Конъюгаты аматоксина с улучшенными связями

Изобретение относится к конъюгатам аматоксина и мишень-связывающего фрагмента, например антитела, соединенных связями определенного типа, которые применимы в лечении рака, и к фармацевтическим композициям, включающим такие конъюгаты. 5 н. и 20 з.п. ф-лы, 2 ил., 3 пр.

 

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Настоящее изобретение относится к лечению опухолей. В одном аспекте настоящее изобретение относится к конъюгатам аматоксина и мишень-связывающего фрагмента, например, антитела, соединенных связями определенного типа, которые используются при лечении рака. В другом аспекте, изобретение относится к фармацевтическим композициям, включающим такие конъюгаты.

ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ

Аматоксины представляют собой циклические пептиды, состоящие из 8 аминокислот. Их можно выделить из грибов Amanita phalloides или получить синтетически. Аматоксины специфично ингибируют ДНК-зависимую РНК полимеразу II в клетках млекопитающих и за счет этого также подавляют транскрипцию и биосинтез белков в пораженных клетках. Ингибирование транскрипции в клетках вызывает остановку их роста и пролиферации. Несмотря на отсутствие ковалентного связывания, комплекс аманатина и РНК-полимеразы II является очень прочным (KD=3 нм). Разрушение комплекса аманатина и фермента является очень медленным процессом, что делает маловероятным восстановление пораженной клетки. Если ингибирование транскрипции будет продолжаться слишком долго, клетка подвергнется запрограммированной клеточной смерти (апоптозу).

Применение аматоксинов в качестве цитотоксичных частиц для лечения опухолей исследуется с 1981 года, причем осуществляли сшивание антитела анти-Thy 1.2 с α-аманитином с использованием линкера, прикрепленного к индольному циклу Trp (аминокислоты 4, см. фиг.1), путем диазотирования (Davis & Preston, Science 1981, 213, 1385-1388). Davis и Preston определили, что точкой присоединения линкера является положение 7'. Morris и Venton также продемонстрировали, что замещение по положению 7' приводит к образованию производного, которое сохраняет цитотоксическую активность (Morris & Venton, Int. J.Peptide Protein Res. 1983, 21 419-430).

В заявке на патент EP 1859811 A1 (опубликована 28 ноября 2007) описаны конъюгаты, в которых γ C-атом аминокислоты 1 аматоксина в β-аманитине непосредственно, т.е. без линкерной структуры, связан с альбумином или с моноклональным антителом HEA125, OKT3 или PA-1. Кроме того, было показано ингибирующее действие этих конъюгатов на пролиферацию клеток рака груди (MCF-7), клеток лимфомы Беркитта (Raji) и клеток T-лимфомы (Jurkat). В рассматриваемой заявке предполагалось применение линкеров, в т.ч. линкеров, включающих такие элементы, как амид, сложный эфир, простой эфир, тиоэфир, дисульфид, мочевину, тиомочевину, углеводородные фрагменты и т.п., но указанные структуры не показаны фактически, и не приведены другие подробности, например, точки присоединения к молекулам аматоксинов.

В заявках на патент WO 2010/115629 и WO 2010/115630 (обе опубликованы 14 Октября 2010) описаны конъюгаты, в которых антитела, такие как антитела против EpCAM, например, гуманизированное антитело huHEA125, соединены с аматоксинами через (i) γ C-атом аминокислоты 1 аматоксина, (ii) 6' C-атом аминокислоты 4 аматоксина или (iii) через δ C-атом аминокислоты 3 аматоксина, в каждом случае либо непосредственно, либо через линкер между антителом и аматоксинами. Предложенные линкеры включают такие элементы, как амид, сложный эфир, простой эфир, тиоэфир, дисульфид, мочевину, тиомочевину, углеводородные фрагменты и т.п. Кроме того, было продемонстрировано ингибирующее действие этих конъюгатов на пролиферацию клеток рака груди (линия клеток MCF-7), рака поджелудочной железы (линия клеток Capan-1), рака ободочной кишки (линия клеток Colo205) и холангиокарциномы (линия клеток OZ).

Известно, что аматоксины являются относительно нетоксичными, если они связаны с макромолекулярными носителями, например, молекулами антител, и их цитотоксическое действие начинает проявляться только после отщепления биомолекулярного носителя. Вследствие токсичности аматоксинов, особенно в отношении клеток печени, исключительно важно, чтобы конъюгаты аматоксина для нацеленного лечения опухолей сохраняли высокую стабильность после введения в плазму, и чтобы высвобождение аматоксина имело место после интернализации в целевые клетки. В связи с этим, незначительные улучшения стабильности конъюгата могут иметь сильное влияние на терапевтическое окно и безопасность конъюгатов аматоксина для терапевтических применений.

ЦЕЛЬ ИЗОБРЕТЕНИЯ

Таким образом, в предшествующем уровне техники существовала сильная потребность в конъюгатах аматоксина, включающих мишень-связывающие фрагменты, которые являются устойчивыми в плазме, с тем, чтобы предельно уменьшить вредные побочные воздействия на нецелевые клетки.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение основано на неожиданном обнаружении того, что нацеливающие фрагменты можно присоединить к аматоксинам через линкеры связанные с другими положениями на аминокислоте 4, т.е. триптофане, а именно с положением 1'-N, без отрицательного влияния на взаимодействие этих аматоксинов с их мишенью, т.е. ДНК-зависимой РНК полимеразой II клеток млекопитающих.

Таким образом, настоящее изобретение относится к конъюгату включающему мишень-связывающий фрагмент, соединенный линкером L с аматоксином или аналогом аматоксина, где этот линкер L соединен с аматоксином через атом 1'-N аминокислоты 4.

В одном из аспектов, настоящее изобретение относится к конъюгату аматоксина формулы (I):

где:

R1 означает H или OH;

R2 означает H или OH;

R3 означает NH2 или OH;

R4 означает OH или OC1-6 алкил; и

R5 означает L-T, где L означает линкер; и T означает мишень-связывающий фрагмент.

В другом аспекте, настоящее изобретение относится к фармацевтической композиции, включающей конъюгат по настоящему изобретению.

В следующем аспекте, настоящее изобретение относится к молекуле конъюгации с аматоксином формулы (I), в которой группы R1-R4 соответствуют данному выше определению; и где R5=L-X, где L означает линкер; и X означает уходящую группу, которая может быть замещена нуклеофильной группой мишень-связывающего фрагмента, в частности, первичной аминогруппой.

В еще одном аспекте, настоящее изобретение относится к способу синтеза конъюгата по настоящему изобретению, включающему стадию взаимодействия молекулы конъюгации с аматоксином по настоящему изобретению с мишень-связывающим фрагментом, включающим нуклеофильную группу, в частности первичную аминогруппу.

КРАТКОЕ ОПИСАНИЕ ИЛЛЮСТРАТИВНОГО МАТЕРИАЛА

На Фиг.1 показаны структурные формулы различных аматоксинов. Цифры, показанные жирным шрифтом (от 1 до 8) показывают стандартную нумерацию восьми аминокислотных остатков, образующих молекулу аматоксина. Кроме того, показаны стандартные обозначения атомов в аминокислотах 1, 3 и 4 (греческие буквы от α до γ, греческие буквы от α до δ, и числа от 1' до 7', соответственно).

На Фиг.2 показана цитотоксическая активность конъюгата Her-DSC-30.0378 [2.8] против клеток HER-2-положительных линий in vitro в анализе BrdU после инкубирования в течение 72 ч.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Перед ознакомлением с приведенным ниже подробным описанием изобретения, следует понимать, что настоящее изобретение не ограничено конкретной методологией, протоколами и реагентами, описанными в настоящей заявке, поскольку они могут меняться. Кроме того, следует понимать, что использованная в описании терминология служит только для описания конкретных вариантов осуществления, и она не предназначена для ограничения объема настоящего изобретения, который должен определяться только приложенной формулой изобретения. Если не приведено иного определения, все технические и научные термины, используемые в описании, имеют те же значения, которые обычно понимает под ними рядовой специалист в данной области техники.

Используемые в заявке термины предпочтительно определяются в соответствии с описаниями, данными в “A multilingual glossary of biotechnological terms: (IUPAC Recommendations)”, Leuenberger, H.G.W, Nagel, B. and Kölbl, H. eds. (1995), Helvetica Chimica Acta, CH-4010 Basel, Switzerland).

В тексте настоящей заявке и следующей за ним формулы изобретения, если контекст не требует иного толкования, следует понимать, что слово «включать» и его формы, такие как «включает» и «включающий», подразумевают включение указанного целого числа или стадии, или группы чисел или стадий, но не исключают любых других чисел или стадий, или групп чисел или стадий.

В тексте настоящего описания упоминается ряд документов. Каждый из документов, упомянутых выше или ниже по тексту описания (включая все патенты, заявки на патенты, научные публикации, спецификации и инструкции производителей, инвентарные номера GenBank, представление последовательностей и т.д.), включен в настоящее описание посредством ссылки в полном объеме, в той степени, которая возможна согласно соответствующему патентному законодательству. Ничто в тексте настоящего описания не следует истолковывать, как признание, что это изобретение не дает права датировать такое изобретение задним числом на основании предыдущего изобретения.

Далее по тексту приведено более подробное описание настоящего изобретения. В следующих ниже фрагментах текста более детально раскрыты различные аспекты настоящего изобретения. Каждый из раскрытых аспектов можно скомбинировать с любым другим аспектом или аспектами, если в явном виде не указано противоположное. В частности, любой элемент изобретения, который охарактеризован, как предпочтительный или преимущественный, может быть скомбинирован с любым другим элементом или элементами, которые указаны, как предпочтительные или преимущественные.

Таким образом, настоящее изобретение относится к конъюгату, включающему мишень-связывающий фрагмент, соединенный с помощью линкера L с аматоксином или аналогом аматоксина, где линкер L соединен с аматоксином через 1'-N атом аминокислоты 4.

В контексте настоящего изобретения термин «конъюгат» относится к молекуле, включающей как минимум две различных молекулы, соединенных ковалентной связью.

Термин «мишень-связывающий фрагмент» в настоящем описании относится к любой молекуле или части молекулы, которая способна специфично связываться с целевой молекулой или целевым эпитопом. Предпочтительными мишень-связывающими фрагментами в контексте настоящей заявки являются (i) антитела или их антиген-связывающие фрагменты; (ii) белки, подобные антителам (антитело-подобные белки); и (iii) аптамеры нуклеиновых кислот. «Мишень-связывающие фрагменты», подходящие для применения в настоящем изобретении, как правило, имеют молекулярную массу, равную 40000 Дальтон (40 КДа) или более.

В настоящем описании, считается, что первое соединение (например, антитело) «специфично связывается» со вторым соединением (например, антигеном, таким как целевой белок), если константа диссоциации KD комплекса с указанным вторым соединением составляет 100 мкМ или менее, предпочтительно, 50 мкМ или менее, предпочтительно, 30 мкМ или менее, предпочтительно, 20 мкМ или менее, предпочтительно, 10 мкМ или менее, предпочтительно 5 мкМ или менее, более предпочтительно, 1 мкМ или менее, более предпочтительно 900 нМ или менее, более предпочтительно, 800 нМ или менее, более предпочтительно 700 нМ или менее, более предпочтительно, 600 нМ или менее, более предпочтительно 500 нМ или менее, более предпочтительно 400 нМ или менее, более предпочтительно 300 нМ или менее, более предпочтительно 200 нМ или менее, еще более предпочтительно 100 нМ или менее, еще более предпочтительно 90 нМ или менее, еще более предпочтительно 80 нМ или менее, еще более предпочтительно 70 нМ или менее, еще более предпочтительно 60 нМ или менее, еще более предпочтительно 50 нМ или менее, еще более предпочтительно 40 нМ или менее, еще более предпочтительно 30 нМ или менее, еще более предпочтительно 20 нМ или менее и еще более предпочтительно 10 нМ или менее.

В контексте настоящей заявки, термины «целевая молекула» и «целевой эпитоп» соответственно относятся к антигену и эпитопу антигена, которые специфично связываются с мишень-связывающим фрагментом. Предпочтительно, целевая молекула представляет собой антиген, имеющий отношение к опухоли, в частности, антиген или эпитоп, который присутствует на поверхности одного или нескольких типов опухолевых клеток в повышенной концентрации и/или в другой пространственной конфигурации по сравнению с поверхностью не опухолевых клеток. Предпочтительно, указанный антиген или эпитоп присутствует на поверхности одного или нескольких типов опухолевых клеток, но не на поверхности не опухолевых клеток. В конкретных вариантах осуществления, мишень-связывающий фрагмент специфично связывается с эпитопом HER-2/neu или молекулой адгезии эпителиальных клеток (EpCAM). В других вариантах осуществления, указанный антиген или эпитоп преимущественно экспрессируются на клетках, вовлеченных в аутоиммунные заболевания. В конкретных примерах таких вариантов осуществления, мишень-связывающий фрагмент специфично связывается с эпитопом рецептора IL-6 (IL-6R).

Термин «антитело или его антиген-связывающий фрагмент» в настоящем описании относится к молекулам иммуноглобулина и иммунологически активным фрагментам молекул иммуноглобулина, т.е. молекулам, которые содержат антиген-связывающий сайт, который иммуноспецифично связывается с антигеном. Кроме того, этот термин охватывает иммуноглобулин-подобные белки, которые отобраны с помощью методик, включающих, например, фаговый дисплей, для специфичного связывания с целевой молекулой, например, с целевым белком Her-2/neu или EpCAM. Молекулы иммуноглобулина по настоящему изобретению могут быть молекулами иммуноглобулина любого типа (например, IgG, IgE, IgM, IgD, IgA и IgY), класса (IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) или подкласса иммуноглобулиновых молекул. «Антитела и их антиген-связывающие фрагменты», подходящие для применения в настоящем изобретении, включают, не ограничиваясь этим, поликлональные, моноклональные, моновалентные, биспецифичные, гетероконъюгаты, мультиспецифичные, человеческие, гуманизированные (в частности, CDR-привитые), деиммунизированные или химерные антитела, одноцепочечные антитела (например, scFv), фрагменты Fab, фрагменты F(ab')2, фрагменты, полученные с использованием экспрессионной библиотеки Fab, диатела или тетратела (Holliger P et al., 1993), нанотела, анти-идиотипические (анти-Id) антитела (включая, например, анти-Id антитела к антителам по настоящему изобретению), а также эпитоп-связывающие фрагменты любых из перечисленных выше антител.

В некоторых вариантах осуществления, антиген-связывающие фрагменты представляют собой фрагменты человеческих антиген-связывающих антител по настоящему изобретению и включают, не ограничиваясь этим, Fab, Fab' и F(ab')2, Fd, одноцепочечные фрагменты Fvs (scFv), одноцепочечные антитела, дисульфид-связанные фрагменты Fvs (dsFv) и фрагменты, включающие любой из доменов VL или VH. Антиген-связывающие фрагменты антител включающие одноцепочечные антитела, могут содержать вариабельный домен (домены) индивидуально или в комбинации со следующими целыми фрагментами или их частями: шарнирной областью, доменами CL, CH1, CH2 и CH3. Кроме того, изобретение включает антиген-связывающие фрагменты, которые охватывают любую комбинацию вариабельного домена (доменов) с шарнирной областью и доменами CL, CH1, CH2 и CH3.

Антитела, используемые в настоящем изобретении, могут быть любого животного происхождения, включая птиц и млекопитающих. Предпочтительно, источниками антител являются организмы людей, грызунов (например, мышей, крыс, морских свинок или кроликов), кур, свиней, овец, коз, верблюдов, коров, лошадей, ослов, кошек или собак. Особенно предпочтительно, чтобы антитела имели человеческое или мышиное происхождение. В настоящем описании «человеческие антитела» включают антитела, имеющие аминокислотную последовательность человеческого иммуноглобулина, и этот термин относится к антителам, выделенным из библиотек человеческого иммуноглобулина или из трансгенных животных, имеющих гены одного или нескольких человеческих иммуноглобулинов, и которые не экспрессируют эндогенных иммуноглобулинов, как описано, например, в патенте США № 5939598, выданном Kucherlapati и Jakobovits.

Термин «антитело-подобный белок», относится к белку, который был сконструирован (например, путем мутагенеза петлевой структуры) для специфичного связывания с целевой молекулой. Обычно, такой антитело-подобный белок содержит, как минимум, одну вариабельную пептидную петлю, прикрепленную обоими концами к белковому каркасу. Эта структура с двойным связыванием значительно увеличивает сродство антитело-подобного белка к связыванию, до уровней, сравнимых с антителами. Длина вариабельной пептидной петли, как правило, составляет от 10 до 20 аминокислотных остатков. Каркасный белок может быть любым белком, имеющим хорошую растворимость. Предпочтительно, каркасный белок является глобулярным белком малого размера. Антитело-подобные белки включают, не ограничиваясь этим, миметики антител компании Affibody, антикалины, и белки с анкириновым повтором (для ознакомления с обзором смотрите Binz et al., 2005). Антитело-подобные белки можно получать из больших библиотек мутантов, например, отбирать из больших библиотек фаговых дисплеев и изолировать аналогично обычным антителам. Антитело-подобные связывающиеся белки можно получать с помощью комбинаторного мутагенеза остатков, находящихся на поверхности глобулярных белков.

Термин «аптамер нуклеиновой кислоты» относится к молекуле нуклеиновой кислоты, которая была искусственно создана путем повторяющихся циклов отбора in vitro или с помощью методики SELEX (систематической эволюции лигандов экспоненциальным обогащением) для связывания с целевой молекулой (для ознакомления с обзором смотрите: Brody and Gold, 2000). Аптамер нуклеиновой кислоты может представлять собой молекулу ДНК или РНК. Аптамеры могут включать модификации, например, модифицированные нуклеотиды, такие как 2'-фторзамещенные пиримидины.

В настоящем описании, «аналог» соединения является структурно родственным, но не идентичным этому соединению и демонстрирует хотя бы один вид активности соединения. Соединение, с которым сравнивается аналог известно под названием «первичное» соединение. Упомянутые выше виды активности включают, не ограничиваясь этим: способность связываться с другим соединением; ингибирующую активность, например, способность ингибировать ферменты; токсические действия; активирующее действие, например, способность активировать ферменты. Необязательно, чтобы аналог демонстрировал указанную активность в той же степени, что и первичное соединение. Соединение считается аналогом в контексте настоящей заявки, если оно проявляет соответствующую активность в размере как минимум 1% (более предпочтительно, как минимум 5%, более предпочтительно, как минимум, 10%, более предпочтительно, как минимум, 20%, более предпочтительно, как минимум 30%, более предпочтительно, как минимум, 40% и более предпочтительно, как минимум 50%) от активности «первичного» соединения. Таким образом, термин «аналог аматоксина» в настоящем описании относится к соединению, которое является структурно родственным любому соединению из числа α-аманитина, β-аманитина, γ-аманитина, ε-аманитина, аманина, аманинамида, амануллина и амануллиновой кислоты, показанным на фиг.1, и которое демонстрирует, как минимум, 1% (более предпочтительно, как минимум 5%, более предпочтительно, как минимум, 10%, более предпочтительно, как минимум, 20%, более предпочтительно, как минимум 30%, более предпочтительно, как минимум, 40% и более предпочтительно, как минимум 50%) ингибирующей активности в отношении РНК полимеразы II млекопитающих, от активности по крайней мере одного соединения из числа α-аманитина, β-аманитина, γ-аманитина, ε-аманитина, аманина, аманинамида, амануллина и амануллиновой кислоты. «Аналог аматоксина», подходящий для применения может проявлять даже большую ингибирующую активность в отношении РНК полимеразы II млекопитающих, чем любое соединение из числа α-аманитина, β-аманитина, γ-аманитина, ε-аманитина, аманина, аманинамида, амануллина и амануллиновой кислоты. Эту ингибирующую активность можно измерить путем определения концентрации, при которой наблюдается 50% ингибирование (значения IC50). Ингибирующую активность в отношении РНК полимеразы II млекопитающих можно определить косвенным образом, измеряя ингибирующее действие на клеточную пролиферацию. Подходящая методика для измерения ингибирования клеточной пролиферации описана в разделе примеров.

Термин «полусинтетический аналог» относится к аналогу, который был получен химическим синтезом с использованием в качестве исходных материалов соединений, полученных из природных источников (например, растительных материалов, бактериальных культур или клеточных культур). Как правило, «полусинтетический аналог» по настоящему изобретению синтезирован на основе соединения, изолированного из грибов семейства Amanita. В противоположность этому, термин «синтетический аналог» относится к аналогу, полученному т.н. «полным синтезом» из малых структурных блоков (например, химических реактивов). Как правило, такой полный синтез проводят без помощи биологических процессов.

В настоящем изобретении, термин «аптамерный конъюгат» относится к конъюгату мишень-связывающего фрагмента и токсина, в котором мишень-связывающий фрагмент представляет собой аптамер нуклеиновой кислоты согласно упомянутой выше альтернативе (iii).

Термин «линкер» в контексте настоящего изобретения относится к молекуле, которая связывает два компонента, каждый из которых присоединен к одному из концов линкера, увеличивает расстояние между двумя компонентами и ослабляет пространственное взаимодействие между двумя этими компонентами, как, например, в данном случае, между мишень-связывающим фрагментом и аматоксином. В отсутствии линкера непосредственная связь аматоксина с мишень-связывающим фрагментом может снижать способность аматоксина взаимодействовать с РНК полимеразой II. В конкретных вариантах осуществления, линкер имеет непрерывную цепь, включающую от 1 до 30 скелетных атомов (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 или 30 атомов; где в контексте настоящего изобретения, термин «от … до» используется таким образом, что он включает указанные границы), т.е. длина линкера определяется, как кратчайшее расстояние, измеренное числом атомов или связей между фрагментом аматоксина и мишень-связывающим фрагментом, где один конец цепи линкера был введен в реакцию с аматоксином, и другой ее конец с мишень-связывающим фрагментом. В контексте настоящего изобретения, линкер предпочтительно представляет собой C1-20-алкилен, C1-20-гетероалкилен, C2-20-алкенилен, C2-20-гетероалкенилен, C2-20-алкинилен, C2-20-гетероалкинилен, циклоалкилен, гетероциклоалкилен, арилен, гетероарилен, аралкилен или необязательно замещенную гетероаралкиленовую группу. Линкер может содержать один или несколько структурных элементов, таких как карбоксамид, сложный эфир, простой эфир, тиоэфир, тиоэфир, дисульфид, мочевину, тиомочевину, углеводородные фрагменты и т.п. Линкер может также содержать комбинации двух или нескольких из этих структурных элементов. Каждый из этих структурных элементов может быть представлен в линкере более одного раза, например, два раза, три раза, четыре раза, пять раз или шесть раз. В некоторых вариантах осуществления, линкер может включать дисульфидную связь. Имеется в виду, что присоединение линкера к аматоксину и мишень-связывающему фрагменту должно осуществляться либо в одну стадию, либо в две или несколько последовательных стадий. С этой целью линкер должен нести две группы, предпочтительно на проксимальном и дистальном концах, которые могут (i) образовывать ковалентную связь с группой, присутствующей в одном из двух компонентов, которые предполагается связать линкером, предпочтительно активированной группой аматоксина или мишень-связывающего пептида или (ii) которая активирована или может быть активирована для образования ковалентной связи с группой в молекуле аматоксина. Соответственно, предпочтительно, чтобы на проксимальном и дистальном концах линкера находились химические группы, которые образуются в результате такой реакции сочетания, например, сложноэфирная, эфирная, уретановая, пептидная связь и т.д.

В контексте настоящего изобретения, термин «аматоксин» включает все циклические пептиды, состоящие из 8 аминокислот, которые выделены из грибов рода Amanita и описаны в обзоре Wieland, T и Faulstich H. (Wieland T, Fauslstich H., CRC Crit Rev Biochem. 1978 Dec; 5(3): 185-260) и, кроме того, включает все их химические производные; все их полусинтетические аналоги; все их синтетические аналоги, построенные из структурных блоков по аналогии с исходной структурой природных соединений (циклические, 8 аминокислот); все синтетические или полусинтетические аналоги, содержащие негидроксилированные аминокислоты, вместо гидроксилированных аминокислот; все синтетические или полусинтетические аналоги, в которых сульфоксидная группа простого тиоэфира заменена сульфидом, сульфоном или атомами, отличными от серы, например, атомом углерода, как в карбааналоге аманитина, где в каждом случае каждое из упомянутых производных или аналогов является функционально активным с точки зрения ингибирования РНК полимеразы II млекопитающих.

С функциональной точки зрения, аматоксины определяются как пептиды или депсипептиды, которые ингибируют РНК полимеразу II млекопитающих. Предпочтительными аматоксинами являются молекулы, включающие функциональные группы, которые можно ввести во взаимодействие с молекулами линкера или мишень-связывающего фрагмента, как определено выше. Аматоксинами, которые особенно подходят для конъюгатов по настоящему изобретению, являются α-аманитин, β-аманитин, γ-аманитин, ε-аманитин, аманин, аманинамид, амануллин и амануллиновая кислота, которые показаны на фиг.1, а также их соли, химические производные, полусинтетические аналоги и синтетические аналоги. Особенно предпочтительными аматоксинами для применения в настоящем изобретении являются α-аманитин, β-аманитин и аманинамид.

В настоящем описании, термин «химическое производное» (или, сокращенно, «производное») соединения относится к соединениям, имеющим химическую структуру, которая подобна структуре исходного соединения, но содержит как минимум одну химическую группу, которая отсутствует в исходном соединении и/или не содержит, как минимум, одной химической группы, которая присутствует в исходном соединении. Соединение, с которым осуществляется сравнение производного известно как «исходное» или «первичное» соединение. Как правило, «производное» можно получить из исходного соединения химическим синтезом, включающим одну или нескольких стадий.

В конкретных вариантах осуществления настоящего изобретения, аматоксин выбран из α-аманитина, β-аманитина, γ-аманитина, ε-аманитина, аманина, аманинамида, амануллина или амануллиновой кислоты, или из их солей или аналогов.

В одном из аспектов, настоящее изобретение относится к конъюгату аматоксина формулы (I):

где:

R1 означает H или OH;

R2 означает H или OH;

R3 означает NH2 или OH;

R4 означает OH или OC1-6 алкил; и

R5 означает L-T; где L означает линкер; и T означает мишень-связывающий фрагмент.

В отдельном варианте осуществления, конъюгат аматоксина формулы (I) представляет собой производное α-аманитина (R1=OH; R2=OH; и R3=NH2).

В отдельном варианте осуществления, R4 означает O-Me.

В отдельном варианте осуществления, линкер соединен с мишень-связывающим фрагментом через фрагмент мочевины.

В контексте настоящего изобретения, термин «соединен с мишень-связывающим фрагментом через фрагмент мочевины» относится к связи между линкером и мишень-связывающим фрагментом, где мишень-связывающий фрагмент непосредственно прикреплен к линкеру через группу -NH-C(O)-NH-.

В отдельных вариантах осуществления настоящего изобретения, мишень-связывающий фрагмент соединен с линкером L через аминогруппу, входящую в мишень-связывающий фрагмент, где указанная аминогруппа образует часть указанного фрагмента мочевины.

В отдельных вариантах осуществления, линкер имеет длину от 1 до 8 атомов, в т.ч. от 1 до 6 атомов, более конкретно от 1 до 4 атомов и наиболее конкретно от 2 до 4 атомов. Так, например, этиленовый линкер имеет длину 2 атома, пропиленовый линкер имеет длину 3 атома и бутиленовый линкер имеет длину 4 атома.

В отдельных вариантах осуществления настоящего изобретения, линкер L включает одну или несколько групп, в частности, одну, две или три группы, выбранные из перечная, состоящего из: алкилена, алкенилена, алкинилена, циклоалкилена, гетероалкилена, гетероалкенилена, гетероалкинилена, гетероциклоалкилена, арилена, гетероарилена, аралкилена и гетероаралкилена, где каждая из этих групп может необязательно и независимо являться замещенной.

Термин «алкилен» относится к двухвалентным углеводородным группам с линейной насыщенной цепью, включающим от 1 до 20 атомов углерода, в т.ч. группам, включающим от 1 до 10 атомов углерода. В некоторых вариантах осуществления, алкиленовая группа может являться низшей алкиленовой группой. Термин «низший алкилен» относится к алкиленовым группам, включающим от 1 до 6 атомов углерода, и, в некоторых вариантах осуществления, от 1 до 5 или от 1 до 4 атомов углерода. Примеры алкиленовых групп включают, не ограничиваясь этим, метилен (-CH2-), этилен (-CH2-CH2-), н-пропилен, н-бутилен, н-пентилен и н-гексилен.

Термин «алкенилен» относится к двухвалентным группам с линейной цепью, включающим от 2 до 20 атомов углерода, в которых как минимум одна из углерод-углеродных связей является двойной, тогда как другие связи могут быть простыми связями или дополнительными двойными связями. Термин «алкинилен» в настоящей заявке относится к группам, включающим от 2 до 20 атомов углерода, в которых как минимум одна из углерод-углеродных связей является тройной, тогда как другие связи могут быть простыми, двойными или дополнительными тройными связями. Примеры алкениленовых групп включают этенилен (-CH=CH-), 1-пропенилен, 2-пропенилен, 1-бутенилен, 2-бутенилен, 3-бутенилен и т.п. Примеры алкиниленовых групп включают этинилен, 1-пропинилен, 2-пропинилен и т.д.

Имеется в виду, что в настоящем описании термин «циклоалкилен» относится к двухвалентному циклу, являющемуся частью любой стабильной моноциклической или полициклической системы, где указанный цикл включает от 3 до 12 атомов углерода, но не содержит гетероатомов, и является полностью насыщенным, и термин «циклоалкенилен» предназначен для указания на двухвалентный цикл, являющийся частью любой стабильной моноциклической или полициклической системы, где указанный цикл включает от 3 до 12 атомов углерода, но не содержит гетероатомов, и является по крайней мере частично ненасыщенным (но исключая ариленовый цикл). Примеры циклоалкиленов включают, не ограничиваясь этим, циклопропилен, циклобутилен, циклопентилен, циклогексилен и циклогептилен. Примеры циклоалкениленов включают, не ограничиваясь этим, циклопентенилен и циклогексенилен.

Имеется в виду, что в настоящем описании термины «гетероциклоалкилен» и «гетероциклоалкенилен» относятся к двухвалентному циклу, являющемуся частью любой стабильной моноциклической или полициклической системы, где указанный цикл включает от 3 до примерно 12 атомов и состоит из атомов углерода и, как минимум, одного гетероатома, в т.ч. как минимум одного гетероатома, независимо выбранного из группы, состоящей из N, O и S, где гетероциклоалкилен относится к полностью насыщенному циклу, и гетероциклоалкенилен относится к циклу, который является хотя бы частично ненасыщенным (но исключая любые ариленовые или гетероариленовые циклы).

Имеется в виду, что термин «арилен» означает двухвалентный цикл или циклическую систему, являющуюся частью любой стабильной моноциклической или полициклической системы, где этот цикл или циклическая система включает от 3 до 20 атомов углерода, но не содержит гетероатомов, и состоит из ароматического фрагмента, который определяется согласно правилу «4n+2» π электронов, включая фенилен.

Имеется в виду, что в настоящем описании термин «гетероарилен» относится к двухвалентному циклу или циклической системе, являющейся частью любой стабильной моно- или полициклической системы, где указанный цикл или полициклическая система включают от 3 до 20 атомов, состоит из ароматического фрагмента, который определяется согласно правилу «4n+2» π электронов, и содержит атомы углерода и один или несколько гетероатомов азота, серы и/или кислорода.

В контексте настоящего изобретения, имеется в виду, что термин «замещенный» указывает на то, что один или несколько атомов водорода, присутствующих в скелете линкера, заменены группами, выбранными из указанных групп, при условии, что не превышена нормальная валентность соответствующих атомов в указанных группах или атомов в замещаемой группе, и что замещение приводит к стабильному соединению. Имеется в виду, что термин «необязательно замещенный» означает, что линкер является замещенным или незамещенным, согласно данному выше определению, одним или несколькими заместителями, которые указаны в описании. Если заместитель представляет собой кето- (или оксо, т.е. =O) группу, тио, имино, или подобную группу, тогда замещению подвергаются два атома водорода у атома линкера. Типовые заместители включают, например, алкил, алкенил, алкинил, циклоалкил, гетероциклоалкил, арил, гетероарил, аралкил, гетероаралкил, ацил, ароил, гетероароил, карбоксил, алкокси, арилокси, ацилокси, ароилокси, гетероароилокси, алкоксикарбонил, галоген, (тио)сложный эфир, циано, фосфорил, амино, имино, (тио)амидо, сульфгидрил, алкилтио, ацилтио, сульфонил, сульфат, сульфонат, сульфамоил, сульфонамидо, нитро, азидо, галогеналкил, включая перфторгалогеналкил (такой как трифторметил), галогеналкокси, алкилсульфанил, алкилсульфинил, алкилсульфонил, алкилсульфониламино, арилсульфоноамино, фосфорил, фосфат, фосфонат, фосфинат, алкилкарбокси, алкилкарбоксиамид, оксо, гидрокси, меркапто, амино (необязательно, моно- или ди замещенную аминогруппу, например, алкилом, арилом или гетероарилом), имино, карбоксамидо, карбамоил (необязательно, моно- или ди-замещенный, например, алкилом, арилом или гетероарилом), амидино, аминосульфонил, ациламино, ароиламино, (тио)уреидо, арил(тио)уреидо, алкил(тио)уреидо, циклоалкил(тио)уреидо, арилокси, аралкокси или -O(CH2)n-OH, -O(CH2)n-NH2, -O(CH2)nCOOH, -(CH2)nCOOH, -C(O)O(CH2)nR, -(CH2)nN(H)C(O)OR или -N(R)S(O)2R, где n означает 1-4 и заместитель R независимо выбран из водорода, -алкила, -алкенила, -алкинила, -циклоалкила, -циклоалкенила, -(С-линкер-гетероциклоалкил), -(C-линкер-гетероциклоалкенил), -арила и -гетероарила, причем допускается наличие различных степеней замещения. Специалист в данной области техники поймет, что заместители, такие как гетероциклоалкил, арил, гетероарил, алкил и т.д., или функциональные группы, такие как -OH, -NHR, и т.д. могут сами по себе быть замещенными, если имеется такая возможность. Кроме того, специалист в данной области поймет, что сами замещенные фрагменты могут быть замещенными, также если имеется такая возможность.

В отдельных вариантах осуществления настоящего изобретения, если линкер L включает m групп, выбранных из: алкилена, алкенилена, алкинилена, циклоалкилена, гетероалкилена, гетероалкенилена, гетероалкинилена, гетероциклоалкилена, арилена, гетероарилена, аралкилена и гетероаралкилена, где каждая группа может быть необязательно независимо замещенной, где указанный линкер дополнительно включает n фрагментов, независимо выбранных из дисульфида (-S-S), простого эфира (-O-), тиоэфира (-S-), амина (-NH-), сложного эфира (-O-C(=O)- или -C(=O)-O-), карбоксамида (-NH-C(=O)- или -C(=O)-NH-), уретана (-NH-C(=O)-O- или -O-C(=O)-NH-) и мочевины (-NH-C(=O)-NH-), где m=n+1. В отдельных вариантах осуществления, m означает 2, и n означает 1, или m означает 3, и n означает 2. В отдельных вариантах осуществления, линкер включает 2 или 3 незамещенные алкиленовые группы и 1 или 2, соответственно, дисульфидные, эфирные, тиоэфирные, амино, сложноэфирные, карбоксамидные, уретановые или мочевинные группы, связывающие эти незамещенные алкиленовые группы.

В отдельных вариантах осуществления настоящего изобретения, мишень-связывающий фрагмент специфично связывается с эпитопом, который имеется на опухолевой клетке.

В отдельных вариантах осуществления настоящего изобретения, мишень-связывающий фрагмент специфично связывается с эпитопом Her-2/neu или молекулы адгезии эпителиальных клеток (EpCAM).

В отдельных вариантах осуществления настоящего изобретения, мишень-связывающий фрагмент выбран из группы, состоящей из антитела или его антиген-связывающего фрагмента, антитело-подобного белка и аптамера нуклеиновой кислоты.

В отдельных вариантах осуществления настоящего изобретения, антитело или его антиген-связывающий фрагмент выбраны из диатела, тетратела, нанотела, химерного антитела, деиммунизированного антитела, гуманизированного антитела или человеческого антитела.

В отдельных вариантах осуществления настоящего изобретения, антиген-связывающий фрагмент выбран из группы, состоящей из Fab, F(ab')2, Fd, Fv, одноцепочечного фрагмента Fv, и дисульфид-связанных Fvs (dsFv).

В отдельных вариантах осуществления, антитело представляет собой герцептин или HEA125, или фрагмент антитела, включающий антиген-связывающий фрагмент герцептина или HEA125.

В отдельных вариантах осуществления, с одним мишень-связывающим фрагментом связана более, чем одна молекула аматоксина. Увеличение числа молекул аматоксина на одну молекулу конъюгата также увеличивает токсичность. Соответственно, в отдельном варианте осуществления, соотношение количества мишень-связывающих фрагментов к количеству аматоксина составляет 1 мишень связывающий фрагмент на 2-15 молекул аматоксина, в том числе 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 или 15. Для вычисления упомянутого отношения в случае димеров антител, например, IgGs, димер рассматривается в качестве одного мишень-связывающего фрагмента.

В отдельных вариантах осуществления настоящего изобретения, конъюгат предназначен для применения в качестве лекарственного средства.

В отдельных вариантах осуществления настоящего изобретения, конъюгат предназначен для применения в лечении ракового заболевания у пациента, где упомянутое раковое заболевание выбрано из группы, состоящей из рака поджелудочной железы, холангиокарциномы, рака груди, колоректального рака, рака легких, рака простаты, рака яичников, рака желудка, рака почек, злокачественной меланомы, лейкоза и злокачественной лимфомы.

В еще одном аспекте настоящее изобретение относится к способу лечения ракового заболевания у пациента, где это раковое заболевание выбрано из группы, состоящей из рака поджелудочной железы, холангиокарциномы, рака груди, колоректального рака, рака легких, рака простаты, рака яичников, рака желудка, рака почек, злокачественной меланомы, лейкоза и злокачественной лимфомы, включающему стадию введения конъюгата по настоящему изобретению пациенту, которому необходимо такое лечение.

В настоящем описании термин «пациент» означает любое млекопитающее или птицу, которые могут получить пользу от лечения конъюгатом мишень-связывающего фрагмента и токсина, описанным в настоящей заявке. Предпочтительно, «пациент» выбран из группы, состоящей из лабораторных животных (например, мышей или крыс), домашних животных (включая, например, морских свинок, кроликов, кур, свиней, овец, коз, верблюдов, коров, лошадей, ослов, кошек или собак), или приматов, включая людей. Особенно предпочтительно, чтобы пациент представлял собой человека.

В настоящем описании, термины «лечить» или «лечение» в отношении заболевания или расстройства означает достижение одного из следующих результатов: (a) уменьшение тяжести расстройства; (b) ограничение или предотвращение развития симптомов, характерных для подвергаемого лечению расстройства (расстройств); (c) подавление усиления симптомов, характерных для подвергаемого лечению расстройства (расстройств); (d) ограничение или предотвращение рецидива расстройства (расстройств) у пациента, у которого ранее имелось это расстройство (расстройства); и (e) ограничение или предотвращение рецидива симптомов у пациента, у которого ранее имелись симптомы этого расстройства (расстройств).

В рамках настоящего изобретения, лечение может включать введение пациенту конъюгата или фармацевтической композиции по настоящему изобретению, где «введение» включает введение in vivo, а также введение непосредственно в ткань ex vivo, например в венозные трансплантаты.

В конкретных вариантах осуществления, применяется терапевтически эффективное количество конъюгата по настоящему изобретению.

«Терапевтически эффективное количество» представляет собой количество терапевтического агента, достаточное для достижения намеченной цели. Эффективное количество данного терапевтического агента будет меняться в зависимости от таких факторов, как природа агента, путь введения, размер и вид животного, получающего терапевтический агент, а также цели введения. Эффективное количество может быть определено экспериментально в каждом индивидуальном случае квалифицированным специалистом в области медицины по известным в технике методикам.

В еще одном аспекте, настоящее изобретение относится к фармацевтической композиции, включающей конъюгат по настоящему изобретению, и, кроме того, один или несколько фармацевтически приемлемых разбавителей, носителей, эксципиентов, наполнителей, связующих веществ, смазывающих веществ, средств для скольжения, дезинтегрирующих средств, абсорбентов и/или консервантов.

«Фармацевтически приемлемый» означает одобренный регулирующим органом федерального правительства или правительства штата, или упомянутый в фармакопее США или другой общепризнанной фармакопее для применения у животных и, более конкретно, у людей.

В отдельных вариантах осуществления, фармацевтическую композицию применяют в форме лекарственного средства системного введения. Это понятие включает средства для парентерального введения, которые охватывают, в том числе, средства для инъекции и инфузии. Препараты для инъекций обычно имеют форму ампул, либо т.н. готовых к применению форм для инъекций, например, готовых к применению шприцев или одноразовых шприцев, и, помимо этого, перфорируемых флаконов для многократного отбора препарата. Введение препаратов для инъекций может осуществляться в форме подкожного (s.c.), внутримышечного (i.m.), внутривенного (i.v.) или внутрикожного (i.c.) введения. В частности, имеется возможность получать составы, подходящие для инъекций, в форме суспензии кристаллов, растворов, наночастиц или коллоидных дисперсных систем, например, гидрозолей.

Кроме того, составы для инъекций можно получать в виде концентратов, которые можно растворять или диспергировать с помощью водных изотонических разбавителей. Препараты для инфузии можно также получать в форме изотонических растворов, жировых эмульсий, липосомальных составов и микроэмульсий. По аналогии с препаратами для инъекции, составы для инфузии можно также получать в форме концентратов для разбавления. Составы для инъекций можно также вводить в форме продолжительных инфузий, как при клиническом, так и при амбулаторном лечении, например, с помощью мини-насосов.

Имеется возможность добавлять к составам для парентерального введения, например, альбумин, плазму, расширяющую добавку, поверхностно-активные вещества, органические разбавители, вещества, влияющие на pH, комплексообразующие вещества или полимерные вещества, в частности, в качестве веществ, влияющих на адсорбцию конъюгатов мишень-связывающего фрагмента и токсина по настоящему изобретению белками или полимерами, или же, комплексообразователи и полимеры можно добавлять с целью уменьшения адсорбции конъюгатов мишень-связывающего фрагмента и токсина по настоящему изобретению материалами устройств для инъекций или упаковочными материалами, например, пластмассой или стеклом.

Конъюгаты мишень-связывающего фрагмента и токсина по настоящему изобретению в препаратах для парентерального введения могут быть связаны с микроносителями или наночастицами, например, с тонко диспергированными частицами поли(мет)акрилатов, полилактатов, полигликолятов, полиаминокислот или полиэфируретанов. Парентеральные составы можно также модифицировать, получая препараты с пролонгированным высвобождением, например, исходя из принципа «мультичастиц», когда конъюгаты мишень-связывающего фрагмента и токсина по настоящему изобретению вводят в тонко диспергированную, диспергированную и суспендированную форму, соответственно, или получают лекарственное средство в виде суспензии кристаллов, или исходя из принципа «моночастиц», если конъюгат мишень-связывающего фрагмента и токсина по настоящему изобретению включают в лекарственную форму, например, типа таблетки или стержня, который затем имплантируют в организм пациента. Эти имплантаты или составы пролонгированного действия в форме препаратов, содержащих моно- или мультичастицы часто состоят из т.н. биоразрушаемых полимеров, например, полиэфиров молочной кислоты и гликолевой кислоты, полиэфируретанов, полиаминокислот, поли(мет)акрилатов или полисахаридов.

Адъюванты и носители, которые добавляют при получении фармацевтических композиций по настоящему изобретению, предназначенных для парентерального введения, предпочтительно представляют собой aqua sterilisata (стерилизованную воду), вещества, регулирующие pH, например, органические или неорганические кислоты или основания, а также их соли, буферные вещества для регулирования значения pH, вещества для достижения изотоничности, например, хлористый натрий, гидрокарбонат натрия, глюкозу и фруктозу, тенсиды и ПАВ, соответственно, и эмульгаторы, например, частично замещенные сложные эфиры полиоксиэтиленсорбитана и жирных кислот (например, Tween®) или, например, сложные эфиры полиоксиэтиленов и жирных кислот (например, Cremophor®), жирные масла, как, например, масло арахиса, соевое масло или касторовое масло, синтетические сложные эфиры жирных кислот, как, например, этилолеат, изопропилмиристат и нейтральное масло (например, Miglyol®), а также полимерные адъюванты, как, например, желатин, декстран, поливинилпирролидон, добавки, которые увеличивают растворимость органических растворителей, как, например, пропиленгликоль, этанол, N,N-диметилацетамид, пропиленгликоль или комплексообразующие вещества, как, например, цитрат и мочевину, консерванты, как, например, гидроксипропиловый и метиловый эфиры бензойной кислоты, бензиловый спирт, антиоксиданты, как, например, сульфит натрия и стабилизаторы, как, например, EDTA.

Если фармацевтические композиции по настоящему изобретению получают в виде суспензий, в предпочтительном варианте осуществления добавляют загущающие агенты для предотвращения осаждения конъюгатов токсина и мишень-связывающего фрагмента по настоящему изобретению, или ПАВ и полиэлектролиты, чтобы обеспечить способность осадка к повторному суспендированию, и/или комплексообразующие агенты, как, например, EDTA. Кроме того, имеется возможность получать комплексы действующего ингредиента с различными полимерами. Примерами таких полимеров являются полиэтиленгликоль, полистирол, карбоксиметилцеллюлоза, Pluronics® или эфир жирной кислоты и полиэтиленгликоль сорбита. Конъюгат токсина и мишень-связывающего фрагмента по настоящему изобретению может быть также введен в жидкие составы в форме соединения включения, например, с циклодекстринами. В отдельных вариантах осуществления, диспергирующие агенты могут быть добавлены в качестве дополнительных адъювантов. Для получения лиофилизатов, могут применяться агенты, образующие каркас твердых частиц, например, маннит, декстран, сахароза, человеческий альбумин, лактоза, PVP или различные виды желатина.

В другом аспекте, настоящее изобретение направлено на способ лечения рака поджелудочной железы, холангиокарциномы, рака груди, колоректального рака, рака легких, рака простаты, рака яичников, рака желудка, рака почек, злокачественной меланомы, лейкоза или злокачественной лимфомы у пациента при наличии такой необходимости, включающий введение пациенту эффективного количества конъюгата или фармацевтической композиции по настоящему изобретению.

В другом аспекте, настоящее изобретение относится к молекуле конъюгации с аматоксином, включающей уходящую группу X, присоединенную к линкеру L, связанному с аматоксином или аналогом аматоксина, где линкер L соединен с аматоксином через атом 1'-N аминокислоты 4.

В некоторых вариантах осуществления этого аспекта, настоящее изобретение относится к молекуле конъюгации с аматоксином формулы (I)

где:

R1 означает H или OH;

R2 означает H или OH;

R3 означает NH2 или OH;

R4 означает OH или OC1-6 алкил; и

R5 означает L-X; где L означает линкер; и X означает уходящую группу, которая может быть замещена нуклеофильной группой мишень-связывающего фрагмента.

В отдельном варианте осуществления, нуклеофильная группа является первичной аминогруппой.

В отдельном варианте осуществления, молекула конъюгации с аматоксином формулы (I) является производным α-аманитина (R1=OH; R2=OH; и R3=NH2).

В отдельном варианте осуществления, R4 означает O-Me.

В отдельных вариантах осуществления, линкер имеет длину от 1 до 8 атомов, в т.ч. от 1 до 6 атомов, более конкретно от 1 до 4 атомов и наиболее конкретно от 2 до 4 атомов.

В отдельных вариантах осуществления, линкер L представляет собой алкилен, гетероалкилен, алкенилен, гетероалкенилен, алкинилен, гетероалкинилен, циклоалкилен, гетероциклоалкилен, арилен, гетероарилен, аралкилен и гетероаралкилен, необязательно замещенные.

В некоторых вариантах осуществления, линкер L включает фрагмент, выбранный из одного или нескольких фрагментов из числа дисульфида, простого эфира, амина, сложного эфира, карбоксамида, уретана и мочевины.

В некоторых вариантах осуществления, функциональная группа X выбрана из: т-бутилокси, сукцинимидилокси, 1-O-сукцинимидилокси-3-сульфоната (сульфо-NHS), O-(4-нитрофенилокси), O-(3-нитрофенилокси), O-(2,4-динитрофенилокси), O-(2,4-дихлор-6-нитрофенилокси), пентафторфенилокси, пентахлорфенилокси, O-(2,4,5-трихлорфенилокси), O-(3,4-дигидро-3-гидрокси-4-оксо-1,2,3-бензотриазин-3-ила), O-(эндо-1-гидрокси-5-норборнен-2,3-дикарбоксимид-1-ила), 1-фталимидоилокси, 1-бензотриазолилокси, 1-(7-азабензотриазолил)окси и N-имидазолила.

В другом аспекте, настоящее изобретение относится к способу синтеза конъюгата аматоксина по настоящему изобретению, включающему стадию взаимодействия молекулы конъюгации с аматоксином по настоящему изобретению с мишень-связывающим фрагментом, включающим нуклеофильную группу, в частности первичную аминогруппу.

В следующем аспекте, настоящее изобретение относится к способу синтеза молекулы конъюгации с аматоксином по настоящему изобретению, включающему стадию (i) взаимодействия аматоксина с молекулой линкера Y-L-X, где Y-является фрагментом, который может взаимодействовать с 1'-N атомом аминокислоты 4 аматоксина, и где X является уходящей группой, которая может быть замещена нуклеофильной группой мишень-связывающего фрагмента, в т.ч. первичной аминогруппой.

В еще одном аспекте, настоящее изобретение относится к способу синтеза молекулы конъюгации с аматоксином по настоящему изобретению, включающему стадию (i) взаимодействия аматоксина с молекулой линкера Y-L-Z, где Y-является фрагментом, который может взаимодействовать с 1'-N атомом аминокислоты 4 аматоксина, и где Z является фрагментом, который может быть превращен в уходящую группу X, которая может быть замещена нуклеофильной группой мишень-связывающего фрагмента, в т.ч. первичной аминогруппой.

В некоторых вариантах осуществления, аматоксин вводят в реакцию с молекулой линкера Y-L-X или Y-L-Z соответственно, где фрагмент Y выбран из группы, состоящей из: O-Tos (O-Tos=тозилат); I; Br, и O-Tf (O-Tf=трифлат). В некоторых из этих вариантов осуществления, аматоксин обрабатывают Y-L-X или Y-L-Z соответственно, в присутствии основания, в том числе KO-t-Bu, LiOH или NaH, в растворителе, в частности полярном, апротонном растворителе, например, ДМФА, ДМСО или NMP.

В некоторых вариантах осуществления, группа Z является защищенной первичной аминогруппой, в частности NH-C(=O)Ot-Bu. В некоторых из этих вариантов осуществления, во-первых, снимают защиту защищенной аминогруппы и затем активируют ее производным угольной кислоты, например, дигидроксисукцинимидо карбонатом (DSC).

В еще одном аспекте, настоящее изобретение относится к молекуле, включающей аматоксин и линкер, формулы (I), в которой заместители R1-R4 соответствуют данному выше определению, и R5 означает L-Z; где L представляет собой линкер, и Z означает фрагмент, который можно превратить в уходящую группу X, которую можно заместить нуклеофильной группой мишень-связывающего фрагмента, в частности первичной аминогруппой.

ПРИМЕРЫ

Ниже по тексту настоящее изобретение более подробно объясняется с привлечением не ограничивающих примеров:

Пример 1: синтез N1'-линкер-замещенных аманитинов

1.1. Получение N1'-6-аминогексил-6'-O-метил-α-аманитина (HDP 30.0378)

4,86 мг (5,21 мкмоль) O-метил-α-аманитина растворяли в 500 мкл сухого ДМСО. В атмосфере аргона добавляли 11,68 мг (41,67 мкмоль) Boc-аминогексил бромида и 100 мкл 52,1 мМ раствора т-бутаноата калия в ДМСО. Добавляли дополнительные порции 5,21 мМ раствора т-бутаноата калия: 50 мкл через 1,5 ч; 50 мкл через 4 ч и 50 мкл через 6 ч. Через 19 часов добавляли 100 мкл т-бутаноата калия и 11,96 мг (41,67 мкмоль) Boc-аминогексил бромида. Через 21 ч реакционную смесь гасили 104 мкл 100 мМ раствора уксусной кислоты в ДМСО. Неочищенный продукт очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода (0,05% TFA), скорость потока: 26,0 мл/мин, детектирование на длине волны λ=295 нм. Растворитель A: 95% воды, 5% метанола, 0,05% трифторуксусной кислоты. Растворитель B: 10% воды, 90% метанола, 0,05% трифторуксусной кислоты. Градиент: 0-5 мин 100% A; 5-20 мин 0% A; 20-25 мин 0% A; 25-27 мин 100% A; 27-35 мин 100% A; собирали фракцию со временем удерживания в диапазоне 19,2-20,9 мин и выпаривали растворители до получения твердого остатка.

4,81 мг (81%) HDP 30.0368; МС: 1133 (M+H+).

4,75 мг (4,19 мкмоль) HDP 30.0368 растворяли в 200 мкл трифторуксусной кислоты и перемешивали в течение 2 мин. Реакционную смесь упаривали досуха при комнатной температуре и затем выпаривали совместно с 1000 мкл толуола и 10000 мкл ацетонитрила. Неочищенный продукт очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода (0,05% TFA), скорость потока: 26,0 мл/мин, детектирование на длине волны λ=295 нм. Растворитель A: 95% воды, 5% метанола, 0,05% трифторуксусной кислоты. Растворитель B: 10% воды, 90% метанола, 0,05% трифторуксусной кислоты. Градиент: 0-5 мин 100% A; 5-20 мин 0% A; 20-25 мин 0% A; 25-27 мин 100% A; 27-35 мин 100% A; собирали фракцию со временем удерживания в диапазоне 14,9-15,5 мин, выпаривали растворители и подвергали лиофильной сушке до получения порошка.

1,54 мг (32%) HDP 30.0378; МС: 1033 (M+H+).

1.2 Получение N1'-8-аминооктил-6'-O-метил-α-аманитина (HDP 30.0516)

12,43 мг (13,32 мкмоль) O-метил-α-метиламанитина растворяли в 750 мкл сухого ДМСО. Добавляли 40,00 мг (129,76 мкмоль) N-Boc-8-аминобромоктана и 120 мкл 0,1М раствора LiOH в смеси ДМСО/вода 1:1. Реакционную смесь перемешивали при комнатной температуре в атмосфере аргона. Через 18 часов добавляли дополнительные 80 мкл LiOH и затем 40 мкл через 36 ч, 50 мкл через 39 ч и 80 мкл через 44 часа. ДМСО и воду удаляли в глубоком вакууме и остаток очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода (0,05% TFA), скорость потока: 10,0 мл/мин, детектирование на длине волны λ=230 нм. Растворитель A: 95% воды, 5% метанола, 0,05% трифторуксусной кислоты. Растворитель B: 10% воды, 90% метанола, 0,05% трифторуксусной кислоты. Градиент: 0-5 мин 80% A; 5-10 мин 50% A; 10-20 мин 30% A; 20-50 мин 20% A; собирали фракцию со временем удерживания 37,0 мин и выпаривали растворители в вакууме.

3,96 мг (26%) HDP 30.0496 в виде белого порошка; МС: 1160 (M+H+).

3,96 мг (3,41 мкмоль) HDP 30.0496 растворяли в 300 мкл трифторуксусной кислоты и перемешивали в течение 2,5 мин при комнатной температуре. Реакционную смесь разбавляли 1000 мкл толуола и упаривали досуха при комнатной температуре. Остаток два раза упаривали с тем же объемом толуола. Остаток очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода (0,05% TFA), скорость потока: 10,0 мл/мин, детектирование на длине волны λ=230 нм. Растворитель A: 95% воды, 5% метанола, 0,05% трифторуксусной кислоты. Растворитель B: 10% воды, 90% метанола, 0,05% трифторуксусной кислоты. Градиент: 0-5 мин 80% A; 5-10 мин 50% A; 10-20 мин 30% A; 20-50 мин 20% A; собирали фракцию со временем удерживания 21,0 мин и выпаривали растворители в вакууме.

2,66 мг (74%) HDP 30.0516 в виде белого порошка; МС: 1060 (M+H+); 1083 (M+Na+).

1.3 Получение N1'-6-аминобутил-6'-O-метил-α-аманитина HDP 30.0592

11,88 мг (12,74 мкмоль) O-метил-α-аманитина растворяли в 500 мкл сухого ДМСО. В атмосфере аргона добавляли 20,00 мг (79,32 мкмоль) Boc-аминобутилбромида и 83,4 мкл 0,25 мМ раствора т-бутанолата калия. Во время проведения реакции каждый час добавляли дополнительные порции 20,00 мг (79,32 мкмоль) Boc-аминобутилбромида и 83,4 мкл т-бутанолата калия. Через 8 часов реакционную смесь гасили 100 мкл уксусной кислоты. Неочищенный продукт очищали на системе LaPrep-HPLC: колонка Phenomenex Luna C18, 10 мкм, 250×20 мм, элюент метанол/вода, скорость потока: 15,0 мл/мин, детектирование на длине волны λ=290 нм. Растворитель A: 100% воды. Растворитель B: 100% метанола. Градиент: 0 мин 95% A; 0-5 мин 50% A; 5-10 мин 30% A; 10-20 мин 20% A; 20-45 мин 5% A. Собирали фракцию со временем удерживания 16,5 мин и выпаривали растворители.

5,10 мг (36%) HDP 30.0587; МС: 1104,5 (M+H+).

5,10 мг (4,61 мкмоль) HDP 30.0587 растворяли в 1000 мкл трифторуксусной кислоты и перемешивали в течение 2 мин. Реакционную смесь упаривали при комнатной температуре и высушивали в вакууме. Неочищенный продукт очищали на системе LaPrep-HPLC: колонка Phenomenex Luna C18, 10 мкм, 250×20 мм, элюент метанол/вода, скорость потока: 15,0 мл/мин, детектирование на длине волны λ=290 нм. Растворитель A: 95% воды, 5% метанола, 0,05% трифторуксусной кислоты. Растворитель B: 5% воды, 95% метанола, 0,05% трифторуксусной кислоты. Градиент: 0 мин 100% A; 0-5 мин 50% A; 5-10 мин 30% A; 10-20 мин 20% A; 20-45 мин 0% A. Собирали фракцию со временем удерживания 10,0 мин и выпаривали растворители.

3,48 мг (75%) HDP 30.0592 в виде белого порошка; МС: 1004,4 (M+H+).

1.4 Получение N1'-6-аминопентил-6'-O-метил-α-аманитина HDP 30.0644

8,40 мг (9,00 мкмоль) O-метил-α-метиламанитина растворяли в 400 мкл сухого ДМСО. Добавляли 29,00 мг (108,94 мкмоль) N-Boc-5-аминобромпентана и 14,20 мкл 1М раствора LiOH в воде. Реакционную смесь перемешивали при комнатной температуре в атмосфере аргона. Через 4 часа добавляли дополнительные 7,10 мкл LiOH. Через 6 ч реакционную смесь гасили 100 мкл уксусной кислоты и удаляли ДМСО и воду в глубоком вакууме. Остаток очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода, скорость потока: 10,0 мл/мин, детектирование на длине волны λ=290 нм. Растворитель A: 95% воды, 5% метанола. Растворитель B: 5% воды, 95% метанола. Градиент: 0-5 мин 80% A; 5-10 мин 50% A; 10-20 мин 30% A; 20-50 мин 20% A. Собирали фракцию со временем удерживания 30 мин и выпаривали растворители в вакууме.

HDP 30.0636 получали в виде белого порошка; МС: 1118,5 (M+H+). Полученный продукт использовали в следующей стадии

HDP 30.0636 растворяли в 400 мкл трифторуксусной кислоты и перемешивали в течение 5 мин при комнатной температуре. Реакционную смесь разбавляли 1000 мкл толуола и упаривали досуха при комнатной температуре. Твердый остаток дважды упаривали с тем же объемом толуола (2х) и очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода (0,05% TFA), скорость потока: 10,0 мл/мин, детектирование на длине волны λ=290 нм. Растворитель A: 95% воды, 5% метанола, 0,05% трифторуксусной кислоты. Растворитель B: 10% воды:90% метанола, 0,05% трифторуксусной кислоты. Градиент: 0-5 мин 80% A; 5-10 мин 50% A; 10-20 мин 30% A; 20-50 мин 20% A. Собирали фракцию со временем удерживания 18,0 мин и выпаривали растворители в вакууме.

0,51 мг белого порошка (суммарный выход 6%) HDP 30.0644; МС: 1018,4 (M+H+).

1.5 Получение N1-т-бутилпропионил-6-O-метил-α-аманитина HDP 30.0678

7,04 мг (7,55 мкмоль) O-метил-α-метиламанитина растворяли в 500 мкл сухого ДМСО. Добавляли 14,10 мкл 1М раствора LiOH в воде. Реакционную смесь перемешивали при комнатной температуре в атмосфере аргона в течение 5 мин и добавляли 20 мкл т-бутилового эфира 1-хлорпропионовой кислоты. Через 1 ч добавляли еще 20,00 мкл LiOH и 20,00 мкл т-бутилового эфира 1-хлорпропионовой кислоты. Через 2 ч реакционную смесь гасили 100 мкл уксусной кислоты. ДМСО и воду удаляли в глубоком вакууме, и остаток очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода, скорость потока: 10,0 мл/мин, детектирование на длине волны λ=290 нм. Растворитель A: 95% воды, 5% метанола. Растворитель B: 5% воды, 95% метанола. Градиент: 0-5 мин 80% A; 5-10 мин 50% A; 10-20 мин 30% A; 20-50 мин 20% A. Собирали фракцию со временем удерживания 26,0 мин и выпаривали растворители в вакууме.

HDP 30.0677 получали в виде белого твердого вещества. МС: 1047,4 (M+H+). Остаток использовали в следующей стадии.

HDP 30.0677 растворяли в 500 мкл трифторуксусной кислоты и перемешивали в течение 4 мин при комнатной температуре. Реакционную смесь упаривали досуха при комнатной температуре. Твердый остаток дважды упаривали с 5 мл толуола. Белый остаток очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода (0,05% TFA), скорость потока: 10,0 мл/мин, детектирование на длине волны λ=290 нм. Растворитель A: 95% воды, 5% метанола, 0,05% трифторуксусной кислоты. Растворитель B: 10% воды, 90% метанола, 0,05% трифторуксусной кислоты. Градиент: 0-5 мин 80% A; 5-10 мин 50% A; 10-20 мин 30% A; 20-50 мин 20% A. Собирали фракцию со временем удерживания 18,0 мин и выпаривали растворители в вакууме.

1,90 мг (25%) HDP 30.0678 в виде белого порошка; МС: 991,3 (M+H+).

1.6 Получение N1'-4-Boc-аминометилбензил-6'-O-метил-α-аманитина HDP 30.0683

8,90 мг (9,54 мкмоль) O-метил-α-метиламанитина растворяли в 500 мкл сухого ДМСО. Добавляли 21,4 мкл 1М раствора LiOH в воде. Реакционную смесь перемешивали при комнатной температуре в атмосфере аргона в течение 10 мин и в один прием добавляли 20,0 мг (78,40 мкмоль) 4-Boc аминобензилхлорида. Через 18 часов реакционную смесь гасили 100 мкл уксусной кислоты. ДМСО и воду удаляли в глубоком вакууме и очищали остаток на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода, скорость потока: 10,0 мл/мин, детектирование на длине волны λ=290 нм. Растворитель A: 95% воды, 5% метанола. Растворитель B: 5% воды, 95% метанола. Градиент: 0-5 мин 80% A; 5-10 мин 50% A; 10-20 мин 30% A; 20-50 мин 20% A. Собирали фракцию со временем удерживания 34 мин и выпаривали растворители в вакууме, получая HDP 30.0680 в виде белого остатка. МС: 1152,5 (M+H+). Полученный продукт использовали в следующей стадии.

HDP 30.0680 растворяли в 500 мкл трифторуксусной кислоты, перемешивали в течение 10 мин при комнатной температуре и упаривали досуха при комнатной температуре. Твердый остаток дважды упаривали совместно с 4 мл толуола. Полученный белый порошок очищали на системе LaPrep-HPLC: колонка Kromasil 100-C18, 10 мкм, 250×20 мм, элюент метанол/вода (0,05% TFA), скорость потока: 10,0 мл/мин, детектирование на длине волны λ=290 нм. Растворитель A: 95% воды, 5% метанола, 0,05% трифторуксусной кислоты. Растворитель B: 10% воды, 90% метанола, 0,05% трифторуксусной кислоты. Градиент: 0-5 мин 80% A; 5-10 мин 50% A; 10-20 мин 30% A; 20-50 мин 20% A. Собирали фракцию со временем удерживания 18,4 мин и выпаривали растворители в вакууме.

3,15 мг (31%) HDP 30.0683 в виде белого порошка. МС: 1052,4 (M+H+).

Пример 2: Синтез конъюгата аматоксина

Синтез конъюгата HDP 30.0378 Her-DSC-30.0378 [2.8]

1,0 мг HDP 30.0378 растворяли в 100 мкл сухого диметилформамида (ДМФА). В атмосфере аргона при перемешивании и при комнатной температуре за один прием добавляли 10,4 мкл раствора дигидроксисукцинимидокарбоната (DSC) в ДМФА (2,56 мг в 100 мкл ДМФА) и 2,1 мкл триэтиламина. Полученную реакционную смесь перемешивали при комнатной температуре. Через 12 часов добавляли 30 мл холодного диэтилового эфира. Осадок собирали, несколько раз промывали диэтиловым эфиром и высушивали в вакууме. Оставшееся твердое вещество растворяли в 200 мкл ДМФА, получая раствор A. 12,0 мг Герцептина растворяли в 4,0 мл фосфатного буферного солевого раствора (PBS, pH=7,4), получая раствор B. Раствор A и раствор B смешивали. Раствор, содержащий Герцептин и аманитин-линкер, встряхивали при 4°C в течение 14 ч и разделяли гель-фильтрационной хроматографией на Sephadex G-25 (колонка XK-16; 2 мл/мин). Колонку G-25 предварительно промывали 500 мл раствора PBS, pH=7,4. Фракцию конъюгата Her-DSC-30.0378 детектировали по поглощению УФ. Концентрацию белка определяли с помощью анализа RotiQuant-Assay (Carl Roth; Germany). Количество аманитина в полученном конъюгате с Герцептином определяли по поглощению УФ-излучения при A=280 нм и A=310 нм. Согласно расчету, содержание токсина составило 2,8 молекул аманитина на каждую молекулу Герцептина.

Пример 3: Цитотоксичность Her-DSC-30.0378 [2.8] в отношении HER-2-положительных линий опухолевых клеток in vitro.

Цитотоксическую активность Her-DSC-30.0378 [2.8] оценивали для HER-2-положительной линии опухолевых клеток SK-OV-3 (яичников) с помощью хемилюминисцентного анализа включения BrdU (Roche Diagnostics) in vitro. Выживаемость клеток определяли после 72 ч инкубирования с различными концентрациями Her-DSC-30.0378 [2.8] при 37°C и 5% CO2, путем измерения сигналов фиксированных клеток с нарушенной проницаемостью мембран, обработанных анти-BrdU-HRP антителами, с помощью считывающего устройства для микропланшетов BMG Labtech Optima. На основе полученной кривой доза-реакция вычисляли значения EC50 с помощью программы Graphpad Prism 4,0. Значение EC50 Her-DSC-30.0378 [2.8] для клеток SK-OV-3 составляло 4,1×10-11 М (смотрите фиг.2).

1. Конъюгат аматоксина формулы (I)

где:
R1 означает Н или ОН;
R2 означает Н или ОН;
R3 означает NH2 или ОН;
R4 означает ОН или OC1-6 алкил; и
R5 означает L-T, где L означает линкер; и Т означает мишень-связывающий фрагмент,
где указанный линкер представляет собой молекулу, которая связывает азот индольного кольца и Т, каждый из которых присоединен к одному концу линкера L, и где линкер имеет непрерывную цепь, включающую от 1 до 30 атомов, и
где указанный мишень-связывающий фрагмент представляет собой молекулу или часть молекулы, которая способна специфично связываться с молекулой-мишенью или эпитопом-мишенью.

2. Конъюгат аматоксина по п. 1, где линкер соединен с мишень-связывающим фрагментом через фрагмент мочевины.

3. Конъюгат аматоксина по п. 2, где мишень связывающий фрагмент соединен с линкером L через аминогруппу, имеющуюся в мишень-связывающем фрагменте, где указанная аминогруппа образует часть упомянутого фрагмента мочевины.

4. Конъюгат аматоксина по п. 1, где линкер имеет длину от 1 до 8 атомов, в том числе от 1 до 6 атомов, более конкретно от 1 до 4 атомов и наиболее конкретно от 2 до 4 атомов.

5. Конъюгат аматоксина по п. 2, где линкер имеет длину от 1 до 8 атомов, в том числе от 1 до 6 атомов, более конкретно от 1 до 4 атомов и наиболее конкретно от 2 до 4 атомов.

6. Конъюгат аматоксина по любому из пп. 1-5, где линкер L представляет собой необязательно замещенные алкилен, гетероалкилен, алкенилен, гетероалкенилен, алкинилен, гетероалкинилен, циклоалкилен, гетероциклоалкилен, арилен, гетероарилен, аралкилен, или гетероаралкиленовую группу.

7. Конъюгат аматоксина по любому из пп. 1-5, где линкер L включает фрагмент, выбранный из следующих фрагментов: фрагмент дисульфида, простого эфира, амина, сложного эфира, карбоксамида, уретана и мочевины.

8. Конъюгат аматоксина по п. 1, где мишень-связывающий фрагмент специфично связывается с эпитопом, который присутствует на опухолевых клетках, в том числе где мишень-связывающий фрагмент специфично связывается с эпитопом молекулы адгезии эпителиальных клеток (ЕрСАМ).

9. Конъюгат аматоксина по п. 2, где мишень-связывающий фрагмент специфично связывается с эпитопом, который присутствует на опухолевых клетках, в том числе где мишень-связывающий фрагмент специфично связывается с эпитопом молекулы адгезии эпителиальных клеток (ЕрСАМ).

10. Конъюгат аматоксина по п. 4, где мишень-связывающий фрагмент специфично связывается с эпитопом, который присутствует на опухолевых клетках, в том числе где мишень-связывающий фрагмент специфично связывается с эпитопом молекулы адгезии эпителиальных клеток (ЕрСАМ).

11. Конъюгат аматоксина по п. 5, где мишень-связывающий фрагмент специфично связывается с эпитопом, который присутствует на опухолевых клетках, в том числе где мишень-связывающий фрагмент специфично связывается с эпитопом молекулы адгезии эпителиальных клеток (ЕрСАМ).

12. Конъюгат аматоксина по п. 1, где мишень-связывающий фрагмент выбран из группы, состоящей из:
(i) антитела или его антиген-связывающего фрагмента;
(ii) антитело-подобного белка; и
(iii) аптамера нуклеиновой кислоты.

13. Конъюгат аматоксина по п. 12, где мишень-связывающий фрагмент представляет собой антитело или его антиген-связывающий фрагмент, выбранный из: диатела, тетратела, нанотела, химерного антитела, деиммунизированного антитела, гуманизированного антитела и человеческого антитела.

14. Конъюгат аматоксина по п. 12, где антиген-связывающий фрагмент выбран из группы, состоящей из Fab, F(ab′)2, Fd, Fv, одноцепочечного фрагмента Fv и Fvs с дисульфидными связями (dsFv).

15. Конъюгат аматоксина по п. 13, где антиген-связывающий фрагмент выбран из группы, состоящей из Fab, F(ab′)2, Fd, Fv, одноцепочечного фрагмента Fv и Fvs с дисульфидными связями (dsFv).

16. Конъюгат аматоксина по любому из пп. 1-5, 8-11 и 13-15 для применения в качестве лекарственного средства.

17. Конъюгат аматоксина по любому из пп. 1-5, 8-11 и 13-15 для применения в лечении ракового заболевания у пациента, где указанное раковое заболевание выбрано из группы, состоящей из рака поджелудочной железы, холангиокарциномы, рака груди, колоректального рака, рака легких, рака простаты, рака яичников, рака желудка, рака почек, злокачественной меланомы, лейкемии и злокачественной лимфомы.

18. Фармацевтическая композиция для лечения ракового заболевания, включающая терапевтически эффективное количество конъюгата аматоксина по любому из пп. 1-17 и дополнительно включающая один или несколько фармацевтически приемлемых разбавителей, носителей, эксципиентов, наполнителей, связующих веществ, смазывающих веществ, средств, способствующих скольжению, дезинтегрирующих средств, адсорбентов и/или консервантов.

19. Молекула конъюгации с аматоксином формулы (I), где
R1 означает Н или ОН;
R2 означает Н или ОН;
R3 означает NH2 или ОН;
R4 означает ОН или OC1-6 алкил, и
R5=L-X, где L означает линкер, и X представляет собой уходящую группу, которая может быть замещена нуклеофильной группой мишень-связывающего фрагмента,
где указанный линкер представляет собой молекулу, которая связывает азот индольного кольца и X, каждый из которых присоединен к одному концу линкера, и где линкер имеет непрерывную цепь, включающую от 1 до 30 атомов, и
где группа X выбрана из т-бутилокси, сукцинимидилокси, 1-O-сукцинимидилокси-3-сульфоната (сульфо-NHS), О-(4-нитрофенилокси), О-(3-нитрофенилокси), O-(2,4-динитрофенилокси), О-(2,4-дихлор-6-нитрофенилокси), пентафторфенилокси, пентахлорфенилокси, O-(2,4,5-трихлорфенилокси), О-(3,4-дигидро-3-гидрокси-4-оксо-1,2,3-бензотриазин-3-ила), О-(эндо-1-гидрокси-5-норборнен-2,3-дикарбоксимид-1-ила), 1-фталимидоилокси, 1-бензотриазолилокси, 1-(7-азабензотриазолил)окси и N-имидазолила.

20. Молекула конъюгации с аматоксином по п. 19, где X означает уходящую группу, которая может быть замещена первичной аминогруппой.

21. Молекула конъюгации с аматоксином по п. 19 или 20, где группа X выбрана из: т-бутилокси, сукцинимидилокси, 1-O-сукцинимидилокси-3-сульфоната (-сульфо-NHS), -О-(4-нитрофенилокси), -О-(3-нитрофенилокси), -O-(2,4-динтирофенилокси), -О-(2,4-дихлор-6-нитрофенилокси), -пентафторфенилокси, пентахлорфенилокси, -О-(2,4,5-трихлорфенилокси), -О-(3,4-дигидро-3-гидрокси-4-оксо-1,2,3-бензотриазин-3-ила), -О-(эндо-1-гидрокси-5-норборнен-2,3-дикарбоксимид-1-ила), 1-фталимидоилокси, -1-бензотриазолилокси, -1-(7-азабензотриазолил)окси и -N-имидазолила.

22. Способ синтеза конъюгата аматоксина по любому из пп. 1-17, включающий стадию взаимодействия молекулы конъюгации с аматоксином по любому из пп. 19-21 с мишень-связывающим фрагментом, включающим нуклеофильную группу.

23. Способ по п. 22, где указанная нуклеофильная группа представляет собой первичную аминогруппу.

24. Способ лечения ракового заболевания у пациента, включающий стадию введения указанному пациенту конъюгата аматоксина по любому из пп. 1-17 или фармацевтической композиции по п. 18.

25. Способ по п. 24, где указанное раковое заболевание выбрано из группы, состоящей из рака поджелудочной железы, холангиокарциномы, рака груди, колоректального рака, рака легких, рака простаты, рака яичников, рака желудка, рака почек, злокачественной меланомы, лейкемии и злокачественной лимфомы.



 

Похожие патенты:

Изобретение относится к области биотехнологии и медицины. Предложено новое октапептидное соединение общей формулы (I): H-2-Nal1-цикло(Cys2-Tyr3-AA4-Lys5-Val6-Cys7)-Thr8-NH2.

Настоящее изобретение относится к области биотехнологии, конкретно к цикличным пептидам из TNF, и может быть использовано в медицине. Цикличный пептид, состоящий из последовательности CGQRETPEGAEAKPWYC, используют для получения лекарственного средства для профилактики или лечения сосудистых осложнений у пациентов с диабетом, в том числе в составе фармацевтической композиции.

Изобретение относится к соединению, выбранному из группы, состоящей из соединений, представленных формулой В указанной формуле R1 представляет собой S-Alk-R, где Alk представляет собой метилен, C2-C6 полиметиленовую связь или C3-C6 алкениленильную связь, R представляет собой -N=C(NR3R4)(NR5R6) или -NR7[(NR3R4)C=NR5], или -N=C(R8)(NR9R10), где R3-R10 представляет собой H, Alk, Ar или (CH2)nAr, где Ar представляет собой арильную группу, и n представляет собой целое число от 1 до 13, или R3 и R4, или R4 и R5, или R5 и R7, или R3 и R7, или R9 и R10, или R8 и R9 вместе могут представлять собой -(CH2)x-, где x представляет собой целое число от 2 до 5, и R2 выбран из группы, состоящей из гидроксила, алкила, имеющего от 1 до 7 атомов углерода, и замещенного гидроксилом алкила, имеющего от 1 до 7 атомов углерода.

Изобретение относится к аналогам циклоспорина, обладающим противовирусной активностью в отношении ВГС, их фармацевтическим композициям и способу лечения вирусной инфекции у субъекта.

Изобретение относится к соединению и его фармацевтически приемлемой соли, предназначенному для использования в качестве противогрибкового средства, в частности терапевтического средства против глубокого микоза.

Изобретение относится к биологически активным пептидам, способным ингибировать киназу легких цепей миозина и тем самым регулировать изменение проницаемости сосудистого эндотелия.

Изобретение относится к области биоорганической химии, в частности к алифатическим производным трипептидов, полярная часть которых состоит из аминокислотных последовательностей OrnOrnGlu, LysLysGlu, OrnLysGlu, LysOrnGlu, а гидрофобная часть представлена остатками спиртов с длиной цепи C8-C16, и способу их получения.

Предложенная группа изобретений относится к области медицины. Предложена система доставки для замедленного высвобождения агента, блокирующего кальциевые каналы, содержащая твердый дисперсный продукт агента, блокирующего кальциевые каналы, в смеси с поли(лактид-ко-гликолидами), где массовое соотношение первого поли(лактид-ко-гликолида) и второго поли(лактид-ко-гликолида) составляет от 10:1 до 1:1,5.

Изобретение относится к области биотехнологии, конкретно к получению пегилированного конъюгата варианта рекомбинантного консенсусного интерферона, и может быть использовано в медицине.

Изобретение относится к фармацевтической промышленности и представляет собой композицию для лечения грибка ногтей, состоящую по существу из от 5 до 15 масс. % лимонной кислоты в качестве источника протонов, от 15 до 40 масс.

Изобретение относится к области иммунологии и биотехнологии. Описан иммуноконъюгат для лечения опухолевых расстройств, связанных с мезотелином.

Изобретение относится к биотехнологии, а именно к комплексу, для применения в способе адъювантной терапии у нуждающегося в таком лечении пациента, а также к вакцине, которая включает данный комплекс.

Изобретение относится к биотехнологии, в частности к получению противоопухолевых лекарственных средств для генной терапии, и может быть использовано в медицине. Получают лекарственное противоопухолевое средство, содержащее генную конструкцию в форме плазмидной ДНК, включающей гены тимидинкиназы вируса простого герпеса (HSVtk) и гранулоцитарно-макрофагального колониестимулирующего фактора (GM-CSF), заключенную в полимерный носитель - сополимер полиэтиленгликоль-полиэтиленимин-тat пептид (ПЭГ-ПЭИ-ТАТ).

Группа изобретений относится к конъюгату инсулин-линкер D-L или его фармацевтически приемлемой соли, где D представляет собой фрагмент инсулина и -L является биологически неактивным линкерным фрагментом -L1, представленным формулой (I), где пунктирная линия указывает на место присоединения к одной из аминогрупп инсулина путем образования амидной связи.

Изобретение относится к конъюгатам, в частности представлен никотиновый гаптен-носитель формулы (III): W представляет собой -О- и находится в положении 5 пиридинового кольца; -(спейсер)- представляет собой С1-С8алкиленовую группу, С3-С10циклоалкиленовую группу или С1-С12алкиленовую группу, прерванную 1-4 атомами кислорода и возможно прерванную группой -N(H)C(O)-; X* представляет собой -NH- или -S-; m означает 1; n означает целое число от 1 до 1000; и Y представляет собой возможно модифицированный белок-носитель, выбранный из бактериальных анатоксинов, иммуногенных веществ, вирусов, вирусоподобных частиц, белковых комплексов, белков, полипептидов, липосом и иммуностимулирующих комплексов, которые могут быть использованы для приготовления вакцин для лечения и/или предупреждения никотиновой зависимости.

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Изобретение относится к циклическим тетрапептидам формулы I, их фармацевтическим композициям, способу получения тетрапептидов формулы I и набору, содержащему соединения формулы I.

Изобретение относится к конъюгатам аматоксина и мишень-связывающего фрагмента, например антитела, соединенных связями определенного типа, которые применимы в лечении рака, и к фармацевтическим композициям, включающим такие конъюгаты. 5 н. и 20 з.п. ф-лы, 2 ил., 3 пр.

Наверх