих липид-хелатор Gd, с авидином и биотинилированным антителом. Например, см. Sipkins et al., Nature Med., 4: 623-626 (1998).

Подходящие флуоресцентные белки, которые могут быть присоединены к рассматриваемому антителу, включают, без ограничения, зеленый флуоресцентный белок (GFP) из Aequoria victoria либо его мутант или производное, например, как описано в Патент США Nos. 6,066,476; 6,020,192; 5,985,577; 5,976,796; 5,968,750; 5,968,738; 5,958,713; 5,919,445; 5,874,304; например. Enhanced GFP. Многие такие GFP коммерчески доступны, например, от Clontech, Inc. Дополнительные флуоресцентные белки включают красный флуоресцентный белок, желтый флуоресцентный белок и любые из целого ряда флуоресцентных и окрашенных белков из видов Anthozoan, как описано, например, у Matz et al. (1999) Nature Biotechnol. 17: 969-973; и др.

В некоторых воплощениях рассматриваемое антитело должно быть связано (например, ковалентно или не ковалентно) с партнером по слиянию, например, лигандом; эпитопной меткой; пептидом; белком, отличающимся от антитела; и др. Подходящими партнерами по слиянию являются пептиды и полипептиды, придающие повышенную стабильность in vivo (например, повышение времени полужизни в сыворотке); облегчающие очистку, как-то полигистидиновые последовательности, например, 6His (HHHHHH, SEQ ID NO:4) и др.; обеспечивающие секрецию слитого белка из клетки; обеспечивающие эпитопную метку, например, GST, гемагглютинин (НА; например, CYPYDVPDYA; SEQ ID NO:5), FLAG (например, DYKDDDDK; SEQ ID NO:6), c-myc (например, CEQKLISEEDL; SEQ ID NO:7) и др.; обеспечивающие детектируемый сигнал, например, ферменты, генерирующие детектируемый продукт (например, β-галактозидаза, люцифераза, β-глюкуронидаза), или белки, которые сами детектируются, например, зеленый флуоресцентный белок, красный флуоресцентный белок, желтый флуоресцентный белок и др.; обеспечивающие мультимеризацию, например, мультимеризационный домен типа Fc-части иммуноглобулина; и др.

Слияние также может охватывать домен аффинности, включая пептидные последовательности, взаимодействующие с партнером по связыванию, например, иммобилизованным на твердой подложке, применяющимся для идентификации или очистки. Последовательные единичные аминокислоты, такие как гистидин, при слиянии с белком могут использоваться для одностадийной очистки слитого белка путем высокоаффинного связывания со смолой на колонке типа никелевой сефарозы. Типичными доменами аффинности являются His5 (HHHHH) (SEQ ID NO:8), His6 (HHHHHH) (SEQ ID NO:4), C-myc (EQKLISEEDL) (SEQ ID NO:7), Flag (DYKDDDDK) (SEQ ID NO:6), StrepTag (WSHPQFEK) (SEQ ID NO:9), гемагглютинин, например, НА-тег (YPYDVPDYA; SEQ ID NO:10), глютатион-S-трансфераза (GST), тиоредоксин, целлюлозосвязывающий домен, RYIRS (SEQ ID N0:11), Phe-His-His-Thr (SEQ ID NO:12), хитин-связывающий домен, S-пептид, пептид Т7, домен SH2, С-концевой РНК-тег, WEAAAREACCRECCARA (SEQ ID NO:13), металлсвязывающие домены, например, цинк-связывающие домены или кальций-связывающие домены типа доменов кальций-связывающих белков, например, кальмодулина, тропонина С, кальцинейрина В, легкой цепи миозина, рековерина, S-модулина, визинина, визининоподобного белка, нейрокальцина, гиппокальцина, фреквенина, кальтрактина, большой субъединицы кальпаина, белков S100, парвальбумина, кальбиндина D9K, кальбиндина D28K, а также кальретинин, интеины, биотин, стрептавидин, MyoD, лейциновые молнии и мальтозосвязывающий белок.

Рассматриваемое антитело в некоторых воплощениях должно быть слито с полипептидом, который связывается с эндогенным рецептором гематоэнцефалического барьера (ВВВ). Связывание данного антитела с полипептидом, связывающимся с эндогенным рецептором ВВВ, облегчает прохождение через ВВВ, например, в рассматриваемом способе лечения (см. ниже), включающем введение данного антитела нуждающемуся в этом индивиду. Подходящими полипептидами, которые связываются с эндогенными рецепторами ВВВ, являются антитела, например, моноклональные антитела или их антиген-связывающие фрагменты, которые специфически связываются с эндогенным рецептором ВВВ. Подходящими эндогенными рецепторами ВВВ являются, без ограничения, инсулиновый рецептор, трансферриновый рецептор, лептиновый рецептор, липопротеиновый рецептор и рецептор инсулиноподобного фактора роста. Например, см. Патент США No. 2009/0156498.

В некоторых воплощениях рассматриваемое антитело содержит модификацию полиаминами. Модификация данного антитела полиаминами повышает проницаемость модифицированного антитела для ВВВ. Данное антитело может быть модифицировано полиаминами природными или синтетическими. Например, см. Пат. США No. 5,670,477. Полезными природными полиаминами являются путресцин, спермидин, спермин, 1,3-диаминопропан, норспермидин, син-гомоспермидин, термин, термоспермин, кальдопентамин, гомокальдопентамин и канавалмин. Особенно подходят путресцин, спермидин и спермин. Синтетические полиамины представлены эмпирической формулой CXHYNZ и могут быть циклическими или ациклическими, разветвленными или неразветвленными углеводородными цепями из 3-12 атомов углерода, которые дополнительно включают 1-6 группировок NR или N(R)2, где R означает Н, (С14)-алкил, фенил или бензил. Полиамины могут быть присоединены к антителу любым стандартным методом сшивания.

В некоторых воплощениях рассматриваемое антитело подвергают модификации так, чтобы оно включало молекулу углевода, при этом молекула углевода может быть ковалентно связана с антителом. В некоторых воплощениях данное антитело подвергают модификации модифицировано так, чтобы оно включало молекулу липида, при этом молекула липида может быть ковалентно связана с антителом. Подходящими липидными молекулами являются, например, N-жирные ацильные группы, как-то N-лауроил, N-олеоил и др.; жирные амины, как-то додецил амин, олеоил амин и др.; С316-длинноцепочечные алифатические липиды; и др. Например, см. Пат. США No. 6,638,513. В некоторых воплощениях данное антитело заключено в липосомы.

В некоторых воплощениях рассматриваемое антитело против LOLX2 конъюгировано или связано с терапевтической и/или визуализирующей/детектируемой молекулой. Методы конъюгирования или связывания антител хорошо известны в данной области. Связывание между антителами и метками включает любые средства, известные в данной области, в том числе ковалентные и нековалентные взаимодействия.

В одном неограничивающем воплощении рассматриваемое антитело против LOLX2 может быть связано с токсином, радионуклидом, железосодержащим соединением, красителем, визуализирующим реагентом, флуоресцентной меткой или химиотерапевтическим средством, которые будут токсичными при введении в раковые клетки. С другой стороны, данное антитело против LOLX2 может быть связано с детектируемой меткой, как-то радионуклидом, железосодержащим соединением, красителем, визуализирующим реагентом или флуоресцентным веществом для иммунодетекции антигенов мишени.

Неограничивающие примеры радиоактивных меток включают, к примеру, 32Р, 33Р, 43К, 52Fe, 57Co, 64Cu, 67Ga, 67Cu, 68Ga, 71Ge, 75Br, 76Br, 77Br, 77As, 77Br, 81Rb, 81MKr, 87MSr, 90Y, 97Ru, 99Tc, 100Pd, 101Rh, 103Pb, 105Rh, 109Pd, 111Ag, 111In, 113In, 119Sb, 121Sn, 123I, 125I, 127Cs, 128Ba, 129Cs, 131I, 131Cs, 143Pr, 153Sm, 161Tb, 166Ho, 169Eu, 177Lu, 186Re, 188Re, 189e, 191Os, 193Pt, 194Ir, 197Hg. 199Au, 203Pb, 211At, 212Pb, 212Bi и 213Bi.

Неограничивающие примеры токсинов включают, к примеру, А-цепь дифтерийного токсина, несвязывающиеся активные фрагменты дифтерийного токсина, А-цепь экзотоксина (из Pseudomonas aeruginosa), А-цепь рицина, А-цепь абрина, А-цепь модекцина, альфа-сарцин, белки Aleurites fordu, диантиновые белки, белки Phytolaca americana (PAPI, PAPII и PAP-S), ингибитор из Momordica charantia, курцин, кротин, ингибитор из Sapaonaria officinalis, гелонин, митогеллин, рестриктоцин, феномицин, еномицин, трикотецины, фосфолипазу С (PLC) из Clostridium perfringens, бычью панкреатическую рибонуклеазу (BPR), антивирусный белок (РАР), абрин, фактор из яда кобры CVF), гелонин (GEL), сапорин (SAP) и вискумин.

Неограничивающие примеры железосодержащих соединений включают, к примеру, магнитные частицы окиси железа, частицы соединений железа(III) или железа(II), Fe203 и Fe304. Железосодержащие соединения и способы мечения полипептидов, белков и пептидов приводятся, к примеру, в патенты США №4,101,435 и 4,452,773 и в опубликованных заявках U.S. 20020064502 и 20020136693.

В некоторых воплощениях рассматриваемое антитело может быть ковалентно или нековалентно конъюгировано с цитотоксином или другим соединением, ингибирующим пролиферацию клеток, в целях локализации доставки такого средства в опухолевые клетки. Например, средство может быть выбрано из: алкилирующих реагентов, ингибиторов ферментов, ингибиторов пролиферации, литических средств, ингибиторов синтеза ДНК или РНК, модификаторов мембранной проницаемости, метаболитов ДНК, производных дихлорэтилсульфида, ингибиторов продукции белка, ингибиторов рибосом, индукторов апоптоза и нейротоксинов.

В некоторых воплощениях рассматриваемое антитело может быть связано с агентом, применяющимся при визуализации опухолей. Такими агентами являются: металлы; хелаторы металлов; лантаниды; хелаторы лантанидов; радиоактивные металлы; хелаторы радиоактивных металлов; излучающие позитроны ядра; микропузырьки (для ультразвука); липосомы; микроинкапсулированные в липосомы или наносферы молекулы; монокристаллические наносоединения окиси железа; контрастные вещества для интраскопии методом ядерного магнитного резонанса; светопоглощающие, отражающие и/или светорассеивающие вещества; коллоидные частицы; флуорофоры, как-то флуорофоры в ближней инфракрасной области. Во многих воплощениях такие вторичные функциональные группировки могут быть относительно большими, например, размером по меньшей мере в 25 атомных единиц массы (а.е.м.), а во многих случаях размером по меньшей мере в 50, 100 или 250 а.е.м.

В некоторых воплощениях вторичная функциональная группировка представляет собой хелатную молекулу для хелатирования металлов, например, хелатора радиоактивных металлов или парамагнитных ионов. В других воплощениях она является хелатором радионуклидов, применяющихся в методах радиотерапии или интраскопии. Условия, при которых хелатор будет координироваться с металлом, описаны, к примеру, в Gasnow et al., Пат. США Nos. 4,831,175, 4,454,106 и 4,472,509, которые включены сюда путем ссылки. В настоящем изобретении "радионуклид" и "радиоактивная метка" взаимозаменяемы.

Радионуклидами, подходящими для включения в рассматриваемое антитело против LOXL2, являются гамма-излучатели, излучатели позитронов, излучатели электронов Оже, рентгеновские излучатели и излучатели флуоресценции. В некоторых воплощениях применяются бета- или альфа-излучатели. Примеры радионуклидов, применимых в качестве токсинов для лучевой терапии, включают: 32Р, 33Р, 43K, 52Fe, 57Co, 64Cu, 67Ga, 67Cu, 68Ga, 71Ge, 75Br, 76Br, 77Br, 77As, 77Br, 81Rb/81MKr, 87MSr, 90Y, 97Ru, 99Tc, 100Pd, 101Rh, 103Pb, 105Rh, 109Pd, 111Ag, 111In, 113In, 119Sb, 121Sn, 123I, 125I, 127Cs, 128Ba, 129Cs, 131I, 131Cs, 143Pr, 153Sm, 161Tb, 166Ho, 169Eu, 177Lu, 186Re, 188Re, 189Re, 191Os, 193Pt, 194Ir, 197Hg, 199Au, 203Pb, 211At, 212Pb, 212Bi and 213Bi. Примеры лечебных радионуклидов включают 188Re, 186Re, 203Pb, 212Pb, 212Bi, 109Pd, 64Cu, 67Cu, 90Y, 125I,131I, 77Br, 211At, 97Ru, 105Rh, 198Au и 199Ag, 166Ho или 177Lu.

Особенно привлекательным радиоизотопом для диагностического применения является 99Те, так как он легкодоступен для всех отделений ядерной медицины, недорогой, дает минимальные дозы облучения пациентов и обладает идеальными свойствами для ядерной интраскопии. Время его полужизни составляет 6 часов, поэтому желательна быстрая доставка меченных технецием антител. Соответственно, в некоторых воплощениях рассматриваемое антитело модифицируют таким образом, чтобы оно включало хелатор для технеция.

В других воплощениях вторичная функциональная группировка может представлять собой радиосенсибилизирующее вещество, например, молекулу, повышающую чувствительность клеток к облучению. Примеры радиосенсибилизирующих веществ включают нитроимидазолы, метронидазол и мизонидазол (см. DeVita V.T. in Harrison′s Principles of Internal Medicine, p.68, McGraw-Hill Book Co., NY, 1983, который включен здесь в виде ссылки radiosensitizing agent). Модифицированные антитела, содержащие радиосенсибилизирующее вещество в качестве активной молекулы, после введения локализуются в клетках мишени. При воздействии на индивидуума излучением радиосенсибилизирующее вещество "возбуждается" и вызывает гибель клеток.

Имеется целый ряд молекул, которые могут служить хелаторами и которыми можно функционализировать рассматриваемое антитело. Например, хелатором может быть производное 1,4,7,10-тетраазациклододекантетрауксусной кислоты (DOTA), этилендиаминтетрауксусной кислоты (EDTA), диэтилентриаминпентауксусной кислоты (DTPA) и 1-пора-изотиоцианатобензилметилдиэтилентриаминпентауксусной кислоты (ITC-MX). Эти хелаторы обычно имеют такие группы на боковой цепи, посредством которых хелатор может присоединяться к рассматриваемым антагонистам. К таким группам относится, например, бензилизотиоцианат, посредством которого DOTA, DTPA или EDTA можно конъюгировать, например, с аминогруппой.

В одном воплощении хелатная молекула представляет собой хелатную молекулу "NxSy". Как определено здесь, "хелаты NxSy" включают бифункциональные хелаторы, которые способны координационно связывать металл или радиоактивный металл и могут содержать ядра типа N2S2 или N3S. Типичные хелаты NxSy описаны, например, в Fritzberg et al. (1998) PNAS 85: 4024-29; и Weber et al. (1990) Chem. 1: 431-37; и в приведенных там ссылках.

В некоторых воплощениях рассматриваемое антитело против LOXL2 модифицируют таким образом, чтобы оно включало химиотерапевтическое средство, например, химиотерапевтическое средство соединяют ковалентно или нековалентно с данным антителом против LOXL2.

Химиотерапевтические средства ("средства химиотерапии"), подходящие для модифицирования рассматриваемого антитела, включают небольшие химические молекулы, полученные путем химического синтеза. Средства химиотерапии включают цитотоксические и цитостатические препараты. Средства химиотерапии могут включать такие средства, которые обладают другими эффектами на клетку, как-то обращают трансформированное состояние в дифференцированное состояние или ингибируют клеточную репликацию. Примеры известных цитотоксических средств, пригодных для применения, приведены, к примеру, в Goodman et al., "The Pharmacological Basis of Therapeutics," Sixth Edition, A.B. Oilman et al., eds. / Macmillan Publishing Co., New York, 1980. Они включают таксаны, такие как паклитаксель и доцетаксель; производные иприта (β-дихлордиэтилсульфида), такие как мехлорэтамин, мелфалан, урациловый иприт и хлорамбуцил; производные этиленимина типа тиотепа; алкилсульфонаты типа бусульфана; такие нитрозомочевины, как ломустин, семустин и стрептозоцин; триазины типа дакарбазина; аналоги фолиевой кислоты типа метотрексата; аналоги пиримидинов, такие как фторурацил, цитарабин и азарибин; аналоги пуринов, такие как меркаптопурин и тиогуанин; алкалоиды барвинка, такие как винбластин и винкристин; такие антибиотики, как дактиномицин, даунорубицин, доксорубицин и митомицин; такие ферменты, как координационные комплексы платины типа цисплатина; такие замещенные мочевины, как гидроксимочевина; производные метилгидразина типа прокарбазина; адренокортикальные супрессанты типа митотана; гормоны и антагонисты, такие как адренокортикостероиды (преднизон), прогестины (гидроксипрогестерон капроат, ацетат и мегестрол ацетат), эстрогены (диэтилстильбэстрол и этинилэстрадиол) и андрогены (тестостерон пропионат и флюоксиместерон).

В некоторых воплощениях рассматриваемое антитело против LOXL2 модифицируют таким образом, чтобы оно включало химиотерапевтическое средство, которое препятствует синтезу белка. Препаратами, препятствующими синтезу белка, являются, например, пуромицин, циклогексимид и рибонуклеаза.

Большинство современных химиотерапевтических средств, применяемых для лечения рака, содержат функциональные группы, поддающиеся химическому сшиванию непосредственно с амино- или карбоксильной группой рассматриваемого антитела. К примеру, свободные аминогруппы имеются на метотрексате, доксорубицине, даунорубицине, цитозинарабинозиде, блеомицине, флюдарабине и кладрибине, а свободные карбоксильные группы имеются на метотрексате, мелфалане и хлорамбуциле.

Эти функциональные группы, то есть свободные амино- и карбоксильные группы, являются мишенями для ряда гомобифункциональных и гетеробифункциональных химических сшивающих реагентов, которые могут пришивать лекарства прямо, например, к свободной аминогруппе рассматриваемого антитела.

Химиотерапевтические средства, предусмотренные для модификации рассматриваемого антитела, включают и другие коммерчески доступные Химиотерапевтические препараты. Только для примера: химиотерапевтическими препаратами могут быть ингибиторы функционирования хроматина, ДНК-повреждающие вещества, антиметаболиты (как-то антагонисты фолата, аналоги пиримидина, аналоги пурина и модифицированные сахарами аналоги), ингибиторы синтеза ДНК, взаимодействующие с ДНК вещества (как-то интеркалирующие вещества) или ингибиторы репарации ДНК.

Химиотерапевтические средства можно классифицировать по механизму их действия, к примеру, на следующие группы: антиметаболиты/противораковые средства, такие как аналоги пиримидинов (флоксуридин, капецитабин и цитарабин) и аналоги пуринов; антагонисты фолата и родственные им ингибиторы; антипролиферативные/ антимитотические средства, включая натуральные препараты, такие как алкалоиды барвинка (винбластин, винкристин), и блокаторы микротрубочек, такие как таксаны (паклитаксель, доцетаксель), винбластин, нокодазол, эпотилоны и навельбин, эпидиподофиллотоксины (этопозид, тенипозид); ДНК-повреждающие вещества (актиномицин, амсакрин, бусульфан, карбоплатин, хлорамбуцил, цисплатин, циклофосфамид, цитоксан, дактиномицин, даунорубицин, доксорубицин, эпирубицин, ифосфамид, мелфалан, мехлорэтамин, митомицин, митоксантрон, нитрозомочевина, прокарбазин, таксол, таксотер, тенипозид, триэтилентиофосфорамид и этопозид; антибиотики, такие как дактиномицин (актиномицинО), даунорубицин, доксорубицин (адриамицин), идарубицин, антрациклины, митоксантрон, блеомицины, пликамицин (митрамицин) и митомицин; ферменты (L-аспарагиназа, которая системно метаболизирует L-аспарагин и лишает его клетки, не обладающие способностью синтезировать свой собственный аспарагин); антитромбоцитарные средства; антипролиферативные/антимитотические алкилирующие реагенты, такие как производные иприта-циклофосфамид и его аналоги мелфалан, хлорамбуцил, гексаметилмеламин и тиотепа, алкил нитрозомочевины (BCNU) и аналоги, стрептозоцин, триазины-дакарбазинин (DTIC); антипролиферативные/антимитотические антиметаболиты, такие как аналоги фолиевой кислоты (метотрексат); координационные комплексы платины (цисплатин, оксилоплатин, карбоплатин), прокарбазин, гидроксимочевина, митотан, аминоглютетимид; гормоны, аналоги гормонов (эстроген, тамоксифен, госерелин, бикалутамид, нилутамид) и ингибиторы ароматаз (летрозол, анастрозол); антикоагулянты (гепарин, синтетические соли гепарина и другие ингибиторы тромбина); фибринолитические средства (такие как активатор тканевого плазминогена, стрептокиназа и урокиназа), аспирин, дипиридамол, тиклопидин, клопидогрель; антимиграционные средства; антисекреторные средства (бревелдин); иммунодепрессанты такролимус, сиролимус, азатиоприн, микофенолат; соединения (TNP-470, генистеин) и ингибиторы факторов роста (ингибиторы фактора роста сосудистого эндотелия, ингибиторы фактора роста фибробластов); блокаторы рецептора ангиотензина, доноры оксида азота; антисмысловые олигонуклеотиды; антитела (трастузумаб, ритуксимаб); ингибиторы клеточного цикла и индукторы дифференцировки (третиноин); ингибиторы тропоизомеразы (доксорубицин (адриамицин), даунорубицин, дактиномицин, энипозид, эпирубицин, этопозид, идарубицин, иринотекан и митоксантрон, топотекан, иринотекан); кортикостероиды (кортизон, дексаметазон, гидрокортизон, метилпреднизолон, преднизон и преднизолон); ингибиторы киназ трансдукции сигналов факторов роста; вызывающие дисфункции токсины, такие как холерный токсин, рицин, экзотоксин Pseudomonas, аденилатциклазный токсин Bordetella pertussis, дифтерийный токсин, и активаторы каспазы; а также хроматин. Предпочтительные дозировки химиотерапевтических средств соответствуют текущим назначаемым дозировкам.

В настоящем изобретении термины "повреждающая нуклеиновую кислоту обработка" и "повреждающее нуклеиновую кислоту средство" относятся к такой обработке, которая прямо или косвенно повреждает нуклеиновую кислоту (например, ДНК, кДНК, геномную ДНК, мРНК, тРНК или рРНК). Примеры таких средств включают алкилирующие реагенты, нитрозомочевины, антиметаболиты, растительные алкалоиды, растительные экстракты и радиоизотопы. Их примеры также включают повреждающие нуклеиновую кислоту препараты, например, 5-фторурацил (5-FU), капецитабин, S-1 (тегафур, 5-хлор-2,4-дигидроксипиридин и оксоновая кислота), 5-этинилурацил, арабинозилцитозин (ага-С), 5-азацитидин (5-АС), 2′,2′-дифтор-2′-дезоксицитидин (dFdC), пуриновые антиметаболиты (меркаптопурин, азатиопурин, тиогуанин), гемцитабин гидрохлорид (гемзар), пентостатин, аллопуринол, 2-фтор-арабинозиладенин (2F-ara-A), гидроксимочевина, иприт (бис-хлорэтилсульфид), мехлорэтамин, мелфалан, хлорамбуцил, циклофосфамид, ифосфамид, тиотепа, AZQ, митомицин С, диангидрогалактитол, дибромдуцитол, алкилсульфонат (бусульфан), нитрозомочевины (BCNU, CCNU, 4-метил-CCNU или ACNU), прокарбазин, декарбазин, ребеккамицин, такие антрациклины, как доксорубицин (адриамицин; ADR), даунорубицин (церубицин), идарубицин (идамицин) и эпирубицин (элленс), аналоги антрациклина, такие как митоксантрон, актиномицин D, не интеркалирующие ингибиторы топоизомеразы, такие как эпиподофиллотоксины (этопозид=VP16, тенипозид=VM-26), подофиллотоксин, блеомицин (Bleo), пепломицин, соединения, образующие аддукты с нуклеиновой кислотой, включая производные платины (например, цисплатин (CDDP), транс-аналоги цисплатина, карбоплатин, ипроплатин, тетраплатин и оксалиплатин), камптотецин, топотекан, иринотекан (СРТ-11) и SN-38. Специфические примеры повреждающей нуклеиновую кислоту обработки включают излучение (например, направленные микроволны, ультрафиолет (UV), инфракрасное (IR) либо альфа-, бета- или гамма-излучение) и экологический шок (например, гипертермия).

В настоящем изобретении термины "антипролиферативная обработка" и "антипролиферативное средство" относятся к такой обработке, которая прямо или косвенно ингибирует пролиферацию клеток, вирусов, бактерий или других одноклеточных или многоклеточных организмов независимо от того, повреждает или нет обработка или агент нуклеиновую кислоту. Конкретными примерами антипролиферативных средств являются противоопухолевые и противовирусные препараты, ингибирующие пролиферацию клеток либо размножение или репликацию вирусов. Их примеры включают, среди прочего, циклофосфамид, азатиоприн, циклоспорин А, преднизолон, мелфалан, хлорамбуцил, мехлорэтамин, бусульфан, метотрексат, 6-меркаптопурин, тиогуанин, цитозинарабинозид, таксол, винбластин, винкристин, доксорубицин, актиномицин D, митрамицин, кармустин, ломустин, семустин, стрептозотоцин, гидроксимочевину, цисплатин, митотан, прокарабазин, дакарбазин и дибромманнитол. Антипролиферативными средствами, вызывающими ошибки при репликации нуклеиновых кислот или ингибирующие репликацию нуклеиновых кислот, являются средства типа аналогов нуклеозидов и нуклеотидов (например, AZT или 5-AZC).

В следующем воплощении рассматриваемое антитело против LOXL2 может быть конъюгировано с "рецептором" (типа стрептавидина) для использования его при предварительном наведении на опухоль, когда пациенту вводится конъюгат антитело-рецептор, после чего несвязавшийся конъюгат удаляется из циркуляции с помощью выводящего средства, а затем вводится "лиганд" (например, авидин), конъюгированный с цитотоксическим агентом (например, радионуклидом).

Способы получения антител

Рассматриваемое антитело может быть получено любым известным способом, например, стандартными методами синтеза белков, методами рекомбинантной ДНК и др.

Для тех воплощений, в которых рассматриваемое антитело представлено одноцепочечным полипептидом, его можно синтезировать при помощи стандартных методов химического синтеза пептидов. Если полипептид синтезируется химическим способом, то синтез может происходить в жидкой фазе или твердой фазе. Твердофазный синтез полипептидов (SPPS), при котором С-концевая аминокислота данной последовательности фиксируется на нерастворимой подложке, после чего последовательно добавляются остальные аминокислоты из последовательности, является примером подходящего способа химического синтеза рассматриваемого антитела. Для синтеза рассматриваемого антитела подходят различные формы SPPS, такие как Fmoc и Вос. Методы твердофазного синтеза описаны в Barany and Merrifield, Solid-Phase Peptide Synthesis; pp.3-284 in The Peptides: Analysis, Synthesis, Biology. Vol.2: Special Methods in Peptide Synthesis, Part A; Merrifield et al., J. Am. Chem. Soc., 85: 2149-2156 (1963); Stewart et al., Solid Phase Peptide Synthesis, 2nd ed. Pierce Chem. Co., Rockford, 111. (1984); а также Ganesan A. 2006 Mini Rev. Med Chem. 6: 3-10; и Camarero JA et al. 2005 Protein Pept Lett. 12: 723-8. Вкратце, небольшие нерастворимые пористые шарики обрабатываются теми функциональными звеньями, из которых строятся пептидные цепи. После многократных циклов присоединения/деблокирования свободный N-концевой амин прикрепленного к твердой фазе пептида конъюгируют с одним N-блокированным аминокислотным звеном. Затем это звено деблокируют, открывая новый N-концевой амин, к которому может присоединяться следующая аминокислота. Пептид остается иммобилизованным на твердой фазе и подвергается процессу фильтрации, после чего его отщепляют.

Для получения рассматриваемого антитела можно использовать стандартные рекомбинантные методы. Например, в экспрессионный вектор вводятся нуклеиновые кислоты, кодирующие вариабельные области легкой и тяжелой цепи, необязательно связанные с константными участками. Легкую и тяжелую цепи можно клонировать в одном и том же или в разных экспрессионных векторах. Сегменты ДНК, кодирующие цепи иммуноглобулина, функционально соединяют с последовательностями в экспрессионном векторе, обеспечивающими экспрессию полипептидов иммуноглобулина. Контролирующие экспрессию последовательности включают, без ограничения, промоторы (например, собственные или гетерологичные промоторы), сигнальные последовательности, энхансерные элементы и последовательности терминации транскрипции. Контролирующие экспрессию последовательности могут быть представлены эукариотическими системами промоторов в векторах, способных трансформировать или трансфецировать эукариотические клетки хозяина (например, клетки COS или СНО). После того, как вектор будет встроен в подходящего хозяина, хозяина содержат в условиях, подходящих для высокого уровня экспрессии нуклеотидных последовательностей и для извлечения и очистки антител.

Вследствие вырожденности генетического кода каждую аминокислотную последовательность иммуноглобулинов могут кодировать различные нуклеотидные последовательности. Требуемые последовательности нуклеиновых кислот могут быть получены посредством твердофазного синтеза ДНК de novo, полимеразной цепной реакции (ПЦР) или мутагенеза ранее полученного варианта данного полинуклеотида. Опосредованный олигонуклеотидами мутагенез является примером подходящего способа получения вариантов замен, делеций и вставок в ДНК искомого полипептида. См. Adelman et al., DNA 2:183 (1983). Вкратце, ДНК искомого полипептида подвергается изменению путем гибридизации олигонуклеотида, кодирующего требуемую мутацию, с однонитчатой ДНК матрицы. После гибридизации с помощью ДНК-полимеразы синтезируется полная вторая комплементарная цепь матрицы, содержащая олигонуклеотидный праймер, которая и кодирует выбранное изменение в ДНК искомого полипептида.

Подходящие экспрессионные вектора обычно реплицируются в организме хозяина либо в виде эписом, либо как часть вошедшая в состав хромосомной ДНК хозяина. Обычно экспрессионные вектора содержат селекционные маркеры (например, устойчивости к ампициллину, устойчивости к гигромицину, устойчивости к тетрациклину, устойчивости к канамицину или неомицину), позволяющие обнаружить клетки, трансформированные требуемой последовательностью ДНК.

Escherichia coli является примером прокариотических клеток хозяина, которые можно использовать для клонирования полинуклеотида, кодирующего рассматриваемое антитело. Другие подходящие для этого хозяева-микробы включают бациллы, как-то Bacillus subtilis, и другие энтеробактерии, как-то Salmonella, Serratia, и различные виды Pseudomonas. В этих прокариотических организмах можно получать экспрессионные вектора, которые должны будут содержать контролирующие экспрессию последовательности, совместимые с клетками хозяина (например, начало репликации). Кроме того, будет присутствовать любое число различных хорошо известных промоторов типа системы лактозных промоторов, системы триптофановых (trp) промоторов, промоторов β-лактамазы или промоторов фага лямбда. Промоторы должны контролировать экспрессию, необязательно с последовательностью оператора, и содержать последовательности сайта связывания с рибосомой и др. для инициации и завершения транскрипции и трансляции.

Для экспрессии применимы и другие микроорганизмы, такие как дрожжи. Примерами подходящих дрожжевых клеток хозяина являются Saccharomyces (например, S. cerevisiae) и Pichia с соответствующими векторами, содержащими контролирующие экспрессию последовательности (например, промоторы), начало репликации, последовательности терминации и др., как потребуется. Типичными промоторами являются промоторы 3-фосфоглицераткиназы и других гликолитических ферментов. Индуцибельные дрожжевые промоторы включают, среди прочего, промоторы алкогольдегидрогеназы, изоцитохрома С и ферментов, ответственных за утилизацию мальтозы и галактозы.

Наряду с микроорганизмами, для экспрессии и получения рассматриваемого антитела можно использовать и клетки млекопитающих (например, клетки млекопитающих, выращенные в культуре клеток in vitro). См. Winnacker, From Genes to Clones, VCH Publishers, N.Y., N.Y. (1987). Подходящими клетками млекопитающих являются линии клеток СНО, различные линии клеток COS, клетки HeLa, линии клеток миеломы и трансформированные В-клетки или гибридомы. Экспрессионные вектора для этих клеток могут включать контролирующие экспрессию последовательности, такие как начало репликации, промотор и энхансер (Queen et al., Immunol. Rev. 89:49 (1986)), и необходимые для процессинга сайты, такие как сайты связывания с рибосомой, сайты сплайсинга РНК, сайты полиаденилирования и последовательности терминаторов транскрипции. Примерами подходящих контролирующих экспрессию последовательностей являются промоторы, происходящие из генов иммуноглобулинов, SV40, аденовирусов, бычьего вируса папилломы, цитомегаловируса и др. См. Со et al., J. Immunol. 148:1149 (1992).

После синтеза (химического либо рекомбинантного) целые антитела, их димеры, индивидуальные легкие и тяжелые цепи или другие формы рассматриваемого антитела (например, scFv и др.) могут быть очищены согласно стандартным процедурам, включая осаждение сульфатом аммония, аффинные колонки, колоночную хроматографию, методы высокоэффективной жидкостной хроматографии (HPLC), гель-электрофореза др. (вообще см. Scopes, Protein Purification (Springer-Verlag, N.Y., (1982)). Рассматриваемое антитело может быть существенно очищенным, например, по меньшей мере на 80-85%, на 85-90%, на 90-95% или на 98-99% или больше, например, свободным от таких загрязнений, как осколки клеток, другие макромолекулы, чем рассматриваемое антитело, и др.

Композиции

В настоящем описании представлены композиции, содержащие рассматриваемое антитело. Композиция рассматриваемого антитела, наряду с рассматриваемым антителом, может содержать одно или несколько из следующего: соль, например, NaCl, MgCl, KCl, MgSO4 и др.; буферное вещество, например, трис-буфер, N-(2-гидроксиэтил)пиперазин-N′-(2-этансульфоновую кислоту) (HEPES), 2-(N-морфолино)этансульфоновую кислоту (MES), натриевую соль 2-(N-морфолино)этансульфоновой кислоты (MES), 3-(N-морфолино) пропансульфоновую кислоту (MOPS), N-трис[гидроксиметил]метил-3-аминопропансульфоновую кислоту (TAPS) и др.; солюбилизирующее вещество; детергент, например, неионный детергент типа Tween-20 и др.; ингибитор протеазы; глицерин и др.

В настоящем описании представлены композиции, включая фармацевтические композиции, содержащие рассматриваемое антитело. В общем, композиция содержит эффективное количество данного антитела. "Эффективное количество" означает дозу, достаточную для получения требуемого результата, например, снижения числа раковых клеток, размера опухоли и т.д., ослабления симптомов рака или фиброзного заболевания. В общем, требуемым результатом является по крайней мере ослабление симптомов рака или фиброзного заболевания по сравнению с контролем. Рассматриваемое антитело может вводиться таким образом, чтобы оно обходило гематоэнцефалический барьер, как описано более подробно ниже. Рассматриваемое антитело может быть составлено и/или модифицировано таким образом, чтобы оно проникало через гематоэнцефалический барьер.

Лекарственные формы

В рассматриваемых способах данное антитело может вводиться в организм любым стандартным способом, способным принести требуемый терапевтический эффект или диагностический эффект.Так, оно может входить в целый ряд лекарственных форм для лечебного применения. В частности, данное антитело может быть заключено в фармацевтические композиции вместе с подходящими и фармацевтически приемлемыми носителями или разбавителями и может входить в препараты в твердой, полутвердой, жидкой или газообразной форме, как-то таблетки, капсулы, порошки, гранулы, мази, растворы, свечи, инъекции, ингаляторы и аэрозоли.

В фармацевтических дозовых формах рассматриваемое антитело может вводиться в виде фармацевтически приемлемых солей, которые могут применяться сами по себе или в подходящей ассоциации, а также в комбинации с другими фармацевтически активными соединениями. Следующие способы и наполнители приводятся только для примера и никоим образом не для ограничения.

Для пероральных препаратов рассматриваемое антитело может применяться само по себе или в комбинации с соответствующими добавками для составления таблеток, порошков, гранул или капсул, к примеру, с обычными добавками, такими как лактоза, маннитол, кукурузный крахмал или картофельный крахмал; со связующими веществами, такими как кристаллическая целлюлоза, производные целлюлозы, гуммиарабик, кукурузный крахмал или желатин; с дезинтегрирующими веществами, такими как кукурузный крахмал, картофельный крахмал или натриевая карбоксиметилцеллюлоза; со смазывающими веществами, такими как тальк или стеарат магния; а если нужно, то с разбавителями, буферными веществами, консервантами и ароматизаторами.

Рассматриваемое антитело может быть заключено в препараты для инъекций путем растворения, суспендирования или эмульгирования его в водном или неводном растворителе, таком как растительное или какое-то другое масло, синтетические кислые алифатические глицериды, эфиры высших алифатические кислот или пропиленгликоль; а если нужно, то с обычными добавками, такими как солюбилизаторы, изотонические вещества, суспендирующие вещества, эмульгаторы, стабилизаторы и консерванты.

Фармацевтические композиции, содержащие рассматриваемое антитело, получают смешиванием антитела требуемой степени чистоты с необязательно физиологически приемлемыми носителями, эксципиентами, стабилизаторами, детергентами, буферами и/или изотоническими веществами. Приемлемые носители, эксципиенты и/или стабилизаторы не должны быть токсичными для получателей в используемых дозах и концентрациях и включают буфера типа фосфатного, цитратного и других органических кислот; антиоксиданты, включая аскорбиновую кислоту, глутатион, цистеин, метионин и лимонную кислоту; консерванты (как-то этанол, бензиловый спирт, фенол, м-крезол, n-хлор-м-крезол, метил- или пропилпарабены, бензалконий хлорид или их комбинации); аминокислоты, такие как аргинин, глицин, орнитин, лизин, гистидин, глутаминовая кислота, аспарагиновая кислота, изолейцин, лейцин, аланин, фенилаланин, тирозин, триптофан, метионин, серин, пролин и их комбинации; моносахариды, дисахариды и другие углеводы; низкомолекулярные (менее чем 10 остатков) полипептиды; белки, такие как желатин или сывороточный альбумин; хелатирующие агенты, такие как EDTA; сахара, такие как трегалоза, сахароза, лактоза, глюкоза, манноза, мальтоза, галатоза, фруктоза, сорбоза, раффиноза, глюкозамин, N-метилглюкозамин, галактозамин и нейраминовая кислота; и/или неионные детергенты, такие как Tween, Brij, Pluronics, Triton-X или полиэтиленгликоль (ПЭГ).

Фармацевтическая композиция может находиться в жидком виде, лиофилизованном виде или жидком виде, восстановленном из лиофилизованной формы, при этом лиофилизованный препарат должен быть восстановлен стерильным раствором перед введением. Стандартная методика восстановления лиофилизованной композиции состоит в добавлении туда объема чистой воды (обычно эквивалентного объему, удаленному при лиофилизации); однако при получении фармацевтических композиций для парентерального введения можно использовать растворы, содержащие антибактериальные средства; см. также Chen (1992) Drug Dev Ind Pharm 18, 1311-54.

Типичные концентрации антител в рассматриваемой фармацевтической композиции могут составлять от 1 мг/мл до 200 мг/мл или от 50 мг/мл до 200 мг/мл или от 150 мг/мл до 200 мг/мл.

Водные составы антител можно готовить в забуференном растворе, например, до рН в диапазоне от 4,0 до 7,0, от 5,0 до 6,0 или же при 5,5. Примеры буферов, подходящих для рН в этом диапазоне, включают фосфатный, гистидиновый, цитратный, сукцинатный, ацетатный буфер и буфера из других органических кислот. Концентрация буфера может составлять от 1 мМ до 100 мМ или от 5 мМ до 50 мМ в зависимости, например, от буфера и требуемой тоничности состава.

В лекарственную форму антитела может входить вещество для модулирования тоничности состава. Типичными веществами для поддержания тоничности являются хлорид натрия, хлорид калия, глицерин и любые другие компоненты из группы аминокислот, Сахаров, а также их комбинации. В некоторых воплощениях водные формы являются изотоничными, хотя могут подойти и гипертоничные или гипотоничные растворы. Термином "изотоничный" обозначаются растворы с такой же тоничностью, как и другой раствор, с которым он сравнивается, как-то физиологический солевой раствор или сыворотка. Вещества для поддержания тоничности могут применяться в количестве от 5 мМ до 350 мМ, например, в количестве от 100 мМ до 350 мМ.

В состав лекарственной формы антитела может входить детергент для уменьшения агрегации заключенных в нем антител и/или минимизации образования твердых частиц и/или уменьшения адсорбции. Типичными детергентами являются полиоксиэтиленсорбитановые эфиры жирных кислот (Tween), алкиловые эфиры полиоксиэтилена (Brij), алкилфениловые эфиры полиоксиэтилена (Triton-X), сополимеры полиоксиэтилена и полиоксипропилена (Poloxamer, Pluronic) и додецил сульфат натрия (SDS). Примерами подходящих полиоксиэтиленсорбитановых эфиров жирных кислот являются полисорбат 20 (продается под торговой маркой Tween 20™) и полисорбат 80 (продается под торговой маркой Tween 80™). Примерами подходящих сополимеров полиоксиэтилена и полиоксипропилена являются те, что продаются под наименованием Pluronic F68 или Poloxamer 188™. Примерами подходящих алкиловых эфиров полиоксиэтилена являются те, что продаются под торговой маркой Brij™. Типичные концентрации детергентов составляют от 0,001% до 1% масс.

Для защиты лабильного активного ингредиента (например, белка) от дестабилизирующих условий в процессе лиофилизации также можно добавлять лиопротекторы. Например, известными липопротекторами являются сахара (в том числе глюкоза и сахароза); полиолы (в том числе маннитол, сорбитол и глицерин); и аминокислоты (в том числе аланин, глицин и глутаминовая кислота). Лиопротекторы можно включать в количестве от 10 мМ до 500 мМ.

В некоторых воплощениях лекарственная форма включает рассматриваемое антитело и одно или несколько из вышеприведенных веществ (например, детергент, буфер, стабилизатор, веществ для поддержания тоничности) и в основном свободна от одного или нескольких консервантов, таких как этанол, бензиловый спирт, фенол, м-крезол, n-хлор-м-крезол, метил- или пропилпарабен, бензалконий хлорид и их комбинации. В других воплощениях консервант входит в состав, например, в концентрации от 0,001 до 2% масс.

Например, рассматриваемая лекарственная форма может представлять собой жидкую или лиофилизованную форму, пригодную для парентерального введения, и может содержать: от 1 мг/мл до 200 мг/мл рассматриваемого антитела; от 0,001% до 1% по меньшей мере одного детергента; от 1 мМ до 100 мМ буфера; необязательно от 10 мМ до 500 мМ стабилизатора и от 5 мМ до 305 мМ поддерживающего тоничность вещества; а его значение рН составляет от 4,0 до 7,0.

В качестве другого примера парентеральная лекарственная форма представляет собой жидкую или лиофилизованную форму, содержащую: от 1 мг/мл до 200 мг/мл рассматриваемого антитела; 0,04% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ сахарозы; и имеет рН 5,5.

В качестве другого примера парентеральная лекарственная форма представляет собой лиофилизованную форму, содержащую: 1) 15 мг/мл рассматриваемого антитела; 0,04% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ сахарозы; и имеет рН 5,5; или 2) 75 мг/мл рассматриваемого антитела; 0,04% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ сахарозы; и имеет рН 5,5; или 3) 75 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ сахарозы; и имеет рН 5,5; или 4) 75 мг/мл рассматриваемого антитела; 0,04% масс. Tween 20; 20 мМ L-гистидиыа; и 250 мМ трегалозы; и имеет рН 5,5; или 6) 75 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ трегалозы; и имеет рН 5,5.

В качестве другого примера парентеральная лекарственная форма представляет собой жидкую форму, содержащую: 1) 7,5 мг/мл рассматриваемого антитела; 0,022% масс. Tween 20; 120 мМ L-гистидина; и 125 мМ сахарозы; и имеет рН 5,5; или 2) 37,5 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; мМ L-гистидина; и 125 мМ сахарозы; и имеет рН 5,5; или 3) 37,5 мг/мл рассматриваемого антитела; 0,01% масс. Tween 20; 10 мМ L-гистидина; и 125 мМ сахарозы; и имеет рН 5,5; или 4) 37,5 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 10 мМ L-гистидина; 125 мМ трегалозы; и имеет рН 5,5; или 5) 37,5 мг/мл рассматриваемого антитела; 0,01% масс. Tween 20; 10 мМ L-гистидина; и 125 мМ трегалозы; и имеет рН 5,5; или 6) 5 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ трегалозы; и имеет рН 5,5; или 7) 75 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ маннитола; и имеет рН 5,5; или 8) 75 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 20 мМ L-гистидина; и 140 мМ хлорида натрия; и имеет рН 5,5; или 9) 150 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ трегалозы; и имеет рН 5,5; или 10) 150 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 20 мМ L-гистидина; и 250 мМ маннитола; и имеет рН 5,5; или 11) 150 мг/мл рассматриваемого антитела; 0,02% масс. Tween 20; 20 мМ L-гистидина; и 140 мМ хлорида натрия; и имеет рН 5,5; или 12) 10 мг/мл рассматриваемого антитела; 0,01% масс. Tween 20; 20 мМ L-гистидина; и 40 мМ хлорида натрия; и имеет рН 5,5.

Рассматриваемое антитело может применяться в составе аэрозоля для введения путем ингаляции. Данное антитело может входить в состав находящихся под давлением приемлемых вытеснителей, таких как дихлордифторметан, пропан, азот и др.

Более того, рассматриваемое антитело может входить в состав свечей при смешивании с различными основами типа эмульгирующих основ или водорастворимых основ. Данное антитело может вводиться интраректально через свечи. Свечи могут включать носители, такие как масло какао, карбовакс и полиэтиленгликоли, которые плавятся при температуре тела, но затвердевают при комнатной температуре.

Могут предусматриваться стандартные дозовые формы для перорального или ректального введения, как-то сиропы, эликсиры и суспензии, при этом каждая дозовая форма, к примеру, чайная ложка, столовая ложка, таблетка или свеча содержит заданное количество рассматриваемого антитела. Точно так же стандартные дозовые формы для инъекций или внутривенного введения могут содержать рассматриваемое антитело в композиции в виде раствора в стерильной воде, нормальном физрастворе или другом фармацевтически приемлемом носителе.

Термин "стандартная дозовая форма" в настоящем изобретении относится к физически дискретным единицам, подходящим в качестве единиц дозы для человека и животных, причем каждая единица содержит заданное количество рассматриваемого LOXL2-связывающего агента, рассчитанное в количестве, достаточном для получения требуемого эффекта вместе с фармацевтически приемлемым разбавителем или носителем. Спецификации для данного LOXL2-связывающего агента могут зависеть от самого LOXL2-связывающего агента и того эффекта, который нужно получить, а также фармакодинамики по каждому антителу в организме.

Другие способы введения также находят применение в рассматриваемом способе. Например, рассматриваемое антитело может быть заключено в свечи, а в некоторых случаях в аэрозоли и интраназальные композиции. Для свечей в состав носителя должны входить включать традиционные связывающие вещества и такие носители, как полиалкиленгликоли или триглицериды. Такие свечи могут быть получены из смесей, содержащих активный ингредиент в пределах от 0,5% до 10% масс., например, от 1% до 2%.

Интраназальные формы обычно включают носители, которые не вызывают раздражения слизистой оболочки носа и не нарушают существенно цилиарную функцию. Можно использовать такие разбавители, как вода, водный солевой раствор или другие известные субстанции. Интраназальные формы также могут содержать консерванты, в том числе хлорбутанол и бензалконий хлорид. Может присутствовать и детергент для усиления всасывания рассматриваемых белков слизистой оболочкой.

Рассматриваемое антитело может вводиться в виде формы для инъекций. Обычно композиции для инъекций готовятся в виде жидких растворов или суспензий; также можно приготовить твердые формы, пригодные для растворения или суспендирования в жидком носителе перед инъекцией. Препарат также может быть эмульгирован или антитело инкапсулировано в липосомных носителях.

Подходящими носителями являются, к примеру, вода, физраствор, декстроза, глицерин, этанол и др. и их комбинации. Кроме того, если нужно, носитель может содержать небольшое количество вспомогательных веществ, как-то увлажняющих или эмульгирующих веществ или рН-буферных веществ. Фактические способы получения таких дозовых форм известны или должны быть известны специалистам в данной области. Например, см. Remington′s Pharmaceutical Sciences, Mack Publishing Company, Easton, Pennsylvania, 17th edition, 1985. Вводимые композиции или лекарственные формы, в любом случае, должны содержать количество рассматриваемого антитела, адекватное для достижения требуемого состояния у подлежащего лечению субъекта.

Фармацевтически приемлемые эксципиенты, как-то переносчики, адъюванты, носители или разбавители, являются общедоступными. Более того, общедоступными являются и такие фармацевтически приемлемые вспомогательные вещества, как средства доведения рН и буферные вещества, средства доведения тоничности, стабилизаторы, смачивающие вещества и др.

В некоторых воплощениях рассматриваемое антитело входит в состав формы с контролируемым высвобождением. Препараты с замедленным высвобождением могут быть получены хорошо известными способами. Подходящие примеры препаратов с замедленным высвобождением включают полупроницаемые матрицы из твердых гидрофобных полимеров, содержащих антитело, при этом матрицы имеют вид формованных изделий, например, пленок ИЛИ микрокапсул. Примеры матриц с замедленным высвобождением включают полиэфиры, сополимеры L-глутаминовой кислоты и этил-L-глутамата, не разлагающийся этилен-винил ацетат, гидрогели, полилактиды, разлагающиеся сополимеры молочной и гликолевой кислоты и поли-D-(-)-3-оксимасляная кислота. Возможную потерю биологической активности и возможные изменения в иммуногенности антител, содержащихся в препаратах с замедленным высвобождением, можно предотвратить с помощью соответствующих добавок, контролируя содержание влаги и путем разработки специфических композиций полимерных матриц.

Контролируемое высвобождение может означать любые из целого ряда дозовых форм с замедленным высвобождением. Следующие термины можно рассматривать как практически эквивалентные контролируемому высвобождению: продолжительное высвобождение, контролируемое высвобождение, замедленное высвобождение, депо, постепенное высвобождение, продолжительное высвобождение, запрограммированное высвобождение, длительное высвобождение, пропорциональное высвобождение, продленное высвобождение, депонированное, замедленное, медленное высвобождение, распределенное высвобождение, затяжное высвобождение, фиксированное по времени, замедленное выделение, длительное выделение, последовательное выделение, лекарства длительного действия, продолжительного действия, неоднократного действия, медленного действия, затяжного действия и растянутого высвобождения. Дополнительное обсуждение этих терминов приведено в Lesczek Krowczynski, Extended-Release Dosage Forms, 1987 (CRC Press, Inc.).

Различные технологии контролируемого высвобождения охватывают очень широкий круг дозированных лекарственных форм. Технологии контролируемого высвобождения включают, без ограничения, физические системы и химические системы.

Физические системы включают, без ограничения, резервуарные системы с контролирующими скорость мембранами, как-то микроинкапсулирование, макроинкапсулирование и мембранные системы; резервуарные системы без контролирующих скорость мембран, как-то полые волокна, ультрамикропористая триацетатцеллюлоза и пористые полимерные субстраты и пены; монолитные системы, включая системы, физически растворенные в непористых, полимерных или эластомерных матрицах (например, неэродируемых, эродируемых, пропускающих окружающие вещества и разлагаемых), и материалы, физически диспергированные в непористых, полимерных или эластомерных матрицах (например, неэродируемых, эродируемых, пропускающих окружающие вещества и разлагаемых); ламинированные структуры, включая резервуарные слои, химически сходные или несходные с внешними контрольными слоями; и другие физические методы, как-то осмотические насосы или адсорбция на ионообменные смолы.

Химические системы включают, без ограничения, химическую эрозию полимерных матриц (например, гетерогенную или гомогенную эрозию) или биологическую эрозию полимерных матриц (например, гетерогенную или гомогенную). Дополнительное обсуждение различных систем для контролируемого высвобождения приведено в Agis F. Kydonieus, Controlled Release Technologies: Methods, Theory and Applications, 1980 (CRC Press, Inc.).

Существует ряд лекарственных форм с контролируемым высвобождением, разработанных для перорального введения. Они включают, без ограничения, контролируемые осмотическим давлением системы желудочно-кишечной доставки; контролируемые гидродинамическим давлением системы желудочно-кишечной доставки; контролируемые проницаемостью мембранные системы доставки в желудочно-кишечной доставки, которые включают контролируемые проницаемостью микропористые мембранные устройства желудочно-кишечной доставки; устойчивые к желудочному соку, нацеленные на кишечник устройства желудочно-кишечной доставки с контролируемым высвобождением; контролируемые диффузией в геле системы желудочно-кишечной доставки; и контролируемые ионным обменом системы желудочно-кишечной доставки, которые включают катионные и анионные препараты. Дополнительная информация по системам доставки лекарств с контролируемым высвобождением приведена в Yie W. Chien, Novel Drug Delivery Systems, 1992 (Marcel Dekker, Inc.).

Дозировка

Подходящую дозировку может определить лечащий врач или другой квалифицированный персонал, исходя из различных клинических факторов. Как хорошо известно в области медицины, дозировка для любого пациента зависит от многих факторов, включая размеры пациента, площадь поверхности тела, возраст, конкретное вводимое соединение, пол пациента, время и способ введения, общее состояние здоровья и одновременное введение других препаратов. Рассматриваемое антитело может вводиться в количестве от 1 нг/кг веса тела до 20 мг/кг веса тела на дозу, например, от 0,1 мг/кг веса тела до 10 мг/кг веса тела, например, от 0,5 мг/кг веса тела до 5 мг/кг веса тела; однако предусмотрены и дозы ниже или выше этого типичного диапазона, особенно с учетом вышеназванных факторов. Если схема предусматривает непрерывную инфузию, то она также может быть в пределах от 1 мкг до 10 мг на килограмм веса тела в минуту.

Специалистам должно быть понятно, что уровень дозы может варьировать в зависимости от конкретного антитела, тяжести симптомов и восприимчивости субъекта к побочным эффектам. Предпочтительная дозировка для данного соединения легко определяется специалистами различными способами.

Способы введения

Рассматриваемое антитело вводится индивидам любым доступным способом или путем, подходящим для доставки лекарств, включая способы in vivo и ex vivo, а также системные и местные способы введения.

Обычные и фармацевтически приемлемые способы введения включают интраназальное, внутримышечное, интратрахеальное, подкожное, внутрикожное, топическое нанесение, внутривенное, внутриартериальное, ректальное, назальное, пероральное и другие энтеральные и парентеральные способы введения. Способы введения можно комбинировать, если нужно, или подбирать в зависимости от антитела и/или требуемого эффекта. Композиция рассматриваемого антитела может вводиться в виде однократной дозы или множественных доз. В некоторых воплощениях композиция данного антитела вводится перорально. В некоторых воплощениях композиция данного антитела вводится путем ингаляции. В некоторых воплощениях композиция данного антитела вводится интраназально. В некоторых воплощениях композиция данного антитела вводится локально. В некоторых воплощениях композиция данного антитела вводится интракраниально. В некоторых воплощениях композиция данного антитела вводится внутривенно.

Средство может вводиться в организм любым стандартным способом и путем, подходящим для доставки обычных лекарств, включая системные или локальные пути. В общем, предусмотренные способы введения включают, без особых ограничений, энтеральное, парентеральное или ингаляционное введение.

Парентеральные способы введения, помимо ингаляции, включают, без особых ограничений, топическое, трансдермальное, подкожное, внутримышечное, интраорбитальное, интракапсулярное, интраспинальное, интрастернальное, внутривенное введение, т.е. любые способы введения, кроме как через пищеварительный тракт.Парентеральное введение может осуществляться для системной или местной доставки рассматриваемого антитела. Если требуется системная доставка, то введение обычно включает инвазивное либо топическое или мукозальное введение действующих системно фармацевтических препаратов.

Рассматриваемое антитело также может вводиться субъекту энтерально. Энтеральные способы введения включают, без особых ограничений, пероральное и ректальное (т.е. с помощью свечей) введение.

Под "лечением" подразумевается по крайней мере ослабление симптомов, связанных с патологическим состоянием у больного, при этом ослабление используется в широком смысле и означает по меньшей мере уменьшение величины параметра, например, симптома, связанного с подлежащим лечению заболеванием типа рака, и связанной с ним боли. При этом лечение также охватывает ситуации, при которых заболевание или хотя бы связанные с ним симптомы полностью подавлялись, например, не возникали или прерывались, например, прекращались с тем, чтобы организм больше не страдал от заболевания или хотя бы от характеризующих его симптомов.

В некоторых воплощениях рассматриваемое антитело вводится посредством инъекции и/или уколом, например, в артерию головного мозга или прямо в ткань мозга. Данное антитело также может вводиться непосредственно в намеченное место, например, посредством биолистической доставки в намеченное место.

Лечению в соответствии с рассматриваемыми способами подлежат многие организмы (при этом термин "организм" применяется взаимозаменимо с терминами "субъект", "индивид" и "пациент"). Обычно такими организмами являются "млекопитающие", причем этот термин применяется в широком смысле для обозначения организмов из класса млекопитающих, включая отряды хищных (например, собаки и кошки), грызунов (например, мыши, морские свинки и крысы) и приматов (например, люди и другие приматы, как-то шимпанзе и макаки). В некоторых воплощениях организмы представлены людьми.

Способы лечения

В настоящем изложении также представлены композиции, наборы, способы профилактики и лечения заболеваний, связанных с ангиогенезом, фиброзом, опухолями и метастазами.

В одном воплощении представлены способы лечения или профилактики инвазии или метастазирования опухолей у субъектов in vivo, включающие введение субъекту эффективного количества рассматриваемого антитела.

В другом воплощении представлены способы уменьшения роста опухолей у субъектов in vivo, включающие введение субъекту эффективного количества рассматриваемого антитела с тем, чтобы рост опухоли уменьшился по меньшей мере на 25%, 50%, 75%, 90% или 95%. В некоторых воплощениях опухоли могут представлять собой метастатические опухоли.

В следующем воплощении представлены способы повышения шансов на выживание у субъектов с метастатическими опухолями, включающие введение нуждающемуся в этом субъекту эффективного количества рассматриваемого антитела, при этом у обработанных субъектов повышаются шансы на выживание на определенный период времени. В некоторых воплощениях выживаемость субъекта возрастает по меньшей мере на 10 дней, 1 месяц, 3 месяца, 6 месяцев, 1 год, 1,5 года, 2 года, 3 года, 4 года, 5 лет, 8 лет или 10 лет.

Композиции могут вводиться пациентам (например, млекопитающим типа человека или другим животным, как-то приматам, грызунам, коровам, лошадям, свиньям, овцам и др.) в терапевтически эффективном количестве, которое эффективно дает требуемый терапевтический эффект путем ингибирования заболеваний типа описанных выше при разумном соотношении выгода/риск, применимом к любому медицинскому лечению. Для введения представленных композиций людям их можно составлять по методологии, известной рядовым специалистам. Терапевтически эффективное количество есть такое количество, которое хотя бы частично оказывает требуемый терапевтический или профилактический эффект на орган или ткань. В одном примере количество рассматриваемого антитела, необходимое для профилактики и/или терапевтического лечения заболевания, не фиксировано per se. Количество вводимого антитела будет зависеть от типа заболевания, выраженности заболевания и размеров страдающего им млекопитающего.

Положительный ответ достигается тогда, когда пациент испытывает частичное или полное ослабление или уменьшение признаков или симптомов заболевания и конкретно включает, без ограничения, продление срока жизни. Ожидаемая продолжительность жизни без прогрессирования может измеряться месяцами или годами в зависимости от прогностических факторов, включая количество рецидивов, стадию болезни и другие факторы. Продление срока жизни включает, без ограничения, по меньшей мере на 1 месяц, 2 месяца, 3 месяца, 4 месяца, 6 месяцев, 1 год, 2 года, 3 года или больше. Общая выживаемость также может измеряться месяцами или годами. Симптомы у пациента могут оставаться без изменений или могут уменьшаться.

Описанные здесь фармацевтические формы могут использоваться для профилактики или лечения широкого круга заболеваний, составной частью этиологии которых является перекрестное сшивание коллагена или усиление фиброза. Фиброз - это аномальное накопление волокнистой ткани, которое возникает в процессе заживления ран в поврежденной ткани. Такое повреждение тканей может быть результатом физического повреждения, воспаления, инфекции, воздействия токсинов и других причин.

Комбинированная терапия

Рассматриваемое антитело может вводиться нуждающемуся в этом индивиду само по себе (например, в виде монотерапии). Однако данное антитело также может вводиться в виде комбинированной терапии с ОДНИМ ИЛИ несколькими другими терапевтическими средствами. Подходящими терапевтическими средствами являются, например, химиотерапевтические средства, антинеопластические биологические препараты, антиангиогенные средства и противофиброзные средства, предназначенные для профилактики или лечения этих заболеваний.

Рассматриваемое антитело в некоторых воплощениях может замедлить или остановить прогрессирование эпителиально-мезенхимального перехода (ЕМТ) в раковых клетках или вызывать эпителиально-мезенхимальный переход (MET) в менее онкогенное состояние, тем самым делая раковые или больные клетки более чувствительными к химиотерапевтическим средствам, антинеопластическим биологическим препаратам, антиангиогенным средствам и противофиброзным средствам. Синергические комбинации данного антитела с другими терапевтическими средствами применимы для профилактики или ингибирования инвазии и метастазирования опухолей, ингибирования роста первичных опухолей путем сенсибилизации раковых клеток к цитотоксическим эффектам терапевтических средств, а также для эффективного предотвращения или лечения рака.

В настоящем изобретении термин "химиотерапевтическое средство" или "средство химиотерапии" (в случае лечения химиотерапевтическим средством) охватывает любые небелковые (т.е. непептидные) химические соединения, применимые при лечении рака. Примеры терапевтических средств включают алкилирующие реагенты типа тиотепа и циклофосфамида (Cytoxan™); алкилсульфонаты, как-то бусульфан, импросульфан и пипосульфан; азиридины, как-то бензодопа, карбоквон, метуредопа и уредопа; этиленимины и метиламеламины, в том числе алтретамин, триэтиленмеламин, триэтиленфосфорамид, триэтилентиофосфорамид и триметилоломеламин; ацетогенины (например, буллатацин и буллатацинон); камптотецин (включая синтетический аналог топотекан); бриостатин; каллистатин; СС-1065 (включая его синтетические аналоги адозелесин, карзелесин и бизелесин); криптофицины (особенно криптофицин 1 и криптофицин 8); доластатин; дуокармицин (включая его синтетические аналоги KW-2189 и CBI-TMI); элеутеробин; панкратистатин; саркодиктин; спонгистатин; соединения иприта, как-то хлорамбуцил, хлорнафазин, хлорфосфамид, эстрамустин, ифосфамид, мехлорэтамин, мехлорэтамин оксид гидрохлорид, мельфалан, новембицин, фенестрин, преднимустин, трофосфамид, урациловый иприт; такие нитрозомочевины, как кармустин, хлорозотоцин, форемустин, ломустин, нимустин, ранимустин; антибиотики типа энедииновых антибиотиков (например, калихеамицин, особенно калихеамицин гамма1I и калихеамицин фиI1, например, см. Agnew, Chem. Intl. Ed. Engl., 33: 183-186 (1994); динемицин, включая динемицин А; бифосфонаты типа клодроната; эсперамицин; а также хромофор неокарциностатин и родственные хромофоры - хромопротеины энедииновых антибиотиков; аклазиномицины, актиномицин, аутрамицин, азасерин, блеомицины, кактиномицин, карабицин, карминомицин, карцинофилин, хромомицины, дактиномицин даунорубицин, деторубицин, 6-диазо-5-оксо-L-норлейцин, доксорубицин (Adriamycin™) (в том числе морфолино-доксорубицин, цианоморфолино-доксорубицин, 2-пирролино-доксорубицин и дезоксидоксорубицин), эпирубицин, эсорубицин, идарубицин, марцелломицин, митомицины типа митомицина С, микофеноловая кислота, ногаламицин, оливомицины, пепломицин, потфиромицин, пуромицин, квеламицин, родорубицин, стрептонигрин, стрептозоцин, туберцидин, убенимекс, зиностатин, зорубицин; такие антиметаболиты, как метотрексат и 5-фторурацил (5-FU); аналоги фолиевой кислоты, как-то демоптерин, метотрексат, птероптерин, триметрексат; аналоги пуринов, как-то флударабин, 6-меркаптопурин, тиамиприн, тиогуанин; аналоги пиримидинов, как-то анцитабин, азацитидин, 6-азауридин, кармофур, цитарабин, дидезоксиуридин, доксифлуридин, еноцитабин, флоксуридин; такие андрогены, как калустерон, дромостанолон пропионат, эпитиостанол, мепитиостан, тестолактон; антиадреналовые препараты, как-то аминоглутетимид, митотан, трилостан; восполнители фолиевой кислоты типа фролиновой кислоты; ацеглатон; альдофосфамид гликозид; аминолевулиновая кислота; энилурацил; амсакрин; бестабуцил; бисантрен; эдатраксат; дефофамин; демекольцин; диазиквон; эльфорнитин; элиптиний ацетат; эпотилон; этоглюцид; галлия нитрат; гидроксимочевина; лентинан; лонидамин; такие майтансиноиды, как майтансин и ансамитоцины; митогуазон; митоксантрон; мопидамол; нитракрин; пентостатин; фенамет; пирарубицин; лосоксантрон; подофиллиновая кислота; 2-этилгидразид; прокарбазин; PSK™; разоксан; ризоксин; сизофиран; спирогерманий; тенуазоновая кислота; триазиквон; 2,2′,2"-трихлортриэтиламин; трихотецены (например, токсин Т-2, верракурин А, роридин А и ангвидин); уретан; виндесин; дакарбазин; манномустин; митобронитол; митолактол; пипоброман; гацитозин; цитозин арабинозид ("Ага-С"); циклофосфамид; тиотепа; таксоиды, например, паклитаксель (Taxol™, Bristol Meyers Squibb Oncology, Prmceton, N.J.) и доцетаксель (Taxotere™, Rhone-Poulenc Rorer, Antony, France); хлорамбуцил; гемцитабин (Gemzar™); 6-тиогуанин; меркаптопурин; метотрексат; такие аналоги платины, как цисплатин и карбоплатин; винбластин; платина; этопозид (VP-16); ифосфамид; митоксантрон; винкристин; винорелбин (Navelbine™); новантрон; тенипозид; эдатрексат; дауномицин; аминоптерин; ксеолода; ибандронат; СРТ-11; ингибитор топоизоиеразы RFS 2000; дифторметилорнитин (DMFO); такие ретиноиды, как ретиноевая кислота; капецитабин; и фармацевтически приемлемые соли, кислоты или производные любых из вышеприведенных. Также в определение "химиотерапевтическое средство" входят антигормональные средства, действующие как регуляторы или ингибиторы действия гормонов на опухоли, как-то антиэстрогены и избирательные модуляторы эстрогеновых рецепторов (SERMs), включая, к примеру, тамоксифен (включая Nolvadex™), ралоксифен, дролоксифен, 4-гидрокситамоксифен, триоксифен, кеоксифен, LY117018, онапристон и торемифен (Fareston™); ингибиторы фермента ароматазы, регулирующего продукцию эстрогенов в надпочечниках, такие, к примеру, как 4(5)-имидазолы, аминоглутетимид, мегестрол ацетат (Megace™), экземестан, форместан, фадрозол, ворозол (Rivisor™), летрозол (Femara™) и анастрозол (Arimidex™);

и такие антиандрогены, как флутамид, нилутамид, бикалутамид, лейпролид и госерелин; и фармацевтически приемлемые соли, кислоты или производные любых из вышеприведенных.

В некоторых воплощениях антинеопластическое средство, которое комбинируется с рассматриваемым антителом, является ингибитором тирозинкиназы. Например, ZD1839 (Iressa™ фирмы AstraZeneca K.K.) проявляет конкуренцию за АТФ в АТФ-связывающем сайте тирозинкиназы EGFR (рецептора эпидермального фактора роста) и ингибирует активность тирозинкиназы путем ингибирования ее аутофосфорилирования.

В результате этого возникает противораковый эффект при блокировании передачи сигналов активирующих EGFR (такие лиганды, как эпидермальный фактор роста (EGF) связываются с внеклеточным доменом EGFR с последующей активацией тирозинкиназы EGFR во внутриклеточном домене, что вызывает не только аутофосфорилирование EGFR, но также и фосфорилирование различных внутриклеточных белков-мишеней, а затем передачу сигналов пролиферации из поверхности раковых клеток в ядро, что приводит к пролиферации, инфильтрации, метастазированию и ангиогенезу раковых клеток).

IMC-C225 или цетуксимаб (Erbitux™) - моноклональное антитело против EGFR, которое распознает рецепторную часть EGFR на поверхностной мембране клетки, ингибирует аутофосфорилирование EGFR и тем самым ингибирует активность тирозинкиназы. Герцептин, моноклональное антитело против Her2/Neu, который гомологичен EGFR, и иматиниб мезилат (Gleevec™, прежде STI-571) могут ингибировать тирозинкиназную активность и BCR-AbI, и c-kit. Сорафениб (Nexavar™) является низкомолекулярным ингибитором киназы Raf, киназ рецептора PDGF (фактора роста из тромбоцитов), рецепторов VEGF 2 и 3 и c-Kit.

В настоящем изобретении моноклональные антитела против опухолевых антигенов представляют собой антитела против антигенов, экспрессирующихся в опухолях и лейкемических клетках, к примеру, против опухолеспецифичных антигенов. Моноклональные антитела также включают полностью человеческие и гуманизированные антитела.

Другие примеры терапевтических антител для лечения рака включают трастузумаб (Herceptin™; суперэкспрессия белка HER2 связана с более агрессивным заболеванием и худшим прогнозом в клинике); ритуксимаб (Rituxan™), которое вырабатывается против CD20+ на клетках лимфомы и избирательно истощает нормальные и злокачественные пре-В и зрелые В-клетки CD20+; алемтузумаб (Campath™) - моноклональное антитело, специфичное к антигену CD52, который находится на В- и Т-лимфоцитах, и применяется для лечения хронической лимфоцитарной лейкемии (CLL) и лимфомы; и гемтузумаб-зогамицин (Mylotarg™) - антительный конъюгат, в котором сочетается специфичное к CD33 антитело с химиотерапевтическим препаратом (зогамицин), который назначается для лечения рецидивирующей взрослой формы острой миелоцитарной лейкемии.

В другом воплощении с рассматриваемым антителом комбинируется антиангиогенное средство для лечения рака и других заболеваний, связанных с аномальным или нежелательным ангиогенезом. Примеры антиангиогенных средств включают, без ограничения, ретиноевую кислоту и ее производные, 2-метоксиэстрадиол, Angiostatin™, Endostatin™, сурамин, скваламин, тканевой ингибитор металлопротеиназы-I, тканевой ингибитор металлопротеиназы-2, ингибитор-1 активатора плазминогена, ингибитор-2 активатора плазминогена, хрящевой ингибитор, паклитаксель, тромбоцитарный фактор 4, протаминсульфат (клупеин), сульфатированные производные хитина (полученные из раковин королевского краба), сульфатированный комплекс полисахаридов пептидогликана (sp-pg), стауроспорин, модуляторы метаболизма матрикса, включая, к примеру, аналоги пролина ((L-азетидин-2-карбоновую кислоту (LACA), цис-гидроксипролин, D,L-3,4-дегидропролин, тиапролин, α-дипиридил, β-аминопропионитрил фумарат, 4-пропил-5-(4-пиридинил)-2(3Н)-оксазолон)); метотрексат, митоксантрон, гепарин, интерфероны, 2-макроглобулин сывороточный, химп-3, химостатин, β-циклодекстрин тетрадекасульфат, эпинеомицин; фумагиллин, натриевый тиомалат золота, D-пеницилламин (CDPT), β1-антиколлагеназу сывороточную, α2-антиплазмин, бисантрен, лобензарит двунатриевый, двунатриевую соль N-2-карбоксифенил-4-хлорантрониловой кислоты или "ССА", талидомид, ангиостатические стероиды, карбоксиаминоимидазол; ингибиторы металлопротеиназ типа ВВ94. Другие антиангиогенные средства включают антитела, к примеру, моноклональные антитела против следующих ангиогенных факторов роста: bFGF, aFGF, FGF-5, изоформ VEGF, VEGF-C, HGF/SF и Ang-1/Ang-2. См. Ferrara N. and Alitalo K. "Clinical application ofangiogenic growth factors and their inhibitors" (1999) Nature Medicine 5: 1359-1364. Другие антиангиогенные средства могут включать ингибиторы транскрипции VEGF.

Способы диагностики

Рассматриваемое антитело применимо для детектирования предраковых клеток или раковых клеток. Так, в настоящем изложении представлены способы диагностики, включающие контактирование биологического образца, взятого у тестируемого индивида, с данным антителом против LOXL2; и детектирование связывания антитела против LOXL2 с эпитопом в биологическом образце. Биологический образец может представлять собой ткань; образец жидкости, содержащей клетки; или бесклеточный образец. Методом детектирования выявляется наличие и/или уровень LOXL2 в биологическом образце. При этом уровень полипептида LOXL2, превышающий контрольное значение в норме, указывает на раковое или предраковое состояние (например, указывает на наличие раковых или предраковых клеток в биологическом образце, содержащем клетки). В некоторых воплощениях антитело против LOXL2 помечено детектируемой меткой. В некоторых воплощениях антитело против LOXL2 иммобилизировано на нерастворимой подложке (например, на полоске, шариках, лунках многолуночного планшета и т.п.).

В некоторых воплощениях методом детектирования выявляются клетки, претерпевающие превращение из эпителия в мезенхиму. Превращение из эпителия в мезенхиму (ЕМТ) означает процесс, при котором клетки с экспрессией генов/фенотипом, характерным для эпителиальных клеток (т.е. экспрессирующие специфические белки, факторы и молекулы), изменяют свои гены или их уровень экспрессии, что приводит к изменению фенотипа клеток, что проявляется изменением экспрессируемых генов. ЕМТ может включать потерю контактного торможения, изменение регуляции роста и/или повышение инвазивности (Christiansen and Rajasekaran, Cancer Res., 66 (17): 8319-8326 (2006); и Thiery et al, Curr. Opin. Cell. Biol, 15: 740-6 (2003)). Молекулярные и морфологические признаки, характерные для ЕМТ, коррелируют со слабой гистологической дифференцировкой, нарушением целостности тканей и метастазированием. ЕМТ обеспечивает эпителиальным клеткам механизмы для преодоления физических ограничений, налагаемых на них межклеточными соединениями, и принятия подвижного фенотипа (Burdsal et al., Development 118: 829-44 (1993); и Nieto et al., Mech. Dev. 105: 27-35 (2001)).

Распространенными молекулярными маркерами ЕМТ являются усиление экспрессии N-кадгерина и виментина, ядерная локализация β-катенина и усиление продукции таких факторов транскрипции, как Snail I (Snail), Snail2 (Slug), Twist, EF1/ZEB1, SIP1/ZEB2 и/или Е47, которые ингибируют продукцию Е-кадгерина. Фенотипическими маркерами ЕМТ являются, без ограничения, повышение способности к миграции и трехмерной инвазии, а также устойчивость к апоптозу. Эти маркеры также коррелируют с индукцией ЕМТ и связаны с раковыми фенотипами. Способ диагностики в некоторых воплощениях, наряду с детектированием полипептида LOXL2, включает и детектирование одного или нескольких из числа Snail I (Snail), Snail2 (Slug), Twist, EF1/ZEB1, SIP1/ZEB2 и Е47.

Наличие ЕМТ при прогрессировании опухолей позволяет раковым клеткам получить способность к инфильтрации окружающей ткани и в конечном счете метастазировать к удаленным сайтам. Изменения экспрессии генов в раковых клетках могут означать переход от эпителиального или эпителиалеподобного профиля экспрессии генов к мезенхимальному или мезенхимоподобному профилю экспрессии генов. Например, выявление потери Е-кадгерина коррелирует с метастатической карциномой, а также с устойчивостью к такой терапии рака, как ингибиторы EGFR и ингибиторы IGF-R1. Анализ многих разных типов рака показал, что циркулирующие раковые клетки или те, что находятся в микрометастазах, проявляют мезенхимальное превращение, судя по изменениям экспрессии ряда маркеров. Такие маркеры включают, без ограничения, EGFR, Е-кадгерин, ErbВ3, RAB25, интегрин бета-6, кадгерин-2, связывающий фактор роста фибробластов белок-1, гомеобокс distal-less 1, ZEB1 (фактор транскрипции 8), SIP1 и виментин. Способ диагностики в некоторых воплощениях, наряду с детектированием полипептида LOXL2, включает и детектирование одного или нескольких из числа EGFR, Е-кадгерина, ErbB3, RAB25, интегрина бета-6, кадгерина-2, связывающего фактор роста фибробластов белка-1, гомеобокса distal-less I, ZEB1 (фактора транскрипции 8), SIP1 и виментина.

Способ диагностики в некоторых воплощениях, наряду с детектированием полипептида LOXL2, включает и детектирование одного или нескольких из числа EGFR, Е-кадгерина, ЕгЬВЗ, RAB25, интегрина бета-6, кадгерина-2, связывающего фактор роста фибробластов белка-1, гомеобокса distal-less 1, ZEB1 (фактора транскрипции 8), SIP1, виментина, Snail I (Snail), Snail2 (Slug), Twist, EF1/ZEB1, SIP1/ZEB2 и Е47.

Для оценки экспрессии эпителиальных или мезенхимальных биомаркеров в раковых клетках можно использовать образцы от пациентов, содержащие раковые клетки, либо белки или нуклеиновые кислоты, вырабатываемые этими раковыми клетками, в методах, описанных, к примеру, в Патент США No. 20070065858. Вкратце, уровень экспрессии биомаркера можно оценить путем определения количества (например, абсолютного количества или концентрации) маркера в образце раковых клеток, например, в биоптате опухоли, взятом у пациента, или другом образце от пациента, содержащем материал, происходящий из опухоли (например, кровь, сыворотку, мочу или другую жидкую среду или выделения организма, как описано выше). Конечно, клеточный образец после взятия может быть подвергнут целому ряду хорошо известных препаративных методов и методов хранения (например, экстракции нуклеиновой кислоты и/или белка, фиксации, хранения, замораживания, ультрафильтрации, концентрирования, упаривания, центрифугирования и т.п.) перед определением количества маркера в образце. Аналогичным образом биоптаты опухолей после взятия тоже могут быть подвергнуты препаративным методам и методам хранения, например, фиксации.

LOXL2 можно детектировать с помощью рассматриваемого антитела (например, меченого радиоизотопом, флуорофором или ферментом), производного антитела (например, антитела, конъюгированного с субстратом либо с белком или лигандом из пары белок-лиганд (например, биотин-стрептавидин) или фрагмента антитела (например, одноцепочечного антитела, выделенного гипервариабельного домена антитела и т.п.), специфически связывающегося с белком биомаркера или его фрагментом, включая такие белки биомаркеров, которые подвергались всем или части посттрансляционных модификаций, которым они обычно подвергаются в раковых клетках (например, гликозилированию, фосфорилированию, метилированию и др.).

При детектировании данным методом нескольких биомаркеров (например, LOXL2 и одного или нескольких из вышеприведенных биомаркеров) уровень каждого биомаркера в биологическом образце можно сравнивать с контрольным значением в норме, например, с нормальным уровнем каждого из нескольких биомаркеров в нераковых образцах одного и того же типа, либо в одной реакционной смеси (т.е. используя различные реагенты, как-то флуоресцентные зонды, для каждого биомаркера), либо в индивидуальных реакционных смесях, соответствующих одному или нескольким биомаркерам.

Уровень экспрессии биомаркера в нормальной (т.е. нераковой) ткани человека можно оценить различными способами. Такой нормальный уровень экспрессии можно оценить путем определения уровня экспрессии биомаркера в порции клеток, не являющихся раковыми, а затем сравнения нормального уровня экспрессии с уровнем экспрессии в порции раковых клеток. По мере поступления дальнейшей информации в результате рутинного выполнения описанных здесь методов можно будет использовать усредненные значения нормальной экспрессии биомаркеров в норме. С другой стороны, нормальный уровень экспрессии биомаркера можно установить путем определения экспрессии биомаркера в образцах, взятых у не страдающих раком пациентов, взятых у пациентов до предполагаемого появления рака, из архивных образцов пациентов и пр.

В общем, рассматриваемый способ диагностики включает контактирование биологического образца, в котором может содержаться биомаркер (например, полипептид LOXL2), с рассматриваемым антителом против LOXL2 в соответствующих условиях и в течение времени, достаточного для того, чтобы произошло взаимодействие и связывание полипептида LOXL2 (если он есть) и антитела, при этом образуется комплекс, который можно выделить и/или детектировать. Детектирование связывания между полипептидом LOXL2, который может присутствовать в биологическом образце, и данным антителом против LOXL2 может проводиться различными способами.

Например, один из способов проведения такого анализа включает фиксирование биомаркера или антитела против LOXL2 на твердофазной подложке, также именуемой субстратом, и детектирование искомых комплексов биомаркер/антитело против LOXL2, фиксированных на твердой фазе, по окончании реакции. В одном воплощении такого способа образец от субъекта, который нужно оценить на присутствие и/или концентрацию биомаркера, можно фиксировать на носителе или твердофазной подложке. В другом воплощении возможна обратная ситуация, при которой на твердой фазе фиксируется антитело против LOXL2, а образец от субъекта подвергается реакции в качестве нефиксированного компонента проб.

Существует несколько общепринятых способов фиксирования компонентов проб на твердой фазе. Они включают, без ограничения, иммобилизацию биомаркера или антитела против LOXL2 посредством конъюгации с биотином и стрептавидином. Такие биотинилированные компоненты проб можно получить из биотина-NHS (N-гидроксисукцинимида) известными методами (например, с помощью набора для биотинилирования фирмы Pierce Chemicals, Rockford, 111.) и иммобилизировать в лунках покрытых стрептавидином 96-луночных планшетов (Pierce Chemicals). В некоторых воплощениях поверхности с иммобилизованными компонентами проб можно приготовить заранее и хранить. Другие подходящие носители или твердофазные подложки для таких определений включают любые материалы, способные связываться с тем классом молекул, к которому относится биомаркер или зонд. Хорошо известными подложками или носителями являются, без ограничения, стекло, полистирен, нейлон, полипропилен, полиэтилен, декстран, амилоза, натуральная и модифицированная целлюлоза, полиакриламид и магнетит.При проведении определений по вышеприведенным подходам неиммобилизованный компонент добавляется к твердой фазе, на которой фиксирован второй компонент.После завершения реакции не образовавшие комплекс компоненты можно удалить (например, путем отмывания) в таких условиях, чтобы образовавшиеся комплексы остались иммобилизованными на твердой фазе. Детектирование комплексов LOXL2/aHTHTeno против LOXL2, фиксированных на твердой фазе, может осуществляться изложенными здесь способами. В одном воплощении антитело против LOXL2, если оно является нефиксированным компонентом проб, в целях детектирования и считывания проб можно пометить, прямо или косвенно, детектируемыми метками, приведенными здесь и хорошо известными специалистам.

Как отмечено выше, в некоторых воплощениях способ диагностики включает использование рассматриваемого антитела против LOXL2, помеченного детектируемой меткой. Термин "помечено" в отношении данного антитела охватывает прямое включение метки путем присоединения (т.е. физического соединения) детектируемого вещества к антителу, равно как и непрямое включение метки при реакции с другим реагентом, который непосредственно помечен. Примеры непрямого включения метки включают детектирование первичного антитела с помощью флуоресцентно меченого вторичного антитела.

Белки из раковых клеток можно выделить методами, которые хорошо известны специалистам. К примеру, можно использовать такие методы выделения белков, которые описаны в Harlow and Lane (Harlow and Lane, 1988, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.).

Для определения того, что образец содержит белок, который связывается с рассматриваемым антителом против LOXL2, можно использовать различные форматы. Примеры таких форматов включают, без ограничения, ферментный иммуноанализ (EIA), радиоиммуноанализ (RIA), метод Вестерн-блот и ферментный иммуносорбентный анализ (ELISA). Специалист легко сможет адаптировать известные методы детектирования белков/антител для определения того, экспрессируют ли раковые клетки определенный биомаркер (например, полипептид LOXL2).

В одном формате можно использовать антитела или фрагменты антител в таких методах, как Вестерн-блот или иммунофлуоресцентные методы для детектирования экспрессируемых белков. При этом либо антитело, либо белки фиксируются на твердой подложке. Подходящими твердофазными подложками или носителями являются любые подложки, способные связывать антиген или антитело. Хорошо известными подложками или носителями являются стекло, полистирен, полипропилен, полиэтилен, декстран, нейлон, амилоза, натуральная или модифицированная целлюлоза, полиакриламид, агароза и магнетит. Специалистам известны многие другие подходящие носители для связывания антител или антигенов и они смогут адаптировать такие подложки для рассматриваемого способа. Например, выделенные из раковых клеток белки можно разделить методом электрофореза в полиакриламидном геле и иммобилизировать на твердофазной подложке типа нитроцеллюлозы. Затем подложку можно промыть соответствующим буфером и обработать антителом с детектируемой меткой. Затем твердофазную подложку можно промыть буфером второй раз для удаления несвязанного антитела. Затем можно детектировать количество связавшейся на твердой подложке метки стандартными методами.

Для метода ELISA специфические связывающиеся пары могут быть иммунного или неиммунного типа. Иммунные специфические связывающиеся пары представлены системами антиген-антитело или гаптен-антитело против гаптена (антигаптен). Можно упомянуть пары флуоресцеин-антифлуоресцеин, динитрофенил-антидинитрофенил, биотин-антибиотин, пептид-антипептид и др. Антитела - члены специфических связывающихся пар можно получить обычными методами, известными специалистам. Такие методы включают иммунизацию животного антигеном - членом специфической связывающейся пары. Если антиген из специфической связывающейся пары не является иммуногенным, например, гаптеном, то его можно ковалентно присоединить к белку-носителю, который сделает его иммуногенным. Неиммунные связывающиеся пары включают системы, в которых два компонента обладают природным сродством друг к другу, но не являются антителами. Типичными неиммунными парами являются биотин-стрептавидин, внутренний фактор-витамин В 12, фолиевая кислота-фолат-связывающий белок и др.

Существуют различные методы для ковалентного мечения антител членами специфических связывающихся пар. Методы выбираются, исходя из природы членов специфической связывающейся пары, нужного типа связи и толерантности антитела к различным методам конъюгирования. Биотин можно ковалентно конъюгировать с антителами с помощью коммерчески доступных активных производных. Вот некоторые из них: биотин-К-гидроксисукцинимид, который связывается с аминогруппами белков; биотин-гидразид, который связывается с молекулами углеводов, альдегидами и карбоксильными группами при реакции с карбодиимидами; и биотинмалеимид и йодоацетилбиотин, которые связываются с сульфгидрильными группами. Флуоресцеин можно конъюгировать с аминогруппами белков с помощью флуоресцеинизотиоцианата. Динитрофенильные группы можно конъюгировать с аминогруппами белков с помощью 2,4-динитробензолсульфата или 2,4-динитрофторбензола. Другие стандартные методы конъюгирования, которые можно использовать для присоединения моноклональных антител к членам специфических связывающихся пар, включают диальдегидное, карбодиимидное конъюгирование, гомофункциональное перекрестное сшивание и гетеробифункциональное перекрестное сшивание. Карбодиимидное конъюгирование является эффективным методом конъюгирования карбоксильных групп одного вещества с аминогруппами другого. Карбодиимидное конъюгирование осуществляется при помощи коммерчески доступного реагента 1-этил-3-(диметиламинопропил)карбодиимида (EDAC).

Гомобифункциональные сшивающие реагенты, включая бифункциональные имидоэфиры и бифункциональные эфиры N-гидроксисукцинимида, коммерчески доступны и применяются для конъюгирования аминогрупп одного вещества с аминогруппами другого. Гетеробифункциональные сшивающие реагенты содержат неодинаковые функциональные группы. Наиболее распространенные коммерчески доступные гетеробифункциональные сшивающие реагенты содержат аминореактивный эфир N-гидроксисукцинимида в качестве одной функциональной группы и сульфгидрил-реактивную группу в качестве второй функциональной группы. Наиболее распространенными сульфгидрил-реактивными группами являются малеимиды, пиридилдисульфиды и активные галогены. Одной из функциональных групп может быть фотоактивный арилнитрен, который при облучении реагирует с самыми разными группами.

Помеченные детектируемой меткой антитела или члены специфических связывающихся пар получают путем конъюгирования с репортером, которым может быть радиоактивный изотоп, фермент, флуорогенный, хемилюминесцентный или электрохимический материал. Широко используются два радиоактивных изотопа: 125I и 3H. Стандартные методы мечения радиоактивными изотопами включают методы на основе хлорамина Т, лактопероксидазы и реактива Болтона-Хантера для 125I и восстановительное метилирование для 3H. Термин "помечено детектируемой меткой" относится к молекулам, помеченным таким образом, что их можно легко детектировать по собственной ферментативной активности метки или по связыванию с меткой другого компонента, который сам легко детектируется.

Подходящими для этого ферментами являются, без ограничения, пероксидаза хрена, щелочная фосфатаза, β-галактозидаза, глюкозоксидаза, люциферазы (в том числе люциферазы светлячков и Renilla), β-лактамаза, уреаза, зеленый флуоресцентный белок (GFP), красный флуоресцентный белок, желтый флуоресцентный белок и лизоцим. Мечение ферментами осуществляется методами диальдегидного, карбодиимидного конъюгирования, с помощью гомобифункциональных сшивающих реагентов и гетеробифункциональных сшивающих реагентов, как описано выше для конъюгирования антител с членами специфических связывающихся пар.

Выбор метода включения метки зависит от доступных функциональных групп на ферменте и подлежащего мечению материала, а также толерантности обоих к условиям конъюгирования. В рассматриваемом способе для введения метки может применяться, без ограничения, один из стандартных методов мечения, используемых в настоящее время, включая те, что описаны в Engvall and Pearlmann, Immunochemistry 8, 871 (1971); Avrameas and Temynck. Immunochemistry 8, 1175 (1975); Ishikawa et al„ J. Immunoassay 4 (3): 209-327 (1983); и Jablonski, Anal. Biochem. 148:199 (1985).

Включение метки может осуществляться непрямыми методами, как-то с помощью спейсеров или других членов специфических связывающихся пар. Примером этого является детектирование биотинилированных антител с помощью немеченного стрептавидина и биотинилированного фермента, причем стрептавидин и биотинилированный фермент добавляются либо последовательно, либо одновременно. Так, рассматриваемое антитело можно пометить детектируемой меткой с помощью репортера или непрямым способом с помощью первого члена специфической связывающейся пары. Если антитело конъюгировано с первым членом специфической связывающейся пары, то детектирование осуществляется проведением реакции комплекса антитело-первый член специфической связывающейся пары со вторым членом связывающейся пары, который может быть меченым или не меченым, как указано выше.

Кроме того, немеченое детектирующее антитело можно детектировать проведением реакции немеченого антитела с меченым антителом, специфичным к немеченому антителу. В этом случае термин "помечено детектируемой меткой" означает содержащее эпитоп, по которому может связываться антитело, специфичное к немеченому антителу. Такое анти-антитело может быть помечено прямо или косвенно по любому из подходов, обсуждавшихся выше. Например, анти-антитело можно конъюгировать с биотином, который детектируется при реакции с системой стрептавидин-пероксидаза хрена, как описано выше. Так, в одном воплощении используется биотин. Биотинилированное антитело в свою очередь подвергается реакции с комплексом стрептавидин-пероксидаза хрена. Для детектирования хромогена может использоваться ортофенилендиамин, 4-хлорнафтол, тетраметилбензидин (ТМВ), ABTS, BTS или ASA.

В одном формате иммуноанализа для выполнения рассматриваемого способа применяется прямой сэндвич-метод, в котором захватывающий реагент стандартными методами иммобилизован на поверхности подложки. Подходящими подложками для этого метода являются подложки из синтетических полимеров, как-то полипропилена, полистирена, замещенного полистирена, например, аминированного или карбоксилированного полистирена, полиакриламида, полиамида, поливинилхлорида, стеклянных шариков, агарозы или нитроцеллюлозы.

Субъекты, подходящие для лечения и/или диагностики

Субъектами, подходящими для лечения рассматриваемым способом лечения рака (например, способом уменьшения роста опухолей и/или метастазирования), являются те индивиды, которым поставлен диагноз рака; ИНДИВИДЫ, получавшие лечение от рака по другой схеме лечения, чем рассматриваемая схема лечения, но испытавшие рецидив; и индивиды, которым не помогло лечение от рака по другой схеме лечения, чем данная схема лечения, например, они не реагировали на лечение по другой схеме лечения, чем данная схема лечения.

Субъектами, подходящими для лечения рассматриваемым способом лечения фиброзных заболеваний, являются те индивиды, которым поставлен диагноз фиброзного заболевания; индивиды, получавшие лечение от фиброзного заболевания по другой схеме лечения, чем рассматриваемая схема лечения, но испытавшие рецидив; и индивиды, которым не помогло лечение от фиброзного заболевания по другой схеме лечения, чем данная схема лечения, например, они не реагировали на лечение по другой схеме лечения, чем данная схема лечения.

Субъектами, подходящими для описанных здесь способов диагностики, являются индивиды, которые проходят тестирование на наличие раковых или предраковых клеток; индивиды, получавшие лечение от рака, которые подвергаются мониторингу на наличие раковых или предраковых клеток после лечения, например, для отслеживания эффективности лечения; и индивиды, получавшие лечение от рака, которые испытывают ремиссию от рака и подвергаются мониторингу на наличие раковых или предраковых клеток после ремиссии.

Наборы

В настоящем изложении представлены наборы для осуществления рассматриваемого лечения или выполнения рассматриваемого способа диагностики.

Рассматриваемый набор включает рассматриваемое антитело и может включать еще один или несколько дополнительных реагентов. Антитело в данном наборе может быть гуманизированным. Данный набор может включать реагенты для включения метки в антитело. В некоторых воплощениях антитело в наборе содержит детектируемую метку. В некоторых воплощениях антитело в наборе лиофилизировано.

В некоторых воплощениях антитело в рассматриваемом наборе находится в композиции, включающей: a) антитело; и b) фармацевтически приемлемый эксципиент.В некоторых воплощениях, например, когда набор предназначен для рассматриваемого способа лечения, композиция, содержащая данное антитело, свободна от пвдогенов. Антитело может быть представлено в лиофилизованном состоянии и его нужно растворять в соответствующей жидкости (например, водном растворе типа физраствора, физрастворе с фосфатным буфером или другом забуференном водном растворе) перед употреблением.

Если же набор предназначается для способа диагностики, антитело может быть иммобилизовано на нерастворимой подложке (например, шариках, полосках, лунках многолуночного планшета и т.п.).

Другие необязательные компоненты набора включают: буфер; ингибитор протеаз; детектируемую метку; и др. Различные компоненты набора могут находиться в отдельных контейнерах или же некоторые совместимые компоненты могут быть заранее объединены в одном контейнере, если нужно.

Наряду с вышеуказанными компонентами, рассматриваемый набор может включать инструкции по применению компонентов набора при выполнении рассматриваемого способа. Инструкции по выполнению данного способа обычно записаны на подходящем носителе. Например, инструкции могут быть отпечатаны на субстрате типа бумаги или пластика. При этом инструкции могут находиться в наборе в виде вкладыша, на этикетке контейнера из набора или его компонентов (т.е. связанные с упаковкой или частью упаковки) и т.п. В других воплощениях инструкции находятся в виде электронного файла для хранения данных, находящегося на подходящем компьютерном носителе, например, компакт-диске, предназначенном только для чтения (CD-ROM), цифровом видеодиске (DVD), дискете и т.п. Еще в других воплощениях самих инструкций в наборе нет, а представлено средство для получения инструкций из удаленного источника, например, через Интернет. Примером такого воплощения является набор, который включает web-адрес, по которому можно просматривать инструкции и/или с которого их можно скачать. Как и сами инструкции, такое средство для получения инструкций записано на подходящем субстрате.

Примеры

Следующие примеры приводятся для того, чтобы предоставить рядовым специалистам полное изложение и описание того, как осуществить и использовать данное изобретение, и не должны ограничивать рамки того, что авторы изобретения считают своим изобретением, и не должны означать, что приведенные ниже эксперименты - это все или единственные проведенные эксперименты. Предпринимались все усилия для обеспечения точности в отношении используемых чисел (например, количества, температуры и т.п.), но следует учитывать и некоторые экспериментальные ошибки и отклонения. Если не указано иначе, все доли выражены по весу, молекулярные массы представляют усредненные молекулярные массы, температура - в градусах Цельсия, а давление равно или близко атмосферному. Могут применяться стандартные сокращения, например, п.о. - пара оснований; т.п.о. - тысяча пар оснований; пл - пиколитр; с -секунды; мин - минуты; ч - часы; а.к. - аминокислота; нт - нуклеотид; в/м -внутримышечно; в/б - внутрибрюшинно; п/к - подкожно; и др.

Пример 1. Получение антител к белку LOXL2 человека

В качестве иммуногенов при иммунизации мышей использовали белок LOXL2 человека полной длины (аминокислотная последовательность представлена на фиг.1), подвергшийся процессингу фрагмент LOXL2, полученный при расщеплении in vivo между доменами SRCR2 и SRCR3, и каталитический домен LOXL2. На карбоксильные концы белков добавляли тег His6 для очистки. Подкожную иммунизацию проводили, используя смесь, содержащую 50% LOXL2 полной длины и 50% процессированного LOXL2 в качестве иммуногена (3 мг общего белка) и альгидрогель (А1(ОН)3) в качестве адъюванта (иммунизация ргоВ). Иммунизацию в подушечки лап проводили, используя смесь, содержащую 90% LOXL2 полной длины и 10% процессированного LOXL2 в качестве иммуногена (0,3 мг общего белка) и TiterMax® (TiterMax, Norcross, GA) в качестве адъюванта (иммунизация RPDS-1). При второй иммунизации в подушечки лап использовали каталитический домен LOXL2 (0,3 мг общего белка, аминокислоты 546-774 на фиг.1) в качестве иммуногена и TiterMax® в качестве адъюванта (иммунизация RPDS-2). Сыворотку от мышей с положительным результатом на антитело против LOXL2 по ELISA использовали для создания гибридомных библиотек, из которых получали индивидуальные клоны. Из этих клонов выделяли антитела и подвергали их скринингу на связывание LOXL2 методом ELISA, как описано в примере 2.

Пример 2. Анализ методом ELISA на LOXL2-связывающие антитела Планшеты Nunc Maxisorp™ (Thermo Fisher Scientific, Rochester, NY) покрывали в течение ночи 1 мкг/мл LOXL2 в боратном буфере при 4°С (100 мкл на лунку). На следующий день планшеты промывали три раза PBST (50 мМ фосфата натрия, 140 мМ хлорида натрия, 0,05% твин-20, рН 7,4) и блокировали раствором бычьего сывороточного альбумина (5% BSA в 50 мМ фосфате натрия, 140 мМ хлорида натрия, рН 7,4, 200 мкл на лунку) в течение 1 часа при комнатной температуре. Затем планшеты отмывали три раза по 300 мкл PBST и в блокированные лунки вносили разведения (2-кратные) очищенных антител из гибридомных клонов, описанных в примере 1, в объеме 100 мкл, и инкубировали при комнатной температуре в течение 1 часа. Планшеты отмывали 3 раза по 300 мкл PBST и добавляли 100 мкл разведения 1:10000 конъюгированного с пероксидазой хрена вторичного козьего антитела против мыши (Pierce, Rockford, IL), разведенного в 0,5% растворе BSA (0,5% BSA в 50 мМ фосфате натрия, 140 мМ хлориде натрия, рН 7,4), после чего инкубировали при комнатной температуре в течение 1 часа.

Планшеты отмывали 3 раза по 300 мкл PBST, а затем проявляли при комнатной температуре с помощью 100 мкл 3,3′,5,5′-тетраметилбензидина (ТМВ) до появления голубой окраски (т.е. до оптической плотности, не превышающей 1,0). Затем реакции останавливали добавлением 100 мкл 1М соляной кислоты. Количественную оценку проводили на SpectraMax® M5 (Molecular Devices, Sunnyvale, CA) в режиме поглощения при длине волны 450 нм. Константы диссоциации определяли нанесением на график значений поглощения против концентрации антител и построения кривой по приведенному ниже уравнению (где PL означает поглощение (которое пропорционально концентрации связанных антител), L - концентрация антител (мМ), Bmax - максимальное связывание (нМ) и KD - константа диссоциации (нМ):

[ P L ] = B max × [ L ] K D + [ L ] .

Антитела со значением Kd в 1 нМ или меньше считались ШХЬ2-связывающими антителами. Из трех иммунизации, описанных в примере 1, получили 72 гибридомных клона, экспрессирующих ЬОХЬ2-связывающие антитела. Антителам давали названия, используя префикс, означающий иммунизацию, от которой они были получены (ргоВ, RPDS-1 или RPDS-2), букву М (т.е. "моноклональное") и число. Антитело АВ0023 соответствует proBM64; AB0024 - гуманизированное производное АВ0023. См. совместный US 2009/0053224. Антитело АВООЗО соответствует ргоВМ20. См. совместный US 2009/0053224. Далее антитела характеризировали в отношении их способности к ингибированию энзиматической активности LOXL2, как описано в примере 3.

Некоторые из 72 антител (из иммунизации RPDS-1 и RPDS-2) подвергали повторному скринингу против фрагмента LOXL2, содержащего только каталитический домен (фиг.1, аминокислоты 546-774). Как оказалось, 37 из них связываются в пределах каталитического домена. К ним относятся RPDS-1M1, RPDS-1M3, RPDS-1M8, RPDS-1M9, RPDS-1M11, RPDS-1M15, RPDS-1M17, RPDS-1M19, RPDS-1M20 (АВООЗО), RPDS-1M22, RPDS-1M24, RPDS-1M25. RPDS-1M27, RPDS-1M28, RPDS-1M29, RPDS-1M30, RPDS-1M31, RPDS-1M32, RPDS-2M1, RPDS-2M2, RPDS-2M3, RPDS-2M4, RPDS-2M5, RPDS-2М6, RPDS-2M7, RPDS-2M8, RPDS-2M9, RPDS-2M10, RPDS-2M11, RPDS-2M12, RPDS-2М13, RPDS-2M14, RPDS-2M15, RPDS-2M16, RPDS-2M17, RPDS-2M18 и RPDS-2M19.

Пример 3. Анализ на антитела, ингибирующие энзиматическую активность LOXL2

Все 72 LOXL2-связывающие антитела, идентифицированные в примере 2, далее подвергали скринингу на их способность к ингибированию энзиматической активности LOXL2. Проводили два анализа ингибирования: в одном использовали диаминопентан (DAP) в качестве субстрата, а в другом в качестве субстрата использовали коллаген. В обоих случаях энзиматическую активность LOXL2 измеряли методом, в котором образование перекиси водорода (выделяющейся под действием LOXL2 при дезаминировании субстрата) сопряжено с катализируемым пероксидазой хрена превращением Amplex® Red (Invitrogen, Carlsbad, CA) в резоруфин (флуоресцентный продукт).

При определении с использованием DAP в качестве субстрата субстратная смесь содержала 50 мМ бората рН 8,0, 100 мкМ реагента Amplex® Red, 1×10-4% противопены Antifbam 204 и 30 мМ диаминопентана (DAP). Ферментная смесь содержала 50 мМ бората рН 8,0, 2 ед./мл пероксидазы хрена (HRP; Sigma, St. Louis, МО), 50 нМ LOXL2 и 1×10-4% Antifoam 204. При определении с использованием коллагена в качестве субстрата в субстратной смеси не было DAP и она содержала 1 мг/мл коллагена I типа (BD Biosciences, San Jose, CA), а в ферментной смеси концентрация LOXL2 была увеличена до 100 нМ. Коллаген перед использованием подвергали полимеризации согласно указаниям производителя и держали на льду вплоть до добавления в субстратную смесь.

Ферментативную реакцию запускали добавлением 50 мкл субстратной смеси в 50 мкл ферментной смеси. Определение проводили при 37°С на SpectraMax® M5 (Molecular Devices, Sunnyvale, CA) в кинетическом режиме при длине волны возбуждения в 544 нм и длине волны излучения в 590 нм. Измерения проводили с интервалами в 30 секунд в течение 1 часа при 37°С. Наклон кривой протекания реакции, выраженный в относительных единицах флуоресценции (ОЕФ) в секунду, определяли на линейном участке.

Для тестирования на ингибирование активности LOXL2 LOXL2-связывающими антителами серии разведении каждого из 72 антител, идентифицированных в примере 2, инкубировали с LOXL2 в 50 мкл ферментной смеси при комнатной температуре в течение 1 часа, а затем запускали реакцию добавлением 50 мкл субстратной смеси с DAP, как описано выше. Данные собирали, как описано выше, и наблюдавшиеся скорости реакции, выраженные в ОЕФ/с, наносили на график в зависимости от концентрации антител.

IC50 (концентрацию ингибитора, вызывающую снижение активности на 50% относительно отсутствия ингибитора) определяли путем аппроксимации этих данных по 4 параметрам, как видно из приведенного ниже уравнения, в котором y - наблюдавшаяся скорость реакции (в ОЕФ/с), range - скорость реакции (ОЕФ/с) в отсутствие антител за вычетом фоновой скорости (см. ниже), s - наклон кривой, построенной по значениям скорости реакции против концентрации антител, background (фон) - скорость реакции (ОЕФ/с) в отсутствие фермента и антител, а x - концентрация антител в нМ:

y = R a n g e 1 + ( x I C 50 ) S + b a c k g r o u n d

Как оказалось, ни одно из антител не ингибирует энзиматическую активность полностью. Следовательно, каждое значение IC50 является кажущимся значением IC50 (IC50′) на основе максимального ингибирования, наблюдавшегося с каждым антителом. Любое антитело со значением IC50′ в 500 нМ или меньше в целях настоящего изобретения считалось ингибирующим активность LOXL2.

Антитела сначала тестировали на ингибирующую активность при определении с использованием DAP в качестве субстрата, при этом было выявлено 4 ингибирующих антитела (таблица 2). Остальные антитела тестировали повторно при определении с использованием коллагена в качестве субстрата, как описано выше. При определении с коллагеном в качестве субстрата было идентифицировано еще 4 ингибирующих антитела. В последующих экспериментах четыре антитела, оказавшихся ингибирующими при определении с DAP в качестве субстрата, также оказались ингибирующими при использовании коллагена в качестве субстрата.

По этим критериям восемь из 72 LOXL2-связывающих антител, установленных в примере 2, оказались ингибиторами LOXL2. Названия и кажущиеся значения IC50 для каждого из этих антител приведены в таблице 2.

Дополнительные эксперименты показали, что из всех антител, ингибирующих энзиматическую активность LOXL2, следующие связываются в каталитическом домене:

RPDS-2M2, RPDS-2M4, RPDS-1M19, RPDS-1 M20 (АВООЗО), RPDS-1M27 и RPDS-1M31. Антитела АВ0023 и RPDS1-M21 связываются за пределами каталитического домена.

Таблица 2
Ингибирующие антитела
Антитело IC50′ (нМ) Субстрат
АВ0023 62 DAP, коллаген
RPDS2-M2 90 DAP, коллаген
RPDS-2M4 114 DAP, коллаген
АВ0030 35 коллаген
RPDS-1M19 33 коллаген
RPDS-1М21 32 DAP, коллаген
RPDS-1M27 39 коллаген
RPDS-1M31 210 коллаген

Ингибиторные антитела АВООЗО, RPDS-1M19, RPDS-1M21, RPDS-1M27, RPDS1-М31, RPDS-2M2 и RPDS-2M4 были депонированы по условиям Будапештского договора в Bureau of Microbiology at Health Canada (BMHC, Winnipeg, Manitoba, Canada) 26 марта 2010 г., как показано в таблице 3.

Таблица 3
Депонируемый материал Дата депонирования Номер доступа
RPDS1-M20 (АВООЗО) 26 марта 2010 г. 050210-04
RPDS-1M19 26 марта 2010 г. 050210-02
RPDS-1M21 26 марта 2010 г. 050210-03
RPDS-1M27 26 марта 2010 г. 050210-01
RPDS1-M31 26 марта 2010 г. 260310-01
RPDS-2M2 26 марта 2010 г. 260310-02
RPDS-2M4 26 марта 2010 г. 260310-03

Депонирование проводилось по условиям Будапештского договора о международном признании депонирования микроорганизмов в целях патентной процедуры и его Правилах по Будапештскому договору. Это обеспечивает поддержание жизнеспособности сданных на хранение культур в течение 30 лет со дня депонирования и в течение по меньшей мере пяти (5) лет после получения депозитарием самого последнего запроса на предоставление образца. Депонированные образцы будут предоставляться из ВМНС по условиям Будапештского договора по договоренности между ВМНС и правопреемниками настоящей заявки, что гарантирует, что все ограничения, наложенные депозитором на доступность депонированного материала, будут бесповоротно сняты после получения соответствующего патента США, гарантирует перманентную и неограниченную общедоступность потомства депонированной культуры после выдачи соответствующего патента США или после публичной выкладки любой патентной заявки в США или за границей, смотря что случится раньше, и гарантирует доступность потомства для тех, кто со стороны Комиссара США по патентам и торговым маркам будет уполномочен на это согласно 35 U.S.C. § 122 и в соответствии с правилами Комиссариата (включая 37 C.F.R. § 1.14 и в особенности 886 OG 638).

Правопреемники настоящей заявки согласны, что если культура из депонированных материалов погибнет или потеряется или разрушится при культивировании в соответствующих условиях, то материалы будут срочно заменены, после уведомления, другой такой же культурой. Доступность депонированных материалов не следует воспринимать как разрешение на практическое применение изобретения в нарушение прав, предоставленных полномочным органом правительства в соответствии с его патентным законодательством.

Пример 4. Дальнейший скрининг антител к LOXL2 человека

Антитела, связывающиеся с полноразмерным белком LOXL2, но не с фрагментом, содержащим каталитический домен LOXL2, подвергали дальнейшему изучению, чтобы определить, где за пределами каталитического домена локализованы их эпитопы. Для этого проводили анализ методом ELISA, используя в качестве мишеней полипептиды, соответствующие различным доменам SRCR LOXL2 и их промежуточным линкерным последовательностям. Участки аминокислотной последовательности LOXL2 (которая приведена на фиг.1), содержавшиеся в каждом полипептиде, и названия полипептидов представлены во втором и первом столбцах таблицы 4, соответственно. Аминокислотные последовательности полипептидов представлены на фиг.2.

Для этого анализа планшеты Nunc покрывали 100 мкл раствора в 1 мкг/мл определенного полипептида, используемого в качестве мишени, в 50 мМ борате натрия рН 8 в течение ночи при 4°С. Планшеты отмывали три раза по 300 мкл PBST, затем в каждую лунку добавляли 200 мкл 5% BSA в PBS и инкубировали планшеты при комнатной температуре 1 час с легким покачиванием. Затем планшеты снова отмывали три раза по 300 мкл PBST на лунку, а затем в лунки добавляли антитело (100 мкл в PBST). Антитела определяли как при фиксированной концентрации в 100 нМ, так и в серии разведении из двенадцати точек при 2-кратном разведении от 10 нМ (100 мкл на лунку или разведение). После добавления раствора антител планшеты инкубировали 1 час при комнатной температуре с легким покачиванием. Затем планшеты отмывали три раза по 300 мкл PBST на лунку. Конъюгированное с HRP вторичное козье антитело против мыши (Pierce, Rockford, IL) разводили в 10000 раз в 0,5% BSA в PBS; в каждую лунку добавляли 100 мкл этого раствора и инкубировали планшеты при комнатной температуре в течение 1 часа. Планшеты отмывали три раза по 300 мкл PBST на лунку. Затем планшеты проявляли добавлением 100 мкл ТМВ на лунку, останавливая реакцию после появления умеренной синей окраски (<1 OD) добавлением 100 мкл 1N HCl. Окраску измеряли на SpetcraMax® М5 (Molecular Devices, Sunnyvale, СА), определяя поглощение при 450 нм. Антитело считали связывающимся с полипептидом, если значения поглощения в зависимости от концентрации антитела давали дозо-зависимое возрастание сигнала. Для антител, которые тестировали при единственной концентрации, величина поглощения должна была по меньшей мере на 0,5 единиц OD превышать значение, полученное в ячейке, не содержащей антитела, чтобы это антитело считалось положительным по связыванию. Результаты такого анализа представлены в таблице 4. Одно антитело (RPDS-1M7) проявляло связывание внутри домена SRCR1, но оно оказалось не ингибирующим (см. пример 3). Не было получено ни одного антитела, которое бы связывалось на участке SRCR2. Из семи антител, которые связывались на участке SRCR3 (RPDS-1M2, RPDS-1M4, RPDS-1M5, RPDS-1M10, RPDS-1M13, RPDS-1M18, RPDS1-1M26), ни одно не оказалось ингибирующим (см. пример 3). Одно антитело (RPDS-1-M21) проявляло связывание на отрезке между SRCR3 и SRCR4 ("линкер" SRCR3/4) и оказалось ингибирующим (см. пример 3, таблица 2). Из двух антител (RPDS-1M14, АВ0023), которые связывались на участке SRCR4, одно (АВ0023) оказалось ингибирующим (см. пример 3, таблица 2).

Таблица 4
Фрагмент LOXL2 Аминокислоты Связывающиеся антитела
1-159 RPDS-1M7
58-187 RPDS-1M7
1C 1-187 RPDS-1M7
160-302 нет
188-324 нет
160-324 нет
303-425 нет
3B 325-434 RPDS-1M2, RPDS-1M4, RPDS-1M5, RPDS-1M10, RPDS-1M13, RPDS-1M18, RPDS-1M21, RPDS-1M26
3C 303-434 RPDS-1M2, RPDS-1M4, RPDS-1M5, RPDS-1M10, RPDS-1M13, RPDS-1M18, RPDS-1M21, RPDS-1M26
426-547 RPDS-1M14, RPDS-1M21, АВ0023, АВ0024
435-547 RPDS-1M14, АВ0023, АВ0024

Эти результаты показывают, что ингибирующие антитела могут связываться на отрезке линкера между SRCR3 и SRCR4 (RPDS-1M21) и в домене SRCR4 (АВ0023). Дополнительные эксперименты, изложенные выше, показали, что ингибирующие антитела могут связываться и в каталитическом домене (RPDS-2M2, RPDS-2M4, RPDS-1М19, RPDS-1 M20(AB0030), RPDS-1M27 и RPDS-1M31).

Пример 5. Картирование пептидов

Синтезировали пептиды, соответствующие перекрывающимся участкам из 15 аминокислот SRCR3 и SRCR4 из LOXL2 (Elim Biopharmaceuticals, Hayward, CA), и анализировали их на способность связываться с АВ0023 и его гуманизированным производным АВ0024. Аминокислотные последовательности пептидов приведены в таблице. 5. Лиофилизированные пептиды растворяли до конечной концентрации 10 мМ в PBS+5% ацетонитрила. Маточные растворы антител в 2 мг/мл готовили в PBS (АВ0023) или 10 мМ Na-фосфате, 140 мМ Nad (АВ0024). Вносили 6 мкл раствора пептида в 496 мкл раствора антител и доводили конечный объем до 1 мл (с помощью PBS для АВ0023 или 10 мМ Na-фосфата для АВ0024), получая конечные концентрации в 60 мкМ пептида и 6,6 мкМ антитела, и инкубировали при 25°С в течение 1 часа при комнатной температуре. Затем образцы наносили на колонку Agilent 1100 SEC-HPLC (смола Tosoh TSKgel G3000SWx). Колонки элюировали с помощью PBS+250 мМ Nad, pH 7,4 (АВ0023) или 10 мМ Na-фосфата, 250 мМ NaCl, pH 5,8 (АВ0024) со скоростью 0,5 мл/мин и измеряли площади пиков поглощающего в УФ материала (210 нм). Поскольку молекулярная масса 15-мерных пептидов была небольшой по сравнению с молекулярной массой антител то образование комплекса антитело-пептид не приводило к изменению времени удержания обеих молекул. Следовательно, на образование комплекса антитело-пептид указывало увеличение площади пика, соответствующего свободному антителу, вместе с уменьшением площади пика, соответствующего свободному пептиду. Для интегрирования площади пиков использовали программу ChemStation (Agilent, Palo Alto, CA).

Результаты такого анализа (приведенные в самом правом столбце из таблицы 5)показали, что пептиды 3, 4 и 5 способны связываться с АВ0023. Хотя это и не показано в таблице, но оказалось, что те же самые три пептида связываются с АВ0024. Эти пептиды составляют функциональный эпитоп из 39 аминокислот в пределах домена SRCR4 LOXL2, имеющий следующую аминокислотную последовательность: VWGMVCGQNWGIVEAMWCRQLGLGFASNAFQETWYWHG (SEQ ID NO:3).

Таблица 5
Картирование пептидов
Пептид Последовательность SEQ ID NO Связывание с АВ0023
1 LRLNGGRNPYEGRVE 25 -
2 RVEVLVERNGSLVWG 26 -
3 VWGMVCGQNWGIVEA 27 +
4 VEAMVVCRQLGLGFA 28 +
5 GFASNAFQETWYWHG 29 +
6 WHGDVNSNKVVMSGV 30 -
7 SGVKCSGTELSLAHC 31 -
8 AHCRHDGEDVACPQG 32 -
9 PQGGVQYGAGVACSE 33 -
10 CSETAPDLVLNAEMV 34 -

Примечание. Аминокислотные последовательности пептидов (в однобуквенных обозначениях) приведены во втором столбце. В четвертом столбце "+" означает то, что пептид связывался с АВ0023, а "-" означает, что связывания не наблюдалось.

Пример 6. Сканирующий аланином мутагенез

Проводили сканирующий аланином мутагенез домена SRCR4 LOXL2 для идентификации аминокислотных остатков в домене SRCR4 LOXL2, участвующих в связывании антител АВ0023, АВ0024 и М14. Для этого конструировали фрагмент ДНК, содержащий последовательности, кодирующие домен SRCR4 LOXL2 (аминокислоты 435-547 в SEQ ID NO:1); добавляли сигнальную последовательность, последовательности линкеров, эпитопную метку туе и тег (His)6 для очистки и клонировали всю конструкцию. Дополнительные конструкции создавали таким образом, чтобы определенные аминокислоты в домене SRCR4 превращались в аланин. Способность АВ0023, АВ0024 и М14 к связыванию с последовательностями аминокислот различных мутантов определяли методами ELISA, поверхностного плазменного резонанса (SPR) и SEC-HPLC для АВ0023 и АВ0024; и методом ELISA для М14. Анализ методом ELISA проводили в точности так, как описано в примере 2, используя различные сканирующие аланиновые мутации в качестве мишеней. При анализе методом SPR определяли связывание антител с конструкциями сканирующих аланиновых мутантов LOXL2 SRCR4 на приборе ProteOn XPR36 (Bio-Rad, Hercules, CA). Белки иммобилизировали на сенсорном чипе GLC. Сенсорный чип GLC активировали смесью из 1-этил-3-[3-диметиламинопропил]карбодиимида гидрохлорида (EDC) и N-гидроксисульфосукцинимида (Sulfo-NHS) в отношении 1:1, приготовленной согласно инструкциям производителя, которую пропускали через чип со скоростью 30 мкл/мин в течение 300 секунд. Затем через чип пропускали раствор белков в 1 мкг/мл в ацетатном буфере рН 4,5 со скоростью 30 мкл/мин в течение 300 секунд, после чего непрореагировавшие сайты на чипе блокировали пропусканием через него 1М этаноламина со скоростью 30 мкл/мин в течение 300 секунд. Создавали контрольный канал по той же методике пропусканием ацетатного буфера по поверхности. Разведения очищенных антител пропускали по поверхности со скоростью 100 мкл/мин в течение 150 секунд и туда же включали контрольный буфер. Сенсограммы анализировали с помощью программы ProteOn Manager и данные подставляли во встроенную в программу модель Langmuir. Данные представляют среднее значение и стандартное отклонение из четырехотдельных экспериментов.

SEC-HPLC проводили как описано в примере 5, используя различные сканирующие аланиновые мутации SRCR4 вместо 15-мерных пептидов.

Результаты, полученные этими тремя разными способами, соответствовали друг другу, поэтому в таблице 6 представлены сводные данные.

Таблица 6
Сканирующий мутагенез на аланин
Мутация Связывание АВ0023 Связывание АВ0024 Связывание М14
N438A + + +
G440A + + н/о
N442A + + н/о
Y444A + + +
V450A + + н/о
R454A + + н/о
G456A + + н/о
L458A + + +
W460A + + н/о
G465A + + н/о
N467A + + н/о
G469A + + н/о
V471A + + н/о
М474А + + н/о
V476A +/- +/- н/о
R478A 0 0 +
F484A 0 0 н/о
Мутация Связывание АВ0023 Связывание АВ0024 Связывание М14
S486A + + н/о
N487A + + +
F489A + + н/о
Q490A + + 4-
Е491А + + н/о
Т492А + + н/о
W493A + + н/о
Y494A + + +
W495A + + н/о
Н496А + + н/о
G497A + + н/о
К510А + + +
S512A + + +

Примечание. Цифры в первом столбце относятся к аминокислотным остаткам в аминокислотной последовательности LOXL2, представленной на фиг.1. Буква, стоящая перед цифрой, обозначает аминокислоту, находящуюся в этом положении (в однобуквенном обозначении) у белка дикого типа. Буква, стоящая после цифры, обозначает превращение остатка дикого типа в аланин у этого конкретного мутанта. Остальные столбцы показывают, что данный мутантный полипептид связывается с АВ0023 (второй столбец), АВ0024 (третий столбец) или М14 (четвертый столбец). М14 означает антитело RPDS-1M14. "+" означает связывание, "+/-" означает слабое связывание, "О" означает, что связывание не обнаруживается, а "н/о" означает "не определяли".

Пример 7. АВ0023 специфически связывается с LOXL2

Лизилоксидазоподобные белки LOXL3 и LOXL4 тоже содержат четыре домена SRCR, которые обладают некоторой гомологией с четырьмя доменами SRCR LOXL2, но не идентичны им. Чтобы оценить его специфичность и получить дополнительную информацию о природе его эпитопа, тестировали связывание антитела АВ0023 с последовательностями SRCR LOXL3 и LOXL4. Анализ методом ELISA проводили в точности так, как описано в примере 2, используя в качестве мишеней LOX, LOXL1, LOXL2, LOXL3 и LOXL4 человека. Представленные на фиг.3 результаты свидетельствуют, что АВ0023 не связывается ни с одним из других известных лизилоксидазных ферментов человека. Таким образом, антитело АВ0023 специфично к LOXL2 по сравнению с другими лизилоксидазными ферментами, в частности, АВ0023 не связывается с доменами SRCR4 ни LOXL3, ни LOXL4.

Выравнивание аминокислотных последовательностей доменов SCRC4 из LOXL2, LOXL3 и LOXL4 представлено на фиг.4. Различия в аминокислотной последовательности между доменом SRCR4 LOXL2 и доменами SRCR4 LOXL3 и LOXL4 можно использовать для дальнейшего определения эпитопа, распознаваемого АВ0023.

Пример 8. М14 связывается с другим эпитопом, чем тот, с которым связываются АВ0023 и АВ0024Из вышеприведенной таблицы 6 видно, что превращение аминокислоты 478 в домене SRCR4 LOXL2 из аргинина в аланин устраняет его способность к связыванию с антителами АВ0023 и АВ0024, но не влияет на его способность к связыванию с антителом М14. Это свидетельствует о том, что М14 распознает эпитоп, который отличается от того, что распознают АВ0023 и АВ0024. В отдельных экспериментах методом поверхностного плазменного резонанса, как описано в примере 6, было установлено, что мутант F484A, который тоже не связывается АВ0023, связывается с антителом М14. Таким образом, антитело М14 определяет второй эпитоп в домене SRCR4, отличный от того, который распознают АВ0023 и АВ0024.

Пример 9. Эпитоп АВООЗО в каталитическом домене

Антитело АВ0030 связывается в каталитическом домене LOXL2 человека и ингибирует его энзиматическую активность. Сравнение методом ELISA связывания АВ0030 с белками LOXL2 человека, макаки Cynomolgus, крысы и мыши показало, что АВ0023 также связывается с LOXL2 макаки, но не с LOXL2 крысы или мыши. При сравнении аминокислотных последовательностей каталитических доменов LOXL2 человека и макаки, с одной стороны, и LOXL2 крысы и мыши, с другой стороны, оказалось, что у них отличаются 21 остатков последовательности. См. фиг.5. В связи с этим методами ELISA и SPR те варианты белка крысы, в которых каждая из этих аминокислот была индивидуально изменена так, чтобы она соответствовала последовательности человека, анализировали на способность к связыванию с АВ0030.

Результаты такого анализа показали, что изменения в двух положениях придают белку LOXL2 крысы способность к связыванию АВООЗО (отмечены звездочками на фиг.5). Эти изменения состоят в превращении остатка Н595 мыши в Y (соответствует Y593 у человека) и превращении остатка Y741 мыши в Н (соответствует Н739 у человека). Соответственно, эти два остатка входят в состав эпитопа, с которым связывается АВ0030.

Хотя настоящее изобретение и было описано на примере его конкретных воплощений, специалистам в данной области должно быть ясно, что в нем можно производить различные изменения и делать эквивалентные замены, не отходя от истинной сути и не выходя за рамки изобретения. Кроме того, можно делать многие модификации для адаптации конкретной ситуации, материала, композиции, процесса или его стадий к цели, сущности и рамкам настоящего изобретения. Все такие модификации должны находиться в рамках прилагаемой формулы изобретения.

Список последовательностей приведен в конце описания.

1. Выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент, которые специфически связываются с эпитопом в пределах аминокислот 325-434 из последовательности, приведенной в SEQ ID NO: 1, где моноклональное анти-LOXL2 антитело или фрагмент не конкурируют за связывание с антителом АВ0023 или АВ0024 и где моноклональное анти-LOXL2 антитело или фрагмент ингибирует энзиматическую активность полипептида LOXL2.

2. Выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент по п.1, где эпитоп включает аминокислоты в пределах последовательности SEQ ID NO: 2.

3. Выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент по п.1, где антитело или фрагмент связывается с эпитопом со сродством от примерно 109 М-1 до примерно 1012 М-1.

4. Выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент по п.1, где моноклональное анти-LOXL2 антитело или фрагмент содержит тяжелую цепь, причем тяжелая цепь моноклонального анти-LOXL2 антитела принадлежит к изотипу IgG1, IgG2, IgG3 или IgG4.

5. Выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент по п.1, где антитело или фрагмент представляет собой Fv, scFv, Fab, F(ab′)2 или Fab′.

6. Выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент по п.1, где моноклональное анти-LOXL2 антитело или фрагмент является гуманизированным.

7. Выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент по п.1, где антитело или фрагмент является химерным.

8. Конъюгат, который связывается с LOXL2, содержащий выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент, которые ковалентно связаны с молекулой, выбранной из группы, состоящей из непептидных синтетических полимеров, липидов, жирных кислот, полисахаридов, углеводов или контрастных средств,
где часть конъюгата, представленная моноклональным анти-LOXL2 антителом или его антиген-связывающим фрагментом
- специфически связывается с эпитопом в пределах аминокислот 325-434 из последовательности, приведенной в SEQ ID NO: 1,
- не конкурирует за связывание с антителом АВ0023 или АВ0024,
- ингибирует энзиматическую активность полипептида LOXL2.

9. Конъюгат, который связывается с LOXL2, содержащий выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент, которые специфически связываются с эпитопом в пределах аминокислот 325-434 из последовательности, приведенной в SEQ ID NO: 1, где антитело не конкурирует за связывание с антителом АВ0023 или АВ0024, где моноклональное анти-LOXL2 антитело или фрагмент ингибирует энзиматическую активность полипептида LOXL2 и где антитело или фрагмент ковалентно или нековалентно связаны с противораковым химиотерапевтическим средством.

10. Конъюгат, который связывается с LOXL2, содержащий выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент, которые специфически связываются с эпитопом в пределах аминокислот 325-434 из последовательности, приведенной в SEQ ID NO: 1, где антитело не конкурирует за связывание с антителом АВ0023 или АВ0024, где моноклональное анти-LOXL2 антитело или фрагмент ингибирует энзиматическую активность полипептида LOXL2 и где моноклональное анти-LOXL2 антитело или фрагмент помечены детектируемой меткой.

11. Фармацевтическая композиция для лечения заболевания, связанного с ангиогенезом, фиброза, опухоли или метастазов, включающая:
выделенное моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент по п.1 в эффективном количестве; и
фармацевтически приемлемый носитель или эксципиент.

12. Композиция по п.11, в которой моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент находится в количестве, эффективном для лечения заболеваний, связанных с LOXL2, а заболевание представляет собой LOXL2 экспрессирующую опухоль, метастазы, заболевание, связанное с ангиогенезом или фиброз.

13. Композиция по п.11, в которой моноклональное анти-LOXL2 антитело или его антиген-связывающий фрагмент соединен с детектируемой меткой, терапевтическим средством или и тем и другим.

14. Способ определения наличия и/или уровней LOXL2 в биологическом образце, включающий:
определение уровня LOXL2 в образце от субъекта путем контактирования данного образца с выделенным моноклональным анти-LOXL2 антителом или его антиген-связывающим фрагментом по любому из пп.1-7 или конъюгатом по любому из пп.8-10,
где определение отличия в уровне LOXL2 в образце по сравнению с контрольным образцом указывает на наличие у субъекта заболевания, связанного с LOXL2.

15. Способ по п.14, в котором заболевание, связанное с LOXL2, представляет собой опухоль, метастазы, заболевание, связанное с ангиогенезом, или фиброз.

16. Способ по п.15, в котором повышение уровня LOXL2 в образце от субъекта по сравнению с контрольным образцом указывает на наличие опухоли или ее метастазов либо увеличение опухоли или рост метастазов.

17. Способ по п.14, в котором контрольный образец взят у субъекта в более раннее время, чем образец от субъекта, или из непораженной ткани того же типа, что и образец от субъекта, либо это образец от другого индивида.

18. Способ по п.14, в котором антитело помечено детектируемой меткой.

19. Способ ингибирования активности LOXL2, который включает контактирование образца или клеточной ткани с эффективным количеством выделенного моноклонального анти-LOXL2 антитела или его антиген-связывающего фрагмента по п.1.

20. Способ по п.19, в котором контактирование проводится in vitro или ex vivo.

21. Способ по п.19, в котором контактирование проводится in vivo.

22. Способ по п.19, в котором контактирование ослабляет заболевание у субъекта, выбранное из группы, состоящей из опухолевого роста, заболевания, связанного с ангиогенезом, и фиброза.

23. Способ ослабления роста экспрессирующей LOXL2 опухоли у субъекта, нуждающегося в этом, включающий введение субъекту эффективного количества моноклонального анти-LOXL2 антитела или его антиген-связывающего фрагмента по п.1.

24. Способ по п.23, в котором экспрессирующая LOXL2 опухоль представляет собой первичную опухоль или метастазирующую опухоль.

25. Способ по п.23, в котором экспрессирующая LOXL2 опухоль представляет собой твердую опухоль.

26. Способ подавления ангиогенеза у субъекта, нуждающегося в этом, включающий введение субъекту эффективного количества моноклонального анти-LOXL2 антитела или его антиген-связывающего фрагмента по п.1.

27. Способ подавления фиброзного заболевания у субъекта, нуждающегося в этом, включающий введение субъекту эффективного количества моноклонального анти-LOXL2 антитела или его антиген-связывающего фрагмента по п.1.

28. Способ мониторинга реакции субъекта на терапию против LOXL2, который включает определение уровня и/или активности LOXL2 у субъекта с помощью моноклонального анти-LOXL2 антитела или его антиген-связывающего фрагмента по любому из пп.1-7 или конъюгатом по любому из пп.8-10.



 

Похожие патенты:

Группа изобретений относится к медицине, а именно диагностике глютен-чувствительной энтеропатии у генетически предрасположенных пациентов, и может быть использована для уточнения диагноза аутоиммунного заболевания.

Группа изобретений относится к медицинской иммунологии, а именно к способам определения функциональной активности компонентов комплемента в сыворотке крови человека при диагностике ряда заболеваний и в биологических препаратах.

Изобретение относится к медицине и описывает способ идентификации модуляторов активности фермента катехол-O-метилтрансферазы (СОМТ), включающий а) получение 4-нитрокатехола, ковалентно связанного с Alexa Fluor® 488, б) приведение в контакт молекулы из этапа а) с ферментом катехол-O-метилтрансферазой (COMT), S-аденозилметионином (SAM) и соединением-кандидатом и в) измерение показателей флуоресценции смеси из этапа б), в котором измененные показатели флуоресценции в присутствии соединения-кандидата по сравнению с контролем являются признаком наличия модулятора фермента катехол-O-метилтрансферазы (COMT).
Изобретение относится к медицине, а именно к педиатрии, инфектологии и гепатологии, и может быть использовано для дифференциальной диагностики стадий хронизации вирусного гепатита С у подростков.
Изобретение относится к области медицины и предназначено для прогнозирования неблагоприятного исхода гипертрофической кардиомиопатии. Методом твердофазного иммуноферментного анализа (ИФА) в крови пациента определяют величины тканевого ингибитора металлопротеиназы 1 (TIMP 1) и терминального фрагмента мозгового натрийуретического пептида (NT pro BNP).

Группа изобретений относится к области медицинской диагностики, иммунологии и онкологии, в частности к новым онкомаркерам и способам диагностики онкологических заболеваний.

Изобретение относится к области биохимии и предназначено для определения IgG-протеиназной активности. В лунках полистиролового планшета сорбируют полимерные матрицы небелковой природы - ДНК, хитин, затем в лунки добавляют специфические к этой матрице IgG и раствор, содержащий протеолитические ферменты.

Изобретение относится к области биотехнологии и представляет собой способ определения неспецифической устойчивости патогенных микроорганизмов к антибиотикам и факта присутствия бактериальных биопленок на основании измерения каталитической активности фосфодиэстераз, расщепляющих циклический дигуанозинмонофосфат, с пороговой чувствительностью 50 пг/мл, включающий: 1) выделение фосфодиэстеразы-мишени из лизированных бактериальных клеток; 2) связывание фосфодиэстеразы биотинилированными антителами, специфичными к некаталитическим доменам фосфодиэстеразы; 3) аффинную очистку комплексов, сформированных фосфодиэстеразой-мишенью и биотинилированным антителом при помощи парамагнитных частиц, содержащих нейтравидин или его аналоги, связывающие биотин; 4) взаимодействие комплексов фосфодиэстераза/биотинилированное антитело, иммобилизованных на парамагнитных частицах, с комплексами, содержащими с-di-GMP в форме G-квадруплексов с интеркалированным красителем, сопровождающееся падением интенсивности флуоресценции по мере разрушения комплексов интеркалирующего красителя c-di-GMP; 5) измерение падения флуоресценции при гидролизе c-di-GMP и разрушении комплекса c-di-GMP с интеркалирующим красителем с последующим количественным определением активности фосфодиэстеразы на основании калибровочных кривых, построенных с использованием известных количеств рекомбинантного фермента фосфодиэстеразы, идентичного исследуемой мишени; 6) выявление повышенного уровня фосфодиэстеразной активности, обнаруживаемого тестируемыми антибиотикоустойчивыми бактериальными штаммами, способными к формированию биопленок, по сравнению с уровнем фосфодиэстеразной активности, обнаруживаемым для контрольных штаммов бактерий того же вида, не обладающих антибиотикоустойчивостью и способностью к формированию биопленок.

Группа изобретений относится к медицине, фармакологии, к способам и композициям ингибиторов фосфатазы PTEN для созревания овариальных фолликулов и ооцитов in vitro. Использование ингибиторов фосфатазы PTEN, таких как комплексы оксованадата и пероксованадата: биспероксо (бипиридин) оксованадат, биспероксо (1,10-фенантролин) оксованадат, биспероксо (пиколинато) оксованадат, биспероксо (5-гидроксипиридин-2-карбоксил) оксованадат, ди-(пиколинат) оксованадат, ди-(3-гидроксипиколинат) оксованадат, биспероксо (фенилбигуанид) оксованадат, ди-(фенилбигуанид) оксованадат и биспероксо (изохинолинкарбоновой кислоты) оксованадат, обеспечивает созревание и/или активацию in vitro ооцитов и фолликулов, таких как примордиальные, промежуточные и первичные фолликулы.
Изобретение относится к химическим композициям реагентов. .

Группа изобретений относится к медицине, а именно диагностике глютен-чувствительной энтеропатии у генетически предрасположенных пациентов, и может быть использована для уточнения диагноза аутоиммунного заболевания.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложены: изолированное антитело или его вариант, специфически распознающие PCSK9, и фармацевтическая композиция для снижения уровня холестерина-LDL на их основе.

Настоящее изобретение относится к области иммунологии и медицины. Предложен способ профилактики или лечения состояния глаза, связанного с высокой экспрессией или активностью фактора комплемента D, включающий введение субъекту антитела или его антигенсвязывающего фрагмента.

Настоящее изобретение относится к соединению, имеющему общую формулу (I): где m и n являются независимо целыми числами от 1 до 6; каждый из X1-X3 и Y1-Y3 является О; R1-R3 каждый независимо выбирают из группы, состоящей из водорода или алкила; и R является O-(CH2)x-C(=O)NR'-(CH2)y-NHR', причем: x и y каждый являются независимо целыми числами от 1 до 6; и R' выбирают из группы, состоящей из водорода и алкила.

В изобретении раскрыты способы лечения нарушения, регулируемого ангиогенезом, предусматривающие введение субъекту эффективного количества антитела, которое связывается с человеческим белком бета-тирозин фосфатазой (HPTPβ).

Изобретение относится к области биотехнологии, конкретно к способам ингибирования последствий MASP-2-зависимой активации комплемента, и может быть использовано в медицине.

Изобретение относится к области иммунологии. .

Изобретение относится к биотехнологии и представляет собой антитело, которое связывается с активатором фактора роста гепатоцитов человека (HGFA). .

Изобретение относится к области биотехнологии и может быть использовано в пищевой промышленности. .
Изобретение относится к медицине, а именно к онкологии, и может быть использовано для лечения больных с метастатическим поражением головного мозга. Проводят операцию и через 3 недели после операции проводят тотальное облучение головного мозга разовой очаговой дозой 2,4 Гр.
Наверх