Пролекарства, содержащие конъюгат инсулина и линкера



Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера
Пролекарства, содержащие конъюгат инсулина и линкера

 


Владельцы патента RU 2574667:

САНОФИ-АВЕНТИС ДОЙЧЛАНД ГМБХ (DE)

Группа изобретений относится к конъюгату инсулин-линкер D-L или его фармацевтически приемлемой соли, где D представляет собой фрагмент инсулина и -L является биологически неактивным линкерным фрагментом -L1, представленным формулой (I), где пунктирная линия указывает на место присоединения к одной из аминогрупп инсулина путем образования амидной связи. Изобретение также относится к фармацевтическим композициям, содержащим указанные конъюгаты, способам получения, а также к их использованию в качестве лекарственного средства для лечения или предотвращения заболеваний или нарушений, которые можно лечить инсулином. Группа изобретений обеспечивает снижение частоты инъекций и сохранение возможности оптимального контроля уровней инсулина и глюкозы в крови. 13 н. и 52 з.п. ф-лы, 21 пр., 9 ил.

 

Настоящее изобретение относится к пролекарствам, фармацевтическим композициям, содержащим указанные пролекарства, а также к их применению в качестве лекарственного средства для лечения или предотвращения заболеваний или нарушений, которые можно лечить инсулином.

Инсулинотерапия диктуется высокой необходимостью поддержать высвобождение инсулинового лекарственного средства на очень строгом уровне, поскольку терапевтическое окно является узким, и вредные эффекты гиперинсулинемии потенциально могут представлять угрозу для жизни. Многочисленные инсулиновые препараты запущены в серийное производство с различными профилями действия, чтобы удовлетворить отдельным требованиям популяции, страдающей диабетом. Быстродействующие инсулиновые аналоги вводят непосредственно перед едой, чтобы контролировать максимальный уровень глюкозы в плазме после переваривания пищи, в то время как аналоги инсулина длительного действия обычно дают один или два раза в день для достижения постоянного базального уровня инсулина.

В связи с этим существует очевидная потребность в новых препаратах инсулина длительного действия, которые постоянно высвобождают инсулин за весь период между введениями.

WO-A 2006/003014 описывает гидрогель, способный высвобождать инсулин с возможностью уменьшения частоты дозирования по сравнению со стандартными ежедневными инъекциями базального инсулина. Однако инсулин высвобождается со скоростью, слишком быстрой для обеспечения строгого контроля инсулинотропного действия в течение периодов продолжительностью в 2 дня. В действительности, инсулин высвобождается с периодом полужизни, составляющим приблизительно 30 часов, что означает, что пролекарство должно вводиться по меньшей мере каждые 30 часов для того, чтобы отношение максимума к самой низшей точке кривой составляло ниже 2 при состоянии равновесия.

Концепция приготовления обратимого конъюгата полимера и пролекарства инсулина была представлена Shechter et al. и описана в научных статьях и патентных заявках (например, European Journal of Pharmaceutics and Biopharmaceutics 2008(70), 19-28 и WO-A 2004/089280). Инсулин конъюгирован с ПЭГ-полимером 40 кДа посредством линкера флуоренила. Гидролиз молекулы указанного линкера высвобождает инсулин с периодом полужизни, составляющим приблизительно 30 часов, что означает, что пролекарство должно вводиться по меньшей мере каждые 30 часов, чтобы отношение максимума к низшей точке кривой составляло менее 2 при состоянии равновесия.

Были предприняты и другие попытки снизить частоту дозирования инсулина. Исследователь Hinds et al., Journal of Controlled Release, 2005 (104), 447-460, описал способ продуцирования инсулина один раз в неделю вначале путем осуществления прочного ПЭГилирования молекулы инсулина и затем микрокапсулирования ПЭГилированного инсулина в микрочастицы PLGA. В данном случае инсулин был подвергнут существенной структурной модификации посредством устойчивой модификации высокомолекулярным полимерным продуктом. Такие модифицированные высокомолекулярными соединениями инсулины могут обладать пониженной эффективностью вследствие снижения связывания с рецептором и также могут проявлять реакции в месте введения, такие как липоатрофия, в результате длительного присутствия высоких концентраций инсулина, модифицированного высокомолекулярным полимером, в подкожной ткани. Кроме того, такие ПЭГилированные инсулины будут иметь более низкий объем распределения, который представляет особый недостаток в лечении диабета.

Однако ПЭГилирование инсулина, очевидно, служит для того, чтобы защитить пептид от деградации в PLGA-полимерной композиции. Эффект ПЭГилирования для защиты пептидов от ацилирования при деградации PLGA-композиции был продемонстрирован для октреотида D. H. Na et al., AAPS PharmSciTech 2003, 4 (4) Article 72.

Было показано, что PLGA-капсулирование белков вызывает побочные реакции сложных эфиров полимеров с аминогруппами пептида или белка. Продукты ацилирования молочной кислоты наблюдали после воздействия на композиции буферными растворами при нейтральном рН (G. Zhu et al., Nature Biotechnology 18 (2000) 52-57; A.J. Domb et al., Pharm. Res. 11 (1994) 865-868; A. Lucke et al., Pharm. Res. 19 (2002) 175-181).

Специально для инсулина были продемонстрированы вредные действия полимерных препаратов P.G. Shao et al., Pharm. Dev. Technol. 4 (1999) 633-642 (см. также P.G. Shao et al., Pharm. Dev. Technol. 5 (2000) 1-9).

Кроме того, известно, что инсулин легко претерпевает побочные реакции, которые связаны с присутствием трех дисульфидных мостиков в молекуле. Например, А- и В-цепи инсулина могут быть расщеплены путем разрыва дисульфидной связи, или димеры или олигомеры могут быть образованы в результате реакций дисульфидного обмена. Такая дисульфидная перегруппировка является особенно вероятной, если молекулы инсулина вынуждены вступать в близкий контакт хаотически. Такая характерная лабильность молекулы инсулина существенно тормозит прогресс развития препарата-депо длительного действия и препятствует использованию других полимерных препаратов, где инсулин капсулирован в некотором смысле подобно аморфному преципитату, который, как хорошо известно, приводит к образованию различных продуктов разложения, возникающих в результате обширного дисульфидного обмена.

Из представленных выше данных следует, что сохраняется проблема разработки препарата инсулина длительного действия без нарушения фармакодинамики инсулина путем прочного присоединения высокомолекулярной структуры или путем создания повреждения структуры молекулы в течение ее присутствия в депо.

Таким образом, задача настоящего изобретения состоит в предоставлении пролекарства, содержащего инсулин, которое соответствует, по меньшей мере частично, описанным выше требованиям.

Задача изобретения решается за счет получения пролекарства или его фармацевтически приемлемой соли, содержащих конъюгат инсулина и линкера D-L, где

D представляет собой фрагмент инсулина; и

-L является биологически неактивным линкерным фрагментом -L1, представленным формулой (I)

где пунктирная линия указывает на присоединение к одной из аминогрупп инсулина с образованием амидной связи;

X является C(R3R3a) или N(R3);

R1a, R3a независимо выбирают из группы, содержащей H, NH(R2b), N(R2b)C(O)R4 и C1-4алкил;

R1, R2, R2a, R2b, R3, R4 независимо выбирают из группы, содержащей H и C1-4алкил,

где фрагмент L1 замещен одним элементом L2-Z и необязательно дополнительно замещен при условии, что водород, помеченный звездочкой в формуле (I), не заменен заместителем, и где

L2 является простой химической связью или спейсером; и

Z является гидрогелем.

В ходе данной работы неожиданно было обнаружено, что пролекарство согласно настоящему изобретению может достичь высвобождения инсулина из подкожного депо в структурно интактной форме в течение периодов времени, составляющих по меньшей мере 2 дня между введениями. Поскольку дальнейшее преимущество структурной целостности высвобожденного инсулина может быть достигнуто с помощью хорошо гидратированного полимерного матрикса, сведение до минимума межмолекулярного контакта молекул инсулина и замедленное высвобождение могут быть возможны благодаря внутреннему расщеплению линкера пролекарства между инсулином и полимерным матриксом.

Таким образом, должно стать возможным вводить инсулин в виде пролекарства согласно настоящему изобретению менее часто, чем обычные инсулины длительного действия. Другими преимуществами должны стать малые величины отношения максимальной к минимальной концентрации, которые в значительной степени снижают риск гипогликемических эпизодов. Такое введение поможет больным снизить частоту инъекций, в то же время сохранить возможность оптимального контроля уровней инсулина в плазме и следовательно глюкозы в крови.

“Инсулин” согласно настоящему изобретению означает рекомбинантный человеческий инсулин, лантус, инсулин гларгин, инсулин детемир, инсулин глулизин, инсулин аспарт, лизпро-инсулин, инсулин, конъюгированный с низкомолекулярным ПЭГ. Низкомолекулярный ПЭГ имеет молекулярную массу менее 10 кДа.

Инсулин, связанный с биологически неактивным линкером, имеет название “фрагмент инсулина”.

Под “аналогом инсулина”, как используют в описании, подразумевают полипептид, имеющий молекулярную структуру, которая формально может быть произведена из структуры природного инсулина, например структуры человеческого инсулина, путем делеции и/или обмена по меньшей мере одного аминокислотного остатка, встречающегося в природном инсулине, и/или добавления по меньшей мере одного аминокислотного остатка. Добавленные и/или обмененные аминокислотные остатки либо могут быть кодируемыми аминокислотными остатками, либо другими природными остатками или чисто синтетическими аминокислотными остатками.

Аналоги инсулина могут быть такими, у которых положение 28 В-цепи может быть модифицировано от природного остатка Pro до одного из Asp, Lys или Ile. В другом аспекте, Lys в положении B29 модифицирован до Pro. Также, Asn в положении A21 может быть модифицирован до Ala, Gln, Glu, Gly, His, Ile, Leu, Met, Ser, Thr, Trp, Tyr или Val, в частности до Gly, Ala, Ser, или Thr и предпочтительно до Gly. Кроме того, Asn в положении B3 может быть модифицирован до Lys или Asp. Другими примерами аналогов инсулина являются дес(B30) человеческий инсулин; аналоги дес(B30) человеческого инсулина; инсулиновые аналоги, у которых PheB1 был исключен; инсулиновые аналоги, у которых A-цепь и/или B-цепь имеет N-концевое удлинение, и инсулиновые аналоги, у которых A-цепь и/или В-цепь имеет C-концевое удлинение. Таким образом, один или два остатка Arg могут быть добавлены в положение B1.

Относительно “десВ30 инсулина”, “десВ30 человеческий инсулин” означает природный инсулин или его аналог с отсутствующим В30 аминокислотным остатком. Аналогично, “десВ29десВ30 инсулин” или “десВ29десВ30 человеческий инсулин” означает природный инсулин или его аналог с отсутствующими В29 и В30 аминокислотными остатками.

Под “В1”, “А1” и т.д. подразумевают аминокислотный остаток в положении 1 в В-цепи инсулина (считая от N-концевой области) и аминокислотный остаток в положении 1 в А-цепи инсулина (считая от N-концевой области), соответственно. Аминокислотный остаток в специфическом положении также может быть обозначен как, например, PheB1, который означает, что аминокислотный остаток в положении В1 является остатком фенилаланина.

“Биологически неактивный линкер” означает линкер, который не проявляет фармакологические эффекты лекарственного средства, произведенного из биологически активного агента.

Термин “защитные группы” относится к фрагменту, который временно защищает химическую функциональную группу молекулы в процессе синтеза для достижения хемоселективности в последующих химических реакциях. Защитными группами для спиртов являются, например, бензил и тритил, защитными группами для аминов являются, например, трет-бутилоксикарбонил, 9-флуоренилметилоксикарбонил и бензил, и для тиолов примерами защитных групп являются 2,4,6-триметоксибензил, фенилтиометил, ацетамидометил, пара-метоксибензилоксикарбонил, трет-бутилтио, трифенилметил, 3-нитро-2-пиридилтио, 4-метилтритил.

Термин “защищенные функциональные группы” означает функциональную группу с определенными химическими свойствами, защищенную защитной группой.

“Ацилирующее средство” означает фрагмент структуры R-(C=O)-, предоставляющий ацильную группу в реакции ацилирования, необязательно соединенный с уходящей группой, такой как хлорангидрид, N-гидроксисукцинимид, пентафторфенол и пара-нитрофенол.

“Алкил” означает прямую или разветвленную углеродную цепь. Любой водород у углерода алкила может быть заменен заместителем.

“Арил” относится к любому заместителю, произведенному от моноциклического или полициклического или конденсированного ароматического кольца, включая гетероциклические кольца, например, фенил, тиофен, индолил, нафтил, пиридил, которое необязательно может быть также замещенным.

“Ацил” означает функциональную группу с определенными химическими свойствами структуры R-(C=O)-, где R является алкилом или арилом.

“C1-4алкил” означает алкильную цепь, содержащую 1-4 атома углерода, например, если присутствует на конце молекулы: метил, этил, н-пропил, изопропил, н-бутил, изобутил, втор-бутил, трет-бутил, или, например, -CH2-, -CH2-CH2-, -CH(CH3)-, -CH2-CH2-CH2-, -CH(C2H5)-, -C(CH3)2-, когда два фрагмента молекулы связаны алкильной группой. Любой водород у углерода C1-4алкила может быть заменен заместителем.

“C1-6алкил” означает алкильную цепь, содержащую 1-6 атомов углерода, например, если присутствует на конце молекулы: C1-4алкил, метил, этил, н-пропил, изопропил, н-бутил, изобутил, втор-бутил; трет-бутил, н-пентил, н-гексил, или, например, -CH2-, -CH2-CH2-, -CH(CH3)-, -CH2-CH2-CH2-, -CH(C2H5)-, -C(CH3)2-, когда два фрагмента молекулы связаны алкильной группой. Любой водород у углерода C1-6алкила может быть заменен заместителем.

Соответственно, “C1-18алкил” означает алкильную цепь, содержащую от 1 до 18 атомов углерода, и “C8-18алкил” означает алкильную цепь, содержащую от 8 до 18 атомов углерода. Соответственно, “C1-50алкил” означает алкильную цепь, содержащую от 1 до 50 атомов углерода.

“C2-50алкенил” означает разветвленную или неразветвленную алкенильную цепь, содержащую от 2 до 50 атомов углерода, например, если присутствует на конце молекулы: -CH=CH2, -CH=CH-CH3, -CH2-CH=CH2, -CH=CH-CH2-CH3, -CH=CH-CH=CH2, или, например, -CH=CH-, когда два фрагмента молекулы соединены алкенильной группой. Любой водород у углерода C2-50алкенила может быть заменен заместителем, как указано далее. Соответственно, термин “алкенил” относится к углеродной цепи по меньшей мере с одной углерод-углеродной двойной связью. Необязательно, одна или более тройные связи могут присутствовать.

“C2-50алкинил” означает разветвленную или неразветвленную алкинильную цепь, содержащую от 2 до 50 атомов углерода, например, если присутствует на конце молекулы: -C≡CH, -CH2-C≡CH, CH2-CH2-C≡CH, CH2-C≡C-CH3, или, например, -C≡C-, когда два фрагмента молекулы соединены алкинильной группой. Любой водород у углерода C2-50алкинила может быть заменен заместителем, как указано далее. Соответственно, термин алкинил” относится к углеродной цепи по меньшей мере с одной углерод-углеродной тройной связью. Необязательно, одна или более двойные связи могут присутствовать.

“C3-7циклоалкил” или “C3-7циклоалкильное кольцо” означает циклическую алкильную цепь, содержащую от 3 до 7 атомов углерода, которая может включать углерод-углеродные двойные связи, будучи по меньшей мере частично насыщенными, например, циклопропил, циклобутил, циклопентил, циклогексил, циклогексенил, циклогептил. Любой водород у углерода циклоалкила может быть заменен заместителем. Термин “C3-7циклоалкил” или “C3-7циклоалкильное кольцо” также включает бициклы, соединенные мостиковой связью подобно норбонану или норбонену. Соответственно, “C3-5циклоалкил” означает циклоалкил, содержащий от 3 до 5 атомов углерода.

Соответственно, “C3-10циклалкил” означает циклический алкил, содержащий от 3 до 10 атомов углерода, например, C3-7циклоалкил; циклопропил, циклобутил, циклопентил, циклогексил, циклогексенил, циклогептил, циклооктил, циклононил, циклодецил. Термин “C3-10циклоалкил” также включает по меньшей мере частично насыщенные карбомоно- и бициклы.

“Галоген” означает фтор, хлор, бром или йод. В большинстве случаев предпочтительно, когда галогеном является фтор или хлор.

“4-7-членный гетероциклил” или “4-7-членный гетероцикл” означает кольцо с 4, 5, 6 или 7 атомами в кольце, которое может содержать вплоть до максимального числа двойные связи (ароматическое или неароматическое кольцо, которое полностью насыщено, частично насыщено или не насыщено), где по меньшей мере от одного кольцевого атома до 4 атомов в кольце заменены гетероатомом, выбранным из группы, состоящей из серы (включая -S(O)-, -S(O)2-), кислорода и азота (включая =N(O)-), и где кольцо связано с остальной частью молекулы через атом углерода или азота. Примерами 4-7-членных гетероциклов являются азетидин, оксетан, тиетан, фуран, тиофен, пиррол, пирролин, имидазол, имидазолин, пиразол, пиразолин, оксазол, оксазолин, изоксазол, изоксазолин, тиазол, тиазолин, изотиазол, изотиазолин, тиадиазол, тиадиазолин, тетрагидрофуран, тетрагидротиофен, пирролидин, имидазолидин, пиразолидин, оксазолидин, изоксазолидин, тиазолидин, изотиазолидин, тиадиазолидин, сульфолан, пиран, дигидропиран, тетрагидропиран, имидазолидин, пиридин, пиридазин, пиразин, пиримидин, пиперазин, пиперидин, морфолин, тетразол, триазол, триазолидин, тетразолидин, диазепан, азепин или гомопиперазин.

“9-11-членный гетеробициклил” или “9-11-членный гетеробицикл” означает гетероциклическую систему из двух колец, содержащую 9-11 кольцевых атомов где по меньшей мере один атом в кольце является общим для обоих колец, и которые могут содержать вплоть до максимального числа двойных связей (ароматическое или неароматическое кольцо, которое является полностью насыщенным, частично насыщенным или ненасыщенным), где по меньшей мере от одного кольцевого атома до 6 кольцевых атомов заменены гетероатомом, выбранным из группы, состоящей из серы (включая -S(O)-, -S(O)2-), кислорода и азота (включая =N(О)-), и где кольцо связано с остальной частью молекулы через атом углерода или азота. Примерами 9-11-членного гетеробицикла являются индол, индолин, бензофуран, бензотиофен, бензоксазол, бензизоксазол, бензотиазол, бензизотиазол, бензимидазол, бензимидазолин, хинолин, хиназолин, дигидрохиназолин, хинолин, дигидрохинолин, тетрагидрохинолин, декагидрохинолин, изохинолин, декагидроизохинолин, тетрагидроизохинолин, дигидроизохинолин, бензазепин, пурин или птеридин. Термин «9-11-членный гетеробицикл» также включает спиро-структуры из двух колец, подобные 1,4-диокса-8-азаспиро[4.5]декану или гетероциклам, соединенным мостиковой связью подобно 8-азабицикло[3.2.1]октану.

В случае инсулиновых пролекарств, включающих соединения согласно формуле (I), которые содержат одну или более кислотных или основных групп, изобретение также включает их соответствующие фармацевтически или токсикологически приемлемые соли, в частности, их фармацевтически пригодные соли. Таким образом, инсулиновые пролекарства, включающие соединения формулы (I), которые содержат кислотные группы, могут быть использованы согласно изобретению, например, в виде солей щелочных металлов, солей щелочноземельных металлов или аммониевых солей. Более определенные примеры таких солей включают натриевые соли, калиевые соли, кальциевые соли, магниевые соли и соли с аммиаком или органическими аминами, такими как, например, этиламин, этаноламин, триэтаноламин или аминокислоты. Инсулиновые пролекарства, включающие соединения формулы (I), которые содержат одну или более основных групп, т.е. группы, которые могут быть протонированы, могут присутствовать и могут быть использованы согласно изобретению в виде их аддитивных солей с неорганическими или органическими кислотами. Примеры таких кислот включают хлористоводородную кислоту, бромистоводородную кислоту, фосфорную кислоту, серную кислоту, азотную кислоту, метансульфокислоту, пара-толуолсульфокислоту, нафталиндисульфокислоту, щавелевую кислоту, уксусную кислоту, винную кислоту, молочную кислоту, салициловую кислоту, бензойную кислоту, муравьиную кислоту, пропионовую кислоту, триметилуксусную кислоту, диэтилуксусную кислоту, малоновую кислоту, янтарную кислоту, пимелиновую кислоту, фумаровую кислоту, малеиновую кислоту, яблочную кислоту, сульфаминовую кислоту, фенилпропионовую кислоту, глюконовую кислоту, аскорбиновую кислоту, изоникотиновую кислоту, лимонную кислоту, адипиновую кислоту и другие кислоты, известные специалисту в данной области. Если инсулиновые пролекарства, включающие соединения формулы (I), одновременно содержат кислотные и основные группы в молекуле, изобретение также включает, кроме указанных выше солевых форм, внутренние соли или бетаины (цвиттерионы). Соответствующие соли сообразно с инсулиновыми пролекарствами, включающими соединения формулы (I), могут быть получены общепринятыми способами, известными специалисту в данной области, подобными, например, способу, включающему взаимодействие их с органической или неорганической кислотой или основанием в растворителе или диспергирующем средстве или анионный обмен или катионный обмен с другими солями. Настоящее изобретение также включает все соли инсулиновых пролекарств, содержащих соединения формулы (I), которые из-за их низкой физиологической совместимости не используются прямо в качестве фармацевтических препаратов, но которые могут быть использованы, например, в качестве промежуточных соединений для химических реакций или для приготовления фармацевтически приемлемых солей.

Для того чтобы усилить физико-химические или фармакокинетические свойства лекарственного средства, такого как инсулин, in vivo, такое лекарственное средство может быть конъюгировано с носителем. Если лекарственное средство временно связано с носителем и/или линкером, такие системы обычно обозначают как связанные с носителем пролекарства. Согласно определениям, предоставленным IUPAC (как дано согласно http://www.chem.qmul.ac.uk/iupac.medchem, доступного с 22 июля 2009), связанное с носителем пролекарство является пролекарством, которое содержит временную связь данного активного вещества с неустойчивой группой носителя, образование которой способствует улучшению физико-химических и фармакокинетических свойств и которая может быть легко удалена in vivo, обычно путем гидролитического расщепления.

Линкеры, используемые в таких пролекарствах, связанных с носителем, являются временными, что означает, что они гидролитически разрушаются (расщепляются) неферментативным путем при физиологических условиях (водный буфер при рН 7,4, 37°C) с периодами полужизни, колеблющимися, например, от одного часа до трех месяцев.

Подходящими носителями являются полимеры, и они могут быть либо непосредственно конъюгированы с линкером, либо через нерасщепляемый спейсер. Термин “пролекарство инсулина с гидрогелем” относится к связанным с носителем пролекарствам инсулина, где носителем является гидрогель. Термины “пролекарство с гидрогелем” и “гидрогельсвязанное пролекарство” относятся к пролекарствам биологически активных средств, временно связанных с гидрогелем, и используются как синонимы. “Гидрогель” может быть определен как трехмерная, гидрофильная или амфифильная полимерная сетка, проявляющая способность поглощать большие количества воды. Сетки состоят из гомополимеров или сополимеров, являются нерастворимыми вследствие присутствия ковалентных химических или физических (ионных, гидрофобных взаимодействий, переплетений) поперечных связей. Поперечные связи обеспечивают сетчатую структуру и физическую целостность. Гидрогели имеют термодинамическую совместимость с водой, что позволяет им набухать в водных средах. Цепи сетки соединены таким образом, что образуются поры и что существенная часть данных пор имеет размеры между 1 нм и 1000 нм.

“Свободная форма” лекарственного средства относится к лекарственному средству в его немодифицированной, фармакологически активной форме, такой как форма после высвобождения средства из полимерного конъюгата.

Термины “лекарственное средство”, “биологически активная молекула”, “биологически активный фрагмент”, “биологически активное средство”, “активное средство” и тому подобные означают любое вещество, которое может воздействовать на любые физические или биохимические свойства биологического организма, включающего, но не ограничивающегося ими, вирусы, бактерии, грибы, растения, животные и людей. В частности, как используют в описании, биологически активные молекулы включают любое вещество, предназначенное для диагностики, устранения, ослабления, лечения или предотвращения заболевания у людей или других животных, или иначе повысить физическое или психическое здоровье людей или животных. Точнее, термины “лекарственное средство”, “биологически активная молекула”, “биологически активный фрагмент”, “биологически активное средство”, “активное средство” и тому подобные относятся к инсулину.

“Терапевтически активное количество” инсулина, как используют в описании, означает количество, достаточное для устранения, ослабления или частичного подавления клинических проявлений данного заболевания и его осложнений. Количество, достаточное для достижения указанных целей, определяют как “терапевтически эффективное количество”. Эффективные количества для каждой цели будут зависеть от тяжести заболевания или повреждения, а также массы тела и общего состояния субъекта. Понятно, что определение соответствующей дозировки может быть достигнуто посредством обычного эксперимента, путем построения матрицы величин и тестирования различных точек в матрице, которые находятся в компетенции квалифицированного врача.

“Стабильные” и “стабильность” означает, что в течение указанного времени хранения конъюгаты гидрогеля остаются конъюгированными и не гидролизуются в значительной степени и имеют приемлемый состав примесей относительно инсулина. Для того чтобы считаться стабильной, композиция должна содержать менее чем 5% лекарственного средства в его свободной форме.

Термин “фармацевтически приемлемый” означает, что он утвержден надзорным органом, таким как EMEA (Европа), и/или FDA (США), и/или любым другим национальным надзорным органом для использования у животных, предпочтительно у людей.

“Фармацевтическая композиция” или “композиция” означает один или более активных ингредиентов, а также любой продукт, который произведен, прямо или непрямо, в результате комбинирования, комплексообразования или агрегирования любых двух или более ингредиентов, или диссоциации одного или более ингредиентов, или в результате других типов реакций или взаимодействий одного или более ингредиентов. Соответственно, фармацевтические композиции настоящего изобретения охватывают любую композицию, приготовленную путем смешивания соединения согласно настоящему изобретению и фармацевтически приемлемого наполнителя (фармацевтически приемлемого носителя).

“Сухая композиция” означает, что композиция пролекарства инсулина с гидрогелем предоставлена в сухом виде в контейнере. Подходящими способами сушки являются сушка распылением и лиофилизация (сушка вымораживанием). Такая сухая композиция пролекарства инсулина с гидрогелем имеет остаточное содержание воды, составляющее максимум 10%, предпочтительно менее 5% и более предпочтительно менее 2% (определено согласно методу Карла Фишера). Предпочтительным способом сушки является лиофилизация. “Лиофилизированная композиция” означает, что композиция пролекарства инсулина с гидрогелевым полимером вначале была заморожена и затем подвергнута обработке путем снижения давления для уменьшения количества воды. Указанная терминология не исключает дополнительные стадии сушки, которые имеют место в процессе производства до заполнения композицией конечного контейнера.

“Лиофилизация” (сушка вымораживанием) представляет собой процесс дегидратации, характеризующийся замораживанием композиции и затем снижением окружающего давления и, необязательно, подведением тепла, чтобы позволить замороженной в композиции воде сублимировать прямо из твердой фазы в газообразную. Обычно сублимированную воду собирают десублимацией.

“Восстановление” означает добавление жидкости для восстановления первоначальной формы композиции.

“Раствор для восстановления” относится к жидкости, используемой для восстановления сухой композиции пролекарства инсулина с гидрогелем для введения больному по необходимости.

“Контейнер” означает любой контейнер, в котором композиция пролекарства инсулина с гидрогелем содержится и может храниться до реконструкции.

“Буфер” или “буферное средство” относится к химическим соединениям, которые поддерживают рН в желаемой области. Физиологически допустимыми буферами являются, например, фосфат натрия, сукцинат, гистидин, бикарбонат, цитрат и ацетат, сульфат, нитрат, хлорид, пируват. Антациды, такие как Mg(OH)2 или ZnCO3, также могут быть использованы. Буферную способность можно регулировать, чтобы подобрать условия, наиболее чувствительные к рН-стабильности.

Термин “наполнители” относится к соединениям, вводимым вместе с терапевтическим средством, например, буферные средства, модифицирующие изотоничность вещества, консерванты, стабилизирующие вещества, противопоглощающие средства, средства, защищающие от окисления, или другие дополнительные средства. Однако в некоторых случаях один наполнитель может иметь двойную или тройную функции.

“Лиопротектант” является молекулой, которая при комбинировании с интересующим белком существенно предотвращает или снижает химическую и/или физическую нестабильность белка при сушке вообще и, особенно, в течение лиофилизации и последующего хранения. Примеры средств, защищающих при сушке, включают сахара, такие как сахароза или трегалоза; аминокислоты, такие как аргинин, глицин, глутамат или гистидин; метиламины, такие как бетаин; соли с лиотропным действием, такие как сульфат магния; полиолы, такие как трехатомные или высшие сахарные спирты, например, глицерин, эритрит, глицерол, арабит, ксилит, сорбит и маннит; этиленгликоль; пропиленгликоль; полиэтиленгликоль; плюроник; гидроксиалкиловые крахмалы, например, гидроксиэтилкрахмал (HES), и их комбинации.

“Поверхностно-активное вещество” относится к смачивающим средствам, которые снижают поверхностное натяжение жидкости.

“Изменяющие изотоничность средства” относятся к соединениям, снижающим до минимума боль, которая может возникать в результате повреждения клетки из-за разницы в осмотическом давлении при инъекции депо-препарата.

Термин “стабилизирующие средства” относится к соединениям, используемым для стабилизации полимерного пролекарства. Стабилизация достигается путем упрочнения сил, стабилизирующих белок, путем дестабилизации состояния денатурации или путем прямого связывания наполнителей с белком.

“Противопоглощающие средства” относится, главным образом, к ионным или неионным поверхностно-активным веществам или другим белкам или растворимым полимерам, используемым, чтобы покрыть или адсорбироваться конкурентно на внутренней поверхности контейнера с композицией. Выбранная концентрация и тип наполнителя зависят от эффекта, которого следует избегать, но обычно монослой поверхностно-активного вещества образуется у поверхности раздела как раз выше величины CMC.

“Средства, защищающие от окисления” относится к антиоксидантам, таким как аскорбиновая кислота, эктоин, глутатион, метионин, тиоглицерин, морин, полиэтиленимин (PEI), пропилгаллат, витамин E, хелатирующим средствам, таким как лимонная кислота, ЭДТА, гексафосфат, меркаптоуксусная кислота.

“Противомикробные средства” относится к химическому веществу, которое убивает или ингибирует рост микроорганизмов, таких как бактерии, грибы, дрожжи, простейшие и/или разрушает вирусы.

“Герметизация контейнера” означает, что контейнер закрывают таким образом, что он становится воздухонепроницаемым, не допуская обмен газа между наружной и внутренней частью и оставляя содержимое стерильным.

Термин “реагент” или “предшественник” относится к промежуточному соединению или исходному материалу, используемому в способе комбинирования, приводящему к пролекарству согласно настоящему изобретению.

Термин “химическая функциональная группа” относится к карбоновой кислоте и активированным производным, амино, малеимиду, тиолу и производным, сульфоновой кислоте и производным, карбонату и производным, карбамату и производным, гидроксилу, альдегиду, кетону, гидразину, изоцианату, изотиоцианату, фосфорной кислоте и производным, фосфоновой кислоте и производным, галогенацетилу, галогеналкилам, акрилоилу и другим альфа-бета ненасыщенным акцепторам Михаэля, арилирующим средствам, подобным арилфторидам, гидроксиламину, дисульфидам, подобным пиридилдисульфиду, винилсульфону, винилкетону, диазоалканам, диазоацетильным соединениям, оксирану и азиридину.

Если химическая функциональная группа соединена с другой химической функциональной группой, образовавшаяся химическая структура названа “связью”. Например, реакция аминогруппы с карбоксильной группой приводит к образованию амидной связи.

“Реакционноспособные функциональные группы” являются химическими функциональными группами фрагмента каркаса, которые соединены с гиперразветвленным фрагментом.

“Функциональная группа” представляет собой собирательное понятие, используемое для “реакционноспособной функциональной группы”, “разрушаемой взаимосвязанной функциональной группы”, или “функциональной группы конъюгата”.

“Разрушаемая взаимосвязанная функциональная группа” является связью, включающей биоразрушаемую связь, которая с одной стороны связана с фрагментом спейсера, соединенным с фрагментом каркаса, и с другой стороны соединена с фрагментом сшивающего реагента. Термины “разрушаемая взаимосвязанная функциональная группа”, “биоразрушаемая взаимосвязанная функциональная группа”, “взаимосвязанная биоразрушаемая функциональная группа” и “взаимосвязанная функциональная группа” используют как синонимы.

Термины “блокирующая группа” или “закрывающая группа” используются как синонимы и относятся к фрагментам, которые необратимо связаны с реакционноспособными функциональными группами, чтобы сделать их неспособными взаимодействовать, например, с химическими функциональными группами.

Термины “защищающая группа” или “защитная группа” относятся к фрагменту, который необратимо соединен с реакционноспособными функциональными группами, чтобы сделать их неспособными взаимодействовать, например, с другими химическими функциональными группами.

Термин “взаимосоединяемая функциональная группа” относится к химическим функциональным группам, которые принимают участие в реакции радикальной полимеризации и являются частью сшивающего средства или каркасного реагента.

Термин “полимеризуемая функциональная группа” относится к химическим функциональным группам, которые принимают участие в реакции типа лигирования и являются частью сшивающего реагента и каркасного реагента.

Фрагмент каркаса может включать фрагмент спейсера, который с одного конца соединен с фрагментом каркаса и с другой стороны со сшивающим фрагментом.

Термин “производные” относится к химическим функциональным группам, подходяще замещенным защитными и/или активирующими группами, или к активированным формам соответствующей химической функциональной группы, которые известны специалисту в данной области. Например, активированные формы карбоксильных групп включают, но не ограничиваются ими, активированные сложные эфиры, такие как сукцинимидильный эфир, бензотриазильный эфир, нитрофенильный эфир, пентафторфенильный эфир, азабензотриазильный эфир, ацилгалогениды, смешанные или симметричные ангидриды, ацилимидазол.

Термин “линкер, расщепляемый неферментативным путем”, относится к линкерам, которые гидролитически разрушаются при физиологических условиях без ферментативной активности. “Биологически неактивный линкер” означает линкер, который не проявляет фармакологические эффекты лекарственного средства (D-H), произведенного из биологически активного фрагмента.

Термины “спейсер”, “спейсерная группа”, “молекула спейсера” и “спейсерный фрагмент” используют взаимозаменяемо, и если используют для описания фрагмента, присутствующего в гидрогельном носителе согласно изобретению, относятся к любому фрагменту, подходящему для соединения двух фрагментов, такому как C1-50алкил, C2-50алкенил или C2-50алкинил, который фрагмент необязательно прерывается одной или более группами, выбранными из -NH-, -N(C1-4алкил)-, -O-, -S-, -C(O)-, -C(O)NH-, -C(O)N(C1-4алкил)-, -O-C(O)-, -S(O)-, -S(O)2-, 4-7-членного гетероциклила, фенила или нафтила.

Термины “концевой”, “конец” или “дальний конец” относятся к положению функциональной группы или связи в молекуле или фрагменте, тем самым такая функциональная группа может быть химической функциональной группой, и связь может быть разрушаемой или устойчивой связью, характеризующейся тем, что она локализована рядом со структурой связи или в структуре связи между двумя фрагментами или на конце олигомерной или полимерной цепи.

Фразы “в связанном виде” или “фрагмент” относятся к субструктурам, которые являются частью большей молекулы. Фразу “в связанном виде” используют, чтобы упростить ссылку на фрагменты при именовании или перечислении реагентов, исходных материалов или гипотетических исходных материалов, хорошо известных в данной области, и тем самым, “в связанном виде” означает, что, например, один или более радикалов водорода (-H), или одна или более активирующих или защитных групп, имеющихся в реагентах или исходных материалах, не присутствуют во фрагменте.

Понятно, что все реагенты и фрагменты, содержащие полимерные фрагменты, относятся к макромолекулярным структурам, которые, как известно, проявляют вариабельности в отношении молекулярной массы, длины цепи или степени полимеризации или числа функциональных групп. Структуры, показанные для каркасных реагентов, каркасных фрагментов, сшивающих реагентов и сшивающих фрагментов, являются только характерными примерами.

Реагент или фрагмент может быть линейным или разветвленным. Если реагент или фрагмент имеет две концевые группы, его называют линейным реагентом или фрагментом. Если реагент или фрагмент имеет более двух концевых групп, его рассматривают как разветвленный или многофункциональный реагент или фрагмент.

Термин “полимерная цепь, основанная на поли(этиленгликоле)” или “ПЭГ-основанная цепь” относится к олиго- или полимерной молекулярной цепи.

Предпочтительно, такая полимерная цепь, основанная на поли(этиленгликоле), связана с разветвленной сердцевиной, она является линейной поли(этиленгликолевой) цепью, у которой один конец соединен с разветвленной сердцевиной и другой конец соединен с гиперразветвленным дендритным фрагментом. Понятно, что ПЭГ-основанная цепь может заканчиваться или прерываться алкильными или арильными группами, необязательно замещенными гетероатомами и химическими функциональными группами.

Если термин “полимерная цепь, основанная на поли(этиленгликоле)” используется при ссылке на сшивающий реагент, он относится к сшивающему фрагменту или цепи, содержащим по меньшей мере 20% масс. этиленгликолевых фрагментов.

Предпочтительно в формуле (I) группа R2 заменена L2-Z.

Предпочтительно в формуле (I) группа R1 заменена L2-Z.

Предпочтительно в формуле (I) Х является N(R3).

Предпочтительно в формуле (I) Х является C(R3R3a) и R3a является N(R2b)C(O)R4.

Предпочтительно в формуле (I) Х является C(R3R3a) и группа R3a заменена L2-Z.

Предпочтительно X является C(R3R3a), R3a является N(R2b)-L2-Z.

Предпочтительные пролекарства согласно настоящему изобретению содержат конъюгат инсулина с линкером D-L, где группа L1 формулы (I) представлена формулами (Ia), (Ib), (Ic) или (Id):

где R1, R1a, R2, R2a, R2b, R3, R4, L2, Z имеют значение, как указано в описании, и где группа L1 необязательно также замещена, при условии, что водород, отмеченный звездочкой в формуле от (Ia) до (Id), не заменен заместителем.

Предпочтительно группа L1 также не замещена (за исключением обязательного заместителя L2-Z).

Предпочтительно фрагмент инсулина соединен с L1 через азот NαА1 или через азот боковой цепи лизина фрагмента инсулина.

Предпочтительно фрагмент инсулина является рекомбинантным человеческим инсулином.

Как показано, например, в формулах от (Ia) до (Id) один атом водорода заменен группой L2-Z.

В общем, группа L2 может быть соединена с L1 у любого положения, за исключением замены водорода, отмеченного звездочкой в формуле (I). Предпочтительно, один из атомов водорода, представленных R1, R1a, R2, R2a, R2b, R3, R3a, R4, непосредственно или как атом водорода C1-4алкила или других групп заменен L2-Z.

Кроме того, группа L1 может быть необязательно также замещена. Вообще, любой заместитель может быть использован, поскольку принцип расщепления не действует. Однако предпочтительно, что группа L1 также не замещена.

Предпочтительно, один или более другие необязательные заместители независимо выбирают из группы, состоящей из галогена; CN; COOR9; OR9; C(O)R9; C(O)N(R9R9a); S(O)2N(R9R9a); S(O)N(R9R9a); S(O)2R9; S(O)R9; N(R9)S(O)2N(R9aR9b); SR9; N(R9R9a); NO2; OC(O)R9; N(R9)C(O)R9a; N(R9)S(O)2R9a; N(R9)S(O)R9a; N(R9)C(O)OR9a; N(R9)C(O)N(R9aR9b); OC(O)N(R9R9a); T; C1-50алкила; C2-50алкенила; или C2-50алкинила, где T, C1-50алкил, C2-50алкенил и C2-50алкинил необязательно замещены одной или более группами R10, которые являются одинаковыми или различными, и где C1-50алкил, C2-50алкенил и C2-50алкинил необязательно прерваны одной или более группами, выбранными из группы, состоящей из T, -C(O)O-; -О-; -C(O)-; -C(O)N(R11)-; - S(O)2N(R11)-; -S(O)N(R11)-; -S(O)2-; -S(O)-; -N(R11)S(O)2N(R11a); -S-; -N(R11)-; -OC(O)R11; -N(R11)C(O)-; -N(R11)S(O)2-; -N(R11)S(O)-; -N(R11)C(O)O-; -N(R11)C(O)N(R11a)- и -OC(O)N(R11R11a);

R9, R9a, R9b независимо выбирают из группы, состоящей из H, T и C1-50алкила, C2-50алкенила или C2-50алкинила, где T, C1-50алкил, C2-50алкенил и C2-50алкинил необязательно замещены одной или более группами R10, которые являются одинаковыми или различными, и где C1-50алкил, C2-50алкенил и C2-50алкинил необязательно прерваны одной или более группами, выбранными из группы, состоящей из T, -C(O)O-; -О-; -C(O)-; -C(O)N(R11)-; - S(O)2N(R11)-; -S(O)N(R11)-; -S(O)2-; -S(O)-; -N(R11)S(O)2N(R11a); -S-; -N(R11)-; -OC(O)R11; -N(R11)C(O)-; - N(R11)S(O)2-; -N(R11)S(O)-; -N(R11)C(O)O-; -N(R11)C(O)N(R11a)- и -OC(O)N(R11R11a);

Т выбирают из группы, состоящей из фенила; нафтила; инденила; инданила; тетралинила; C3-10циклоалкила; 4-7-членного гетероциклила или 9-11-членного гетеробициклила, где группа T необязательно замещена одной или более группами R10, которые являются одинаковыми или различными;

R10 означает галоген; CN; оксо (=О); COOR12; OR12; C(O)R12; C(O)N(R12R12a); S(O)2N(R12R12a); S(O)N(R12R12a); S(O)2R12; S(O)R12; N(R12)S(O)2N(R12aR12b); SR12; N(R12R12a); NO2; OC(O)R12; N(R12)C(O)R12a; N(R12)S(O)2R12a; N(R12)S(O)R12a; N(R12)C(O)OR12a; N(R12)C(O)N(R12aR12b); OC(O)N(R12R12a); или C1-6алкил, где C1-6алкил необязательно замещен одним или более галогенами, которые являются одинаковыми или различными;

R11, R11a, R12, R12a, R12b независимо выбирают из группы, состоящей из H или C1-6алкила, где C1-6алкил необязательно замещен одним или более галогенами, которые являются одинаковыми или различными.

Термин “прерванная цепь” означает, что между двумя углеродами или на конце углеродной цепи между углеродом и водородом вставлена группа.

L2 является простой химической связью или спейсером. В случае когда L2 является спейсером, предпочтительно определение как один или более заместители, указанные выше, при условии, что группа L2 замещена Z.

Соответственно, когда L2 является группой, отличной от простой химической связи, L2-Z означает COOR9; OR9; C(O)R9; C(O)N(R9R9a); S(O)2N(R9R9a); S(O)N(R9R9a); S(O)2R9; S(O)R9; N(R9)S(O)2N(R9aR9b); SR9; N(R9R9a); OC(O)R9; N(R9)C(O)R9a; N(R9)S(O)2R9a; N(R9)S(O)R9a; N(R9)C(O)OR9a; N(R9)C(O)N(R9aR9b); OC(O)N(R9R9a); T; C1-50алкил; C2-50алкенил или C2-50алкинил, где T, C1-50алкил, C2-50алкенил и C2-50алкинил необязательно замещены одной или более группами R10, которые являются одинаковыми или различными, и где C1-50алкил, C2-50алкенил и C2-50алкинил необязательно прерваны одной или более группами, выбранными из группы, состоящей из -T-; -C(O)O-; -О-; -C(O)-; -C(O)N(R11)-; - S(O)2N(R11)-; -S(O)N(R11)-; -S(O)2-; -S(O)-; -N(R11)S(O)2N(R11a); -S-; -N(R11)-; -OC(O)R11; -N(R11)C(O)-; -N(R11)S(O)2-; -N(R11)S(O)-; -N(R11)C(O)O-; -N(R11)C(O)N(R11a)- и -OC(O)N(R11R11a);

R9, R9a, R9b независимо выбирают из группы, состоящей из H; Z; T; и C1-50алкила, C2-50алкенила или C2-50алкинила, где T; C1-50алкил, C2-50алкенил и C2-50алкинил необязательно замещены одной или более группами R10, которые являются одинаковыми или различными, и где C1-50алкил, C2-50алкенил и C2-50алкинил необязательно прерваны одной или более группами, выбранными из группы, состоящей из T; -C(O)O-; -О-; -C(O)-; -C(O)N(R11)-; - S(O)2N(R11)-; -S(O)N(R11)-; -S(O)2-; -S(O)-; -N(R11)S(O)2N(R11a); -S-; -N(R11)-; -OC(O)R11; -N(R11)C(O)-; - N(R11)S(O)2-; -N(R11)S(O)-; -N(R11)C(O)O-; -N(R11)C(O)N(R11a)- и -OC(O)N(R11R11a);

Т выбирают из группы, состоящей из фенила; нафтила; инденила; инданила; тетралинила; C3-10циклоалкила; 4-7-членного гетероциклила; или 9-11-членного гетеробициклила, где группа T необязательно замещена одной или более группами R10, которые являются одинаковыми или различными;

R10 означает Z; галоген; CN; оксо (=О); COOR12; OR12; C(O)R12; C(O)N(R12R12a); S(O)2N(R12R12a); S(O)N(R12R12a); S(O)2R12; S(O)R12; N(R12)S(O)2N(R12aR12b); SR12; N(R12R12a); NO2; OC(O)R12; N(R12)C(O)R12a; N(R12)S(O)2R12a; N(R12)S(O)R12a; N(R12)C(O)OR12a; N(R12)C(O)N(R12aR12b); OC(O)N(R12R12a); или C1-6алкил, где C1-6алкил необязательно замещен одним или более галогенами, которые являются одинаковыми или различными;

R11, R11a, R12, R12a, R12b независимо выбирают из группы, состоящей из H; Z; или C1-6алкила, где C1-6алкил необязательно замещен одним или более галогенами, которые являются одинаковыми или различными;

при условии, что только одна группа из R9, R9a, R9b, R10, R11, R11a, R12, R12a, R12b означает Z.

Более предпочтительно, L2 означает C1-20алкильную цепь, которая необязательно прерывается одной или более группами, независимо выбранными из -O- и C(O)N(R3aa); необязательно замещена одной или более группами, независимо выбранными из OH и C(O)N(R3aaR3aaa); и где R3aa, R3aaa независимо выбраны из группы, состоящей из H и C1-4алкила.

Предпочтительно, L2 имеет молекулярную массу в диапазоне от 14 г/моль до 750 г/моль.

Предпочтительно, группа L2 соединена с Z через концевую группу, выбранную из

и

В случае, когда L2 имеет такую концевую группу, также предпочтительно, что L2 имеет молекулярную массу в диапазоне от 14 г/моль до 500 г/моль, рассчитанную без такой концевой группы.

Предпочтительно, когда ковалентное соединение, образованное между линкером и гидрогелем Z, имеет прочную связь.

Предпочтительно, гидрогель Z представляет собой биоразрушаемый, не растворимый в воде гидрогель, основанный на полиэтиленгликоле (PEG). Термин “ПЭГ-основанный”, как установлено в описании, означает, что массовая доля цепей ПЭГ в гидрогеле составляет по меньшей мере 10% масс., предпочтительно по меньшей мере 25% на основании общей массы гидрогеля. Остальная часть может быть составлена из других спейсеров и/или олигомеров или полимеров, таких как олиго- или полилизины.

Кроме того, термин “нерастворимый в воде” относится к набухаемой, пространственно сшитой молекулярной сетке, образующей гидрогель. Гидрогель, если суспендирован в большом избытке воды или водном буфере физиологической осмоляльности, может впитать значительное количество воды, например, вплоть до 10-кратного превышения массы гидрогеля, и поэтому является набухаемым, однако после удаления избытка воды физическая стабильность и форма все еще сохраняются. Такая форма может иметь любую геометрию, и понятно, что такой индивидуальный гидрогелевый материал следует рассматривать как единую молекулу, состоящую из компонентов, где каждый компонент связан с любым другим компонентом химическими связями.

Согласно настоящему изобретению гидрогель может состоять из каркасных фрагментов, связанных между собой гидролитически разрушаемыми связями.

Предпочтительно группа L2 связана с фрагментом каркаса.

Предпочтительно фрагмент каркаса имеет молекулярную массу в диапазоне от 1 кДа до 20 кДа, более предпочтительно от 1 кДа до 15 кДа и даже более предпочтительно от 1 кДа до 10 кДа. Фрагменты каркаса предпочтительно являются ПЭГ-основанными, содержащими одну или более цепи ПЭГ.

В гидрогеле, несущем конъюгаты лекарственного средства и линкера согласно изобретению, каркасный фрагмент характеризуется числом функциональных групп, включающих взаимосвязанные биоразрушаемые функциональные группы и гидрогельсвязанные конъюгаты лекарственное средство-линкер и необязательно блокирующие группы. Это означает, что каркасный фрагмент характеризуется числом гидрогельсвязанных конъюгатов лекарственное средство-линкер; функциональных групп, включающих биоразрушаемые взаимосвязанные функциональные группы; и необязательно блокирующих групп. Предпочтительно, сумма взаимосвязанных биоразрушаемых функциональных групп и конъюгатов лекарственное средство-линкер и блокирующих групп составляет 16-128, предпочтительно 20-100, более предпочтительно 24-80 и наиболее предпочтительно 30-60.

Предпочтительно сумма взаимосвязанных функциональных групп и гидрогельсвязанных конъюгатов лекарственное средство-линкер и блокирующих групп фрагмента каркаса поровну разделена на число ПЭГ-основанных полимерных цепей, исходящих от ветвящейся сердцевины. Например, если существует 32 взаимосвязанные функциональные группы и гидрогельсвязанные конъюгаты лекарственное средство-линкер и блокирующие группы, восемь групп может быть предоставлено каждой их четырех ПЭГ-основанных полимерных цепей, исходящих от сердцевины, предпочтительно посредством дендритных фрагментов, присоединенных к концу каждой ПЭГ-основанной полимерной цепи. Альтернативно, четыре группы могут быть предоставлены каждой из восьми ПЭГ-основанных полимерных цепей, исходящих от сердцевины, или две группы каждой из шестнадцати ПЭГ-основанных полимерных цепей. Если число ПЭГ-основанных полимерных цепей, исходящих от ветвящейся сердцевины, не допускает ровное распределение, предпочтительно, когда отклонение от среднего числа суммы взаимосвязанных функциональных групп и гидрогельсвязанных конъюгатов лекарственное средство-линкер и блокирующих групп на ПЭГ-основанную полимерную цепь сводится до минимума.

В таких связанных с носителем пролекарствах согласно изобретению желательно, чтобы почти все лекарственное средство высвободилось (>90%) до высвобождения значительного количества каркасных фрагментов (<10%). Это может быть достигнуто путем регулирования времени полужизни связанного с носителем пролекарства в сравнении с кинетикой деградации гидрогеля согласно изобретению.

Предпочтительно каркасный фрагмент характеризуется наличием ветвящейся сердцевины, из которой вытягиваются по меньшей мере три ПЭГ-основанные полимерные цепи. Соответственно, в предпочтительном аспекте настоящего изобретения каркасный реагент включает ветвящуюся сердцевину, от которой по меньшей мере три ПЭГ-основанные полимерные цепи исходят. Такие ветвящиеся сердцевины могут состоять из поли- или олигоспиртов в связанном виде, предпочтительно пентаэритрита, трипентаэритрита, гексаглицерина, сахарозы, сорбита, фруктозы, маннита, глюкозы, целлюлозы, амилоз, крахмалов, гидроксиалкилкрахмалов, поливиниловых спиртов, декстранов, гиалуронанов, или ветвящиеся сердцевины могут состоять из поли- или олигоаминов, таких как орнитин, диаминомасляная кислота, трилизин, тетрализин, пентализин, гексализин, гептализин, октализин, нонализин, декализин, ундекализин, додекализин, тридекализин, тетрадекализин, пентадекализин или олиголизины, полиэтиленимины, поливиниламины в связанном виде.

Предпочтительно от ветвящейся сердцевины исходит от трех до шестнадцати ПЭГ-основанных полимерных цепей, более предпочтительно от четырех до восьми. Предпочтительные ветвящиеся сердцевины могут состоять из пентаэритрита, орнитина, диаминомасляной кислоты, трилизина, тетрализина, пентализина, гексализина, гептализина или олиголизина, низкомолекулярного PEI, гексаглицерина, трипентаэритрита в связанном виде. Предпочтительно, от ветвящейся сердцевины исходит от трех до шестнадцати ПЭГ-основанных полимерных цепей, более предпочтительно от четырех до восьми. Предпочтительно, ПЭГ-основанная полимерная цепь является линейной поли(этиленгликолевой) цепью, у которой один конец связан с ветвящейся сердцевиной и другой конец связан с гиперразветвленным дендритным фрагментом. Понятно, что полимерная ПЭГ-основанная цепь может быть окончена или прервана алкильными или арильными группами, необязательно замещенными гетероатомами и химическими функциональными группами.

Предпочтительно, ПЭГ-основанная полимерная цепь подходяще замещена производным полиэтиленгликоля (ПЭГ-основанным).

Предпочтительные структуры соответствующих ПЭГ-основанных полимерных цепей, исходящих от ветвящейся сердцевины, содержащейся в каркасном фрагменте, представляют собой множество ветвей ПЭГ-производных, как например, подробно описано в перечне продуктов JenKem Technology, USA (доступно из www.jenkemusa.com, загружено 28 июля, 2009), 4ARM-ПЭГ-производные (сердцевина из пентаэритрита), 8ARM-ПЭГ-производные (сердцевина из гексаглицерина) и 8ARM-ПЭГ-производные (сердцевина из трипентаэритрита). Наиболее предпочтительными являются производные из 4 ветвей ПЭГамина (сердцевина из пентаэритрита) и из 4 ветвей ПЭГкарбоксила (сердцевина из пентаэритрита), из 8 ветвей ПЭГамина (сердцевина из гексаглицерина), из 8 ветвей ПЭГкарбоксила (сердцевина из гексаглицерина), из 8 ветвей ПЭГамина (сердцевина из трипентаэритрита) и из 8 ветвей ПЭГкарбоксила (сердцевина из трипентаэритрита). Предпочтительные молекулярные массы таких ПЭГ-производных, представленных в виде множества ветвей, в каркасном фрагменте составляют от 1 кДа до 20 кДа, более предпочтительно от 1 кДа до 15 кДа и даже более предпочтительно от 1 кДа до 10 кДа.

Понятно, что концевые аминогруппы упомянутых выше молекул, представленных в виде множества ветвей, присутствуют в связанном виде в каркасном фрагменте, чтобы предоставить также взаимосвязанные функциональные группы и реакционноспособные функциональные группы фрагмента каркаса.

Предпочтительно, когда сумма взаимосвязанных функциональных групп и реакционноспособных функциональных групп фрагмента каркаса поровну разделена на число ПЭГ-основанных полимерных цепей, исходящих от ветвящейся сердцевины. Если число ПЭГ-основанных полимерных цепей, исходящих от ветвящейся сердцевины, не допускает равное распределение, предпочтительно, чтобы отклонение от среднего числа суммы взаимосвязанных функциональных групп и реактивных функциональных групп на ПЭГ-основанную полимерную цепь сводилось до минимума.

Более предпочтительно сумма взаимосвязанных и реакционноспособных функциональных групп каркасного фрагмента поровну разделена на число ПЭГ-основанных полимерных цепей, исходящих от ветвящейся сердцевины. Например, если существует 32 взаимосвязанные функциональные группы и реакционноспособные функциональные группы, восемь групп может быть предоставлено каждой из четырех ПЭГ-основанных полимерных цепей, исходящих от сердцевины, предпочтительно посредством дендритных фрагментов, присоединенных к концу каждой ПЭГ-основанной полимерной цепи. Альтернативно, четыре группы могут быть предоставлены каждой из восьми ПЭГ-основанных полимерных цепей, исходящих от сердцевины, или две группы каждой из шестнадцати ПЭГ-основанных полимерных цепей.

Такие дополнительные функциональные группы могут быть предоставлены дендритными фрагментами. Предпочтительно, каждый дендритный фрагмент имеет молекулярную массу в диапазоне от 0,4 кДа до 4 кДа, более предпочтительно от 0,4 кДа до 2 кДа. Предпочтительно, каждый дендритный фрагмент имеет по меньшей мере 3 разветвления и по меньшей мере 4 реакционноспособные функциональные группы, и по большей мере 63 разветвления и 64 реакционноспособные функциональные группы, предпочтительно по меньшей мере 7 разветвлений и по меньшей мере 8 реакционноспособных функциональных групп и по большей мере 31 разветвление и 32 реакционноспособные функциональные группы.

Примеры таких дендритных фрагментов включают трилизин, тетрализин, пентализин, гексализин, гептализин, октализин, нонализин, декализин, ундекализин, додекализин, тридекализин, тетрадекализин, пентадекализин, гексадекализин, гептадекализин, октадекализин, нонадекализин в связанном виде. Примеры таких предпочтительных дендритных фрагментов включают трилизин, тетрализин, пентализин, гексализин, гептализин в связанном виде, наиболее предпочтительны трилизин, пентализин или гептализин, орнитин, диаминомасляная кислота в связанном виде.

Наиболее предпочтительно, гидрогелевый носитель согласно настоящему изобретению отличается тем, что каркасный фрагмент имеет четвертичный атом углерода C(A-Hyp)4, где каждая группа А является независимо поли(этиленгликоль)-основанной полимерной цепью, своим концом соединенной с четвертичным атомом углерода прочной ковалентной связью, и дальний конец ПЭГ-основанной полимерной цепи ковалентно связан с дендритным фрагментом Hyp, каждый дендритный фрагмент Hyp имеет по меньшей мере четыре функциональные группы, представляющие собой взаимосвязанные функциональные группы и реакционноспособные функциональные группы.

Предпочтительно каждая группа А независимо выбрана из формулы -(CH2)n1(OCH2CH2)nX-, где n1 равно 1 или 2; n является целым числом в диапазоне от 5 до 50; и X является химической функциональной группой, ковалентно связывающей A и Hyp.

Предпочтительно A и Hyp ковалентно связаны амидной связью.

Предпочтительно дендритный фрагмент Hyp представляет собой гиперразветвленный полипептид. Предпочтительно гиперразветвленный полипептид содержит лизин в связанном виде. Предпочтительно каждый дендритный фрагмент Hyp имеет молекулярную массу в диапазоне от 0,4 кДа до 4 кДа. Понятно, что каркасный фрагмент C(A-Hyp)4 может состоять из одинаковых или различных дендритных фрагментов Hyp и что каждый Hyp может быть выбран независимо. Каждый фрагмент Hyp содержит 5-32 лизина, предпочтительно по меньшей мере 7 лизинов, т.е. каждый фрагмент содержит 5-32 лизина в связанном виде, предпочтительно по меньшей мере 7 лизинов в связанном виде. Наиболее предпочтительно, Hyp включает гептализинил.

Реакция полимеризуемых функциональных групп каркасного реагента, точнее Hyp с полимеризуемыми функциональными группами полиэтиленгликоль-основанных сшивающих реагентов, приводит к образованию прочной амидной связи.

Предпочтительно C(A-Hyp)4 имеет молекулярную массу в диапазоне от 1 кДа до 20 кДа, более предпочтительно от 1 кДа до 15 кДа и даже более предпочтительно от 1 кДа до 10 кДа.

Один предпочтительный каркасный фрагмент представлен ниже, пунктирные линии указывают на взаимосвязывающиеся биоразрушаемые связи со сшивающими фрагментами, и n равно целому числу от 5 до 50:

Биоразрушаемость гидрогелей согласно настоящему изобретению достигается введением связей, расщепляемых гидролизом.

Термины “гидролитически разрушаемые”, “биоразрушаемые” или “расщепляемые гидролизом”, “ауторасщепляемые”, или “саморасщепление”, “саморасщепляющиеся”, “неустойчивые” или “временные” относятся в контексте настоящего изобретения к связям и сшивкам, которые разрушаются или расщепляются посредством неферментативного гидролиза при физиологических условиях (водный буфер при pH 7,4, 37°C) с временем полужизни, колеблющимся от одного часа до трех месяцев, включающим, но не ограничивающимся ими, аконитилы, ацетали, амиды, ангидриды карбоновых кислот, сложные эфиры, имины, гидразоны, амиды малеиновой кислоты, сложные орто-эфиры, фосфамиды, фосфоэфиры, силиловые эфиры кислот фосфора, силиловые сложные эфиры, сложные эфиры сульфоновых кислот, ароматические карбаматы, их комбинации и тому подобное.

Если в гидрогеле согласно изобретению имеется разрушаемая взаимосвязанная функциональная группа, предпочтительными биоразрушаемыми сшивками являются сложные эфиры карбоновых кислот, карбонаты, фосфоэфиры и сложные эфиры сульфокислот, и наиболее предпочтительными являются сложные эфиры карбоновых кислот или карбонаты.

Устойчивые сшивки не разрушаются путем ферментативного гидролиза при физиологических условиях (водный буфер при pH 7,4, 37°C) со временем полужизни, составляющим шесть месяцев или дольше, такие как амиды.

Для того чтобы ввести расщепляемые путем гидролиза связи в гидрогелевый носитель согласно изобретению, каркасные фрагменты могут быть непосредственно связаны друг с другом с помощью биоразрушаемых связей.

В одном варианте осуществления изобретения каркасные фрагменты биоразрушаемого гидрогелевого носителя могут быть прямо связаны вместе, т.е. без сшивающих фрагментов. Гиперразветвленные дендритные фрагменты двух каркасных фрагментов такого биоразрушаемого гидрогеля могут быть, каждый, прямо связаны посредством взаимосвязанной функциональной группы, которая соединяет два гиперразветвленных дендритных фрагмента. Альтернативно, два гиперразветвленных дендритных фрагмента двух разных каркасных фрагментов могут быть связаны друг с другом посредством двух спейсерных фрагментов, соединенных с каркасным фрагментом, и с другой стороны соединенных со сшивающим фрагментом, разделенными взаимосвязанными функциональными группами.

Альтернативно, каркасные фрагменты могут быть соединены вместе посредством сшивающих фрагментов, каждый сшивающий фрагмент оканчивается по меньшей мере двумя гидролитически разрушаемыми связями. Кроме концевых разрушаемых связей, сшивающие фрагменты могут также содержать биоразрушаемые связи. Таким образом, каждый конец сшивающего фрагмента, связанного с каркасным фрагментом, включает гидролитически разрушаемую связь, и дополнительные биоразрушаемые связи необязательно могут присутствовать в сшивающем фрагменте.

Предпочтительно биоразрушаемый гидрогелевый носитель состоит из каркасных фрагментов, взаимосвязанных гидролитически разрушаемыми связями, и каркасные фрагменты соединены вместе через сшивающие фрагменты.

Биоразрушаемый гидрогелевый носитель может содержать один или более различных типов сшивающих фрагментов, предпочтительно один. Сшивающий фрагмент может представлять собой линейную или разветвленную молекулу, и предпочтительно является линейной молекулой. В предпочтительном варианте осуществления изобретения сшивающий фрагмент соединен с каркасными фрагментами по меньшей мере двумя биоразрушаемыми связями.

Предпочтительно сшивающие фрагменты имеют молекулярную массу в диапазоне от 60 Да до 5 кДа, более предпочтительно от 0,5 кДа до 4 кДа, даже более предпочтительно от 1 кДа до 4 кДа, даже более предпочтительно от 1 кДа до 3 кДа. В одном варианте осуществления изобретения сшивающий фрагмент состоит из полимера.

Кроме олигомерных или полимерных сшивающих фрагментов, низкомолекулярные сшивающие фрагменты могут быть использованы, особенно когда гидрофильные высокомолекулярные каркасные фрагменты используют для формирования биоразрушаемого гидрогеля согласно изобретению.

Предпочтительно поли(этиленгликоль)-основанные сшивающие фрагменты представляют собой углеводородные цепи, содержащие этиленгликолевые единицы, необязательно включающие также функциональные группы, где поли(этиленгликоль)-основанные сшивающие фрагменты содержат, каждый, по меньшей мере m этиленгликолевых единиц, где m является целым числом в диапазоне от 3 до 100, предпочтительно от 10 до 70. Предпочтительно поли(этиленгликоль)-основанные сшивающие фрагменты имеют молекулярную массу в диапазоне от 0,5 кДа до 5 кДа.

При использовании в ссылке на сшивающий фрагмент или ПЭГ-основанную полимерную цепь, связанную с ветвящейся сердцевиной, термин “ПЭГ-основанный” относится к сшивающему фрагменту или ПЭГ-основанной полимерной цепи, содержащей по меньшей мере 20% масс. этиленгликолевых фрагментов.

В одном варианте осуществления изобретения мономеры, составляющие полимерные сшивающие фрагменты, соединены биоразрушаемыми связями. Такие полимерные сшивающие фрагменты могут содержать вплоть до 100 биоразрушаемых связей или более, в зависимости от молекулярной массы сшивающего фрагмента и молекулярной массы мономерных единиц. Примерами таких сшивающих фрагментов являются полимеры, основанные на поли(молочной кислоте) или поли(гликолевой кислоте). Понятно, что такая цепь поли(молочной кислоты) или поли(гликолевой кислоты) может быть окончена или прервана алкильными или арильными группами, и что они необязательно могут быть замещены гетероатомами и химическими функциональными группами.

Предпочтительно сшивающие фрагменты представляют собой ПЭГ-основанные, предпочтительно представленные только одной ПЭГ-основанной молекулярной цепью. Предпочтительно, поли(этиленгликоль)-основанные сшивающие фрагменты представляют собой углеводородные цепи, содержащие этиленгликолевые единицы, необязательно также содержащие химические функциональные группы, где поли(этиленгликоль)-основанные сшивающие фрагменты содержат по меньшей мере каждый m этиленгликолевых единиц, где m является целым числом в диапазоне от 3 до 100, предпочтительно от 10 до 70. Предпочтительно поли(этиленгликоль)-основанные сшивающие фрагменты имеют молекулярную массу в диапазоне от 0,5 кДа до 5 кДа.

В предпочтительном варианте осуществления настоящего изобретения сшивающий фрагмент состоит из ПЭГ, который симметрично соединен посредством сложноэфирных связей с двумя альфа-, омега-алифатическими дикарбоновыми спейсерами, предоставленными каркасными фрагментами, соединенными с гиперразветвленным дендритным фрагментом посредством устойчивых амидных связей.

Дикарбоновые кислоты спейсерных фрагментов, соединенных с каркасным фрагментом и с другой стороны соединенных с сшивающим фрагментом, состоят из 3-12 атомов углерода, наиболее предпочтительно 5-8 атомами углерода и могут быть замещены у одного или более атомов углерода. Предпочтительными заместителями являются алкильные группы, гидроксильные группы или амидогруппы или замещенные аминогруппы. Одна или более из метиленовых групп алифатических дикарбоновых кислот могут быть замещены O или NH или алкил-замещенным N. Предпочтительный алкил является линейным или разветвленным алкилом с 1-6 атомами углерода.

Предпочтительно, существует устойчивая амидная связь между гиперразветвленным дендритным фрагментом и спейсерным фрагментом, соединенным с каркасным фрагментом и с другой стороны соединенным со сшивающим фрагментом.

Один предпочтительный сшивающий фрагмент представлен ниже; пунктирные линии указывают на соединяющие биоразрушаемые связи с каркасными фрагментами:

где n является целым числом от 5 до 50.

Предпочтительно гидрогелевый носитель состоит из каркасных фрагментов, взаимосвязанных гидролитически разрушаемыми связями.

Более предпочтительно фрагменты каркаса содержат ветвящуюся сердцевину следующей формулы:

где пунктирная линия указывает на место присоединения к остальной части фрагмента каркаса.

Более предпочтительно, каркасные фрагменты включают структуру следующей формулы:

где n является целым числом от 5 до 50, и пунктирная линия указывает на место присоединения к остальной части фрагмента каркаса.

Предпочтительно каркасный фрагмент включает гиперразветвленный фрагмент Hyp.

Более предпочтительно, каркасный фрагмент включает гиперразветвленный фрагмент Hyp следующей формулы:

где пунктирные линии указывают на места присоединения к остальной части молекулы, и атомы углерода, отмеченные звездочками, указывают на S-конфигурацию.

Предпочтительно, фрагменты каркаса присоединены по меньшей мере к одному спейсеру следующей формулы:

где одна из пунктирных линий указывает на место присоединения к гиперразветвленному фрагменту Hyp и вторая пунктирная линия указывает на место присоединения к остальной части молекулы; и где m является целым числом от 2 до 4.

Предпочтительно, фрагменты каркаса связаны вместе посредством сшивающих фрагментов, имеющих следующую структуру:

где q является целым числом от 3 до 100, предпочтительно от 5 до 50.

В гидрогелевых пролекарствах согласно изобретению степень гидролиза биоразрушаемых связей между каркасными фрагментами и сшивающими фрагментами зависит или определяется по числу и типу связанных атомов, соседних с карбоксигруппой ПЭГ-сложного эфира. Например, путем выбора из янтарной, адипиновой или глутаровой кислоты для образования сложного эфира ПЭГ, можно изменить период полужизни биоразрушаемого гидрогелевого носителя согласно изобретению.

Предпочтительно фрагмент L2 присоединен к Z через тиосукцинимидную группу, которая в свою очередь присоединена к фрагменту каркаса гидрогеля посредством спейсера, такого как олигоэтиленгликолевая цепь. Предпочтительно, сшивка указанной спейсерной цепи с фрагментом каркаса является прочной связью, предпочтительно амидной связью.

Биоразрушаемая способность гидрогелей согласно настоящему изобретению достигается путем введения гидролитически разрушаемых связей.

Относительно взаимосвязанных функциональных групп, термин “гидролитически разрушаемые” относится в контексте настоящего изобретения к сшивкам, которые не разрушаются ферментативным гидролизом при физиологических условиях (водный буфер при рН 7,4, 37°С) с периодом полужизни, колеблющимся от одного часа до трех месяцев, включающим, но не ограничивающимся ими, аконитилы, ацетали, ангидриды карбоновых кислот, сложные эфиры, имины, гидразоны, амиды малеиновой кислоты, сложные орто-эфиры, фосфамиды, сложные фосфоэфиры, силиловые сложные эфиры кислот фосфора, силиловые сложные эфиры, сложные эфиры сульфокислот, ароматические карбаматы, их комбинации и тому подобное. Предпочтительными биоразрушаемыми сочленениями являются сложные эфиры карбоновых кислот, карбонаты, сложные фосфоэфиры и сложные эфиры сульфокислот, и наиболее предпочтительными являются сложные эфиры карбоновых кислот или карбонаты. Понятно, что для исследований in vitro ускоренные условия, подобные, например, рН 9, 37°С, водный буфер, могут быть использованы для практических целей.

Прочные сшивки не разрушаются ферментативным гидролизом при физиологических условиях (водный буфер при рН 7,4, 37°С) с периодом полужизни, составляющим шесть месяцев или дольше, такие как, например, амиды.

Деградация биоразрушаемого гидрогелевого носителя согласно изобретению является многоступенчатой реакцией, где множество разрушаемых связей расщепляется, приводя к образованию продуктов деградации, которые могут быть водорастворимыми или не растворимыми в воде. Однако не растворимые в воде продукты деградации могут также включать разрушаемые связи, так что они могут расщепляться с образованием водорастворимых продуктов деградации. Указанные водорастворимые продукты деградации могут содержать один или более фрагментов каркаса. Понятно, что высвобожденные каркасные фрагменты могут, например, быть прочно конъюгированы со спейсером или блокирующими группами или линкерными группами или группами, обладающими сходными свойствами, и/или продуктами деградации линкера пролекарства, и что водорастворимые продукты деградации также могут содержать разрушаемые связи.

Структуры ветвящейся сердцевины, ПЭГ-основанных полимерных цепей, гиперразветвленных дендритных фрагментов и фрагментов, присоединенных к гиперразветвленным дендритным фрагментам, могут быть определены, исходя из соответствующих описаний, представленных в разделах, охватывающих гидрогелевые носители согласно настоящему изобретению. Понятно, что структура продукта деградации зависит от типа гидрогеля согласно изобретению, претерпевающего разрушение.

Общее количество каркасных фрагментов можно измерить в растворе после полной деградации гидрогеля согласно изобретению, и в течение деградации, фракции растворимых продуктов деградации каркаса можно отделить от нерастворимого гидрогеля согласно изобретению и можно количественно определить без помех со стороны других растворимых продуктов деградации, высвобожденных из гидрогеля согласно изобретению. Гидрогелевый материал согласно изобретению может быть отделен от избытка воды или буфера физиологической осмоляльности путем седиментации или центрифугирования. Центрифугирование может быть осуществлено таким путем, что супернатант содержит по меньшей мере 10% объема набухшего гидрогеля согласно изобретению. Растворимые продукты деградации гидрогеля остаются в водном супернатанте после такой стадии седиментации или центрифугирования, и водорастворимые продукты деградации, содержащие один или более фрагментов каркаса, определяются посредством подходящего разделения аликвот такого супернатанта и/или с помощью аналитических методов.

Предпочтительно водорастворимые продукты деградации могут быть отделены от не растворимых в воде продуктов деградации путем фильтрации через фильтры с диаметром пор 0,45 мкм, после которой водорастворимые продукты деградации могут быть обнаружены в фильтрате. Водорастворимые продукты деградации также могут быть отделены от не растворимых в воде продуктов деградации путем комбинирования стадий центрифугирования и фильтрации.

Например, фрагменты каркаса могут нести группы, которые имеют поглощение в УФ-области при таких длинах волн, при которых другие продукты деградации не имеют поглощение в УФ-области. Подобная избирательность УФ-поглощающих групп может быть обусловлена структурными компонентами каркасного фрагмента, такими как амидные связи, или может быть введена в каркас путем присоединения к его реакционноспособным функциональным группам посредством ароматических кольцевых систем, таких как индоильные группы.

В таких гидрогельсвязанных инсулиновых пролекарствах согласно изобретению желательно, чтобы почти весь инсулин высвобождался (>90%) до высвобождения значительного количества продуктов разложения каркаса (<10%). Это может быть достигнуто путем регуляции времени полужизни гидрогельсвязанного инсулинового пролекарства против кинетики разложения гидрогеля.

Предпочтительно инсулиновые пролекарства имеют структуру формулы (IIa) или (IIb)

где Nε-инсулин относится к инсулину, соединенному посредством боковой цепи одного остатка лизина; или

Предпочтительно гидрогель в формуле (IIa) или (IIb) является биоразрушаемым полиэтиленгликоль (ПЭГ)-основанным не растворимым в воде гидрогелем.

Предпочтительно гидрогель в формуле (IIa) или (IIb) состоит из каркасных фрагментов, связанных друг с другом гидролитически разрушаемыми связями.

Более предпочтительно фрагменты каркаса содержат ветвящуюся сердцевину следующей формулы:

где пунктирная линия указывает на место присоединения к остальной части каркасной молекулы.

Более предпочтительно фрагменты каркаса включают структуру следующей формулы:

где n является целым числом от 5 до 50, и пунктирная линия указывает на место присоединения к остальной части молекулы.

Предпочтительно фрагмент каркаса содержит гиперразветвленный фрагмент Hyp.

Более предпочтительно фрагмент каркаса содержит гиперразветвленный фрагмент Hyp следующей формулы:

где пунктирная линия указывает на место присоединения к остальной части молекулы и атомы углерода, отмеченные звездочкой, указывают на S-конфигурацию.

Предпочтительно фрагменты каркаса присоединены по меньшей мере к одному спейсеру следующей формулы:

где одна из пунктирных линий указывает на место присоединения к гиперразветвленному фрагменту Hyp и вторая пунктирная линия указывает на место присоединения к остальной части молекулы; и где m является целым числом от 2 до 4.

Предпочтительно каркасные фрагменты связаны по меньшей мере с одним спейсером следующей формулы:

где пунктирная линия, отмеченная звездочкой, указывает на связь между гидрогелем и N тиосукцинимидной группы,

где другая пунктирная линия указывает на место присоединения к Hyp и где р является целым числом от 0 до 10.

Предпочтительно фрагменты каркаса связаны вместе посредством сшивающих фрагментов, имеющих следующую структуру

где q является целым числом от 3 до 100.

Степень гидролиза биоразрушаемых связей между каркасом и сшивающими фрагментами определяется по числу и типу связанных атомов, соседних с карбоксигруппой ПЭГ-сложного эфира. Например, путем выбора из янтарной, адипиновой или глутаровой кислоты для образования сложного эфира ПЭГ, возможно изменить период полужизни сшивающего средства, претерпевающего разложение.

Гидрогельсвязанное пролекарство инсулина согласно настоящему изобретению может быть приготовлено, исходя из гидрогеля согласно настоящему изобретению обычными способами, известными в данной области. Практику в данной области понятно, что имеется несколько способов. Например, линкер пролекарства, описанный выше, к которому ковалентно присоединен биологически активный фрагмент, может взаимодействовать с реакционноспособными функциональными группами гидрогеля согласно настоящему изобретению, уже несущими активный фрагмент частично или целиком.

В предпочтительном способе получения гидрогель получают химическими реакциями сшивания. Гидрогель может быть образован из двух макромолекулярных продуктов с комплементарными функциональностями, которые претерпевают реакцию, такую как конденсация или присоединение. Одним из указанных исходных материалов является сшивающий реагент по меньшей мере с двумя идентичными функциональными группами, и другим исходным материалом является многофункциональный гомоструктуры каркасный реагент. Подходящие функциональные группы, присутствующие в сшивающем реагенте, включают концевые аминогруппы, карбоновую кислоту и производные, малеимид и другие альфа,бета-ненасыщенные акцепторы Михаэля, подобные винилсульфону, тиолу, гидроксильным группам. Подходящие функциональные группы, присутствующие в каркасном реагенте, включают, но не ограничиваются ими, аминогруппы, карбоновую кислоту и производные, малеимид и другие альфа,бета-ненасыщенные акцепторы Михаэля, подобные винилсульфону, тиолу и гидроксильным группам.

Если реакционноспособные функциональные группы сшивающего реагента используют субстехиометрически относительно реакционноспособных функциональных групп каркаса, образующийся гидрогель должен быть реакционноспособным гидрогелем со свободными реакционноспособными функциональными группами, присоединенными к каркасной структуре.

Необязательно, линкер пролекарства может быть вначале конъюгирован с инсулином, и образующийся конъюгат инсулин-линкер пролекарства затем может взаимодействовать с реакционноспособными функциональными группами гидрогеля. Альтернативно, после активации одной из функциональных групп линкера пролекарства конъюгат линкер-гидрогель может вступать в контакт с инсулином на второй стадии реакции, и избыток инсулина может быть удален путем фильтрации после конъюгирования инсулина с гидрогельсвязанным линкером пролекарства.

Предпочтительный способ получения пролекарства согласно настоящему изобретению представлен ниже:

Предпочтительным исходным материалом для синтеза каркасного реагента является ПЭГ-тетраамин, представленный 4 ветвями полимера, или ПЭГ-октаамин, представленный 8 ветвями полимера, с ПЭГ молекулярной массы, колеблющейся от 2000 до 10000 Дальтон, наиболее предпочтительно от 2000 до 5000 Да. К таким ПЭГ-производным, состоящим из множества ветвей, остатки лизина присоединяют последовательно с образованием гиперразветвленного каркасного реагента. Понятно, что лизины могут быть частично или полностью защищены защитными группами в течение стадий присоединения и что конечный каркасный реагент также может содержать защитные группы. Предпочтительным элементарным звеном является бис-бок-лизин. Альтернативно, вместо последовательных добавлений остатков лизина дендритный полилизиновый фрагмент может быть вначале синтезирован и впоследствии соединен с представленным 4 ветвями ПЭГ-тетраамином или представленным 8 ветвями ПЭГ-октаамином. Желательно получить каркасный реагент, несущий 32 аминокислоты, поэтому семь лизинов должно быть присоединено к каждой ветви ПЭГ, представленного 4 ветвями, или пять лизинов должно быть присоединено к каждой ветви ПЭГ, представленного 8 ветвями. В другом варианте осуществления изобретения ПЭГ-производными, представленными множеством ветвей, являются тетра- или октакарбокси-ПЭГ. В таком случае дендритные фрагменты могут быть произведены из глутаровой или аспарагиновой кислоты и образовавшийся каркасный реагент должен нести 32 карбоксигруппы. Понятно, что все или часть функциональных групп каркасного реагента может присутствовать в свободном виде, в виде солей или конъюгатов с защитными группами. Понятно, что по практическим соображениям число лизинов каркасного реагента на ветвь ПЭГ должно составлять между шестью и семью остатками, более предпочтительно приблизительно семь остатков.

Предпочтительный каркасный реагент представлен ниже:

Синтез сшивающего реагента начинается с линейной цепи ПЭГ с молекулярной массой, колеблющейся от 0,2 до 5 кДа, более предпочтительно от 0,6 до 2 кДа, которая этерифицирована до неполного эфира дикарбоновой кислоты, большей частью адипиновой кислоты или глутаровой кислоты. Предпочтительной защитной группой для образования неполного эфира является бензильная группа. Образующиеся ПЭГ-неполные бис-эфиры дикарбоновой кислоты превращаются в более реакционноспособные карбоксисоединения, такие как хлорангидриды карбоновой кислоты или активированные эфиры, например, пентафторфенил или N-гидроксисукцинимидные эфиры, наиболее предпочтительно N-гидроксисукцинимидные эфиры, из которых предпочтительная выбранная структура представлена ниже.

Альтернативно, ПЭГ-неполные бис-эфиры дикарбоновой кислоты могут быть активированы в присутствии связывающего средства, такого как DCC, или HOBt, или PyBOP.

В альтернативном варианте осуществления изобретения каркасный реагент несет карбоксигруппы, и соответствующий сшивающий реагент должен быть выбран из содержащих сложный эфир аминоконцевых цепей ПЭГ.

Каркасный реагент и сшивающий реагент могут быть полимеризованы с образованием гидрогеля согласно изобретению при использовании обратной эмульсионной полимеризации. После выбора желаемой стехиометрии между функциональными группами каркаса и сшивающего реагента каркас и сшивающий реагент растворяют в ДМСО, и подходящее эмульгирующее средство с соответственно выбранной величиной HLB, предпочтительно Арлацел Р135, используют для образования обратной эмульсии посредством механической мешалки и контроля скорости перемешивания. Полимеризацию инициируют добавлением подходящего основания, предпочтительно N,N,N',N'-тетраметилэтилендиамина. После перемешивания в течение соответствующего количества времени реакцию гасят путем добавления кислоты, такой как уксусная кислота и вода. Шарики собирают, промывают и фракционируют согласно размеру частиц путем механического просеивания. Необязательно, защитные группы могут быть удалены на данной стадии.

Кроме того, такой гидрогель согласно изобретению может быть функционализирован спейсером, несущим реакционноспособную функциональную группу, отличную от группы, предоставленной гидрогелем. Например, малеимидные реакционноспособные функциональные группы могут быть введены в гидрогель путем связывания подходящего гетеробифункционального спейсера, такого как Mal-PEG6-NHS, с гидрогелем. Такой функционализированный гидрогель также может быть конъюгирован с комплексами инсулин-линкер, несущими реакционноспособную тиоловую группу на линкерном фрагменте, с образованием гидрогельсвязанных пролекарств инсулина согласно настоящему изобретению.

После введения конъюгата инсулин-линкер в функционализированный гидрогель, содержащий малеимидогруппы, все оставшиеся функциональные группы блокируют подходящим блокирующим средством, таким как меркаптоэтанол, для предотвращения побочных реакций.

В предпочтительном варианте осуществления изобретения конъюгат инсулин-линкер, несущий свободную тиоловую группу, соединенную с фрагментом линкера, взаимодействует с функционализированным малеимидом гидрогелем при температурах между комнатной температурой и 4°С, более предпочтительно при комнатной температуре, в буферном водном растворе при рН 2-5, предпочтительно при рН 2,5-4,5, более предпочтительно при рН 3,0-4,0. Далее, соответствующий образующийся конъюгат инсулин-линкер-гидрогель обрабатывают меркаптоэтанолом при температурах между комнатной температурой и 4°С, более предпочтительно при комнатной температуре, в буферном водном растворе при рН 2-5, предпочтительно при рН 2,5-4,0, более предпочтительно при рН 2,5-3,5.

В другом предпочтительном варианте осуществления изобретения конъюгат инсулин-линкер, несущий малеимидную группу, соединенную с фрагментом линкера, взаимодействует с функционализированным тиолом гидрогелем при температурах между комнатной температурой и 4°С, более предпочтительно при комнатной температуре, в буферном водном растворе при рН 2-5, предпочтительно при рН 2,5-4,5, более предпочтительно при рН 3,0-4,0. Далее, соответствующий образующийся конъюгат инсулин-линкер-гидрогель обрабатывают низкомолекулярным соединением, содержащим малеимидную группу, предпочтительно малеимидсодержащим соединением массой от 100 до 300 Да, например N-этилмалеимидом, при температурах между комнатной температурой и 4°С, более предпочтительно при комнатной температуре, в буферном водном растворе при рН 2-5, предпочтительно при рН 2,5-4,0, более предпочтительно при рН 2,5-3,5.

Другим аспектом настоящего изобретения является способ, включающий следующие стадии:

(а) контакт водной суспензии, содержащей микрочастицы функционализированного малеимидом гидрогеля, с раствором, содержащим реагент инсулин-линкер, несущий тиоловые группы, при температурах между комнатной температурой и 4°С, в буферном водном растворе при рН 2-5, с образованием конъюгата инсулин-линкер-гидрогель;

(b) необязательно, обработка конъюгата инсулин-линкер-гидрогель со стадии (а) тиолсодержащим соединением молекулярной массы от 34 Да до 500 Да при температурах между комнатной температурой и 4°С в буферном водном растворе при рН 2-5.

Другим аспектом настоящего изобретения является способ, включающий следующие стадии:

(а) контакт водной суспензии, содержащей микрочастицы функционализированного тиолом гидрогеля, с раствором, содержащим реагент инсулин-линкер, несущий малеимидные группы, при температурах между комнатной температурой и 4°С, в буферном водном растворе при рН 2-5, с образованием конъюгата инсулин-линкер-гидрогель;

(b) необязательно, обработка конъюгата инсулин-линкер-гидрогель со стадии (а) малеимидсодержащим соединением молекулярной массы от 100 до 300 Да при температурах между комнатной температурой и 4°С в буферном водном растворе при рН 2-5.

Наиболее предпочтительный способ получения пролекарства согласно настоящему изобретению включает следующие стадии:

(а) взаимодействие соединения формулы C(A'-X1)4, где A'-X1 представляет собой элемент А до его связывания с Hyp или предшественник Hyp, и Х1 является подходящей функциональной группой, с соединением формулы Hyp'-X2, где Hyp'-X2 представляет собой Hyp до его связывания с А или предшественник Hyp, и Х2 является подходящей функциональной группой для реакции с Х1;

(b) необязательно взаимодействие образующегося на стадии (а) соединения, осуществляемое в одну или более стадии, с получением соединения формулы C(A-Hyp)4, включающего по меньшей мере четыре функциональные группы;

(с) взаимодействие по меньшей мере четырех функциональных групп образующегося на стадии (b) соединения со сшивающим предшественником, основанным на полиэтиленгликоле, где активированные сложноэфирные группы сшивающего предшественника используют в субстехиометрическом количестве в сравнении с общим числом реакционноспособных функциональных групп C(A-Hyp)4 с образованием гидрогеля;

(d) взаимодействие остающихся, не участвующих в реакции функциональных групп (представляющих собой реакционноспособные функциональные группы каркаса, входящего в состав гидрогеля) каркаса гидрогеля со стадии (с), с ковалентным конъюгатом биологически активного фрагмента и неустойчивого линкера пролекарства, или вначале взаимодействие не участвующих в реакции функциональных групп с неустойчивым линкером пролекарства и затем с биологически активным фрагментом;

(е) необязательно блокирование остающихся, не участвующих в реакции функциональных групп с получением пролекарства согласно настоящему изобретению.

Конкретно, гидрогели для пролекарств инсулина согласно настоящему изобретению синтезируют, как описано ниже.

Относительно полимеризации в массе, каркасный реагент и сшивающий реагент смешивают в отношении амин/активированный эфир от 2:1 до 1,05:1.

Как каркасный реагент, так и сшивающий реагент растворяют в ДМСО с получением раствора с концентрацией от 5 до 50 г на 100 мл, предпочтительно от 7,5 до 20 г на 100 мл и наиболее предпочтительно от 10 до 20 г на 100 мл.

Для проведения полимеризации, от 2 до 10% (об.) N,N,N',N'-тетраметилэтилендиамина (TMEDA) добавляют к раствору ДМСО, содержащему сшивающий реагент и каркасный реагент, и смесь встряхивают в течение от 1 до 20 сек и оставляют стоять. Смесь отвердевает в течение менее чем 1 мин.

Такой гидрогель согласно изобретению предпочтительно измельчают механическими способами, такими как перемешивание, дробление, фракционирование под давлением или размол, и необязательно просеивание.

Относительно эмульсионной полимеризации, реакционная смесь состоит из дисперсной фазы и непрерывной фазы.

Что касается дисперсной фазы, каркасный реагент и сшивающий реагент смешивают в отношении амин/активированный эфир, составляющем от 2:1 до 1,05:1, и смесь растворяют в ДМСО с получением раствора с концентрацией от 5 до 50 г на 100 мл, предпочтительно от 7,5 до 20 г на 100 мл и наиболее предпочтительно от 10 до 20 г на 100 мл.

Дисперсионной средой является любой растворитель, который не смешивается с ДМСО, не основный, апротонный и имеет вязкость ниже, чем 10 Па. Предпочтительно растворитель не смешивается с ДМСО, не основный, апротонный, имеет вязкость ниже, чем 2 Па и является нетоксичным. Более предпочтительно растворителем является насыщенный линейный или разветвленный углеводород, содержащий от 5 до 10 атомов углерода. Наиболее предпочтительно растворителем является н-гептан.

Для образования эмульсии дисперсной фазы в дисперсионной среде, эмульгатор добавляют к дисперсионной среде до добавления дисперсной фазы. Количество эмульгатора составляет от 2 до 50 мг на мл дисперсной фазы, более предпочтительно от 5 до 20 мг на мл дисперсной фазы, наиболее предпочтительно 10 мг на мл дисперсной фазы.

Эмульгатор имеет HLB-показатель от 3 до 8. Предпочтительно, эмульгатор является триэфиром сорбита и жирной кислоты или конъюгатом поли(жирная оксикислота)-поли(этиленгликоль). Более предпочтительно, эмульгатор является конъюгатом поли(жирная оксикислота)-поли(этиленгликоль), с линейным поли(этиленгликолем) молекулярной массы в диапазоне от 0,5 кДа до 5 кДа и единицами поли(жирной оксикислоты) молекулярной массы в диапазоне от 0,5 кДа до 3 кДа на каждом конце цепи. Наиболее предпочтительно, эмульгатор является диполигидроксистеарат поли(этиленгликоля), Cithrol DPHS (Cithrol DPHS, продукт конденсации Arlacel P135, Croda International Plc).

Капельки дисперсной фазы приготавливали путем перемешивания посредством аксиально-поточной мешалки с конфигурацией, подобной конфигурации мешалок, таких как осевой импеллер с изогнутыми лопастями, мешалка конструкции “Интермиг”, пропеллерная мешалка (EKATO Rühr- und Mischtechnik GmbH, Germany), наиболее предпочтительно использование мешалки, подобной осевому импеллеру с изогнутыми лопастями с диаметром от 50 до 90% диаметра реактора. Предпочтительно перемешивание начинают до добавления дисперсной фазы. Скорость перемешивания составляет от 0,6 до 1,7 м/сек. Дисперсную фазу добавляют при комнатной температуре, и концентрация дисперсной фазы составляет от 2% до 70%, предпочтительно от 5 до 50%, более предпочтительно от 10 до 40% и наиболее предпочтительно от 20 до 35% от общего реакционного объема. Смесь дисперсной фазы, эмульгатора и дисперсионной среды перемешивают в течение 5-60 мин до добавления основания для осуществления полимеризации.

От 5 до 10 эквивалентов (относится к образованию каждой амидной связи) основания добавляют к смеси дисперсной фазы и непрерывной фазы. Основанием является апротонное, ненуклеофильное и растворимое в дисперсной фазе основание. Предпочтительно основание является апротонным, ненуклеофильным, хорошо растворимым как в дисперсной фазе, так и в ДМСО. Более предпочтительно основание является апротонным, ненуклеофильным, хорошо растворимым как в дисперсной фазе, так и в ДМСО, аминным основанием и нетоксичным. Наиболее предпочтительно основанием является N,N,N',N'-тетраметилэтилендиамин (TMEDA). Перемешивание в присутствии основания продолжается в течение от 1 до 16 ч.

В течение перемешивания капельки дисперсной фазы делаются твердыми с образованием сшитых шариков гидрогеля согласно изобретению, которые могут быть собраны и фракционированы по размеру. Фракционирование осуществляют на вибрационной, непрерывного действия просеивающей машине с диаметром пор деки 75 мкм и 32 мкм для получения микрочастиц гидрогеля согласно изобретению.

Другим аспектом настоящего изобретения являются конъюгаты инсулин-линкер формулы (IIIa) и (IIIb)

где Nε-инсулин относится к инсулину, связанному посредством боковой цепи одного остатка лизина; и

Другим аспектом настоящего изобретения являются реагенты инсулин-линкер D-L,

где

D представляет собой фрагмент инсулина; и

L является биологически неактивным линкерным реагентом, представленным формулой (IV),

где пунктирная линия указывает на место присоединения к одной из аминогрупп инсулина с образованием амидной связи;

X является C(R3R3a); или N(R3);

R1a, R3a независимо выбирают из группы, состоящей из H, NH(R2b), N(R2b)C(O)R4 и C1-4алкила;

R1, R2, R2a, R2b, R3, R4 независимо выбирают из группы, состоящей из H и С1-4алкила,

где группа L замещена одним L2∗ и необязательно также замещена, при условии, что водород, отмеченный звездочкой в формуле (IV), не заменен на заместитель и где

L2∗ является спейсером, соединенным с L и содержащим химическую функциональную группу, предназначенную для конъюгирования с реакционноспособным биоразрушаемым гидрогелем.

Предпочтительно R2 в формуле (IV) заменен на L2∗.

Предпочтительно R1 в формуле (IV) заменен на L2∗.

Предпочтительно X в формуле (IV) означает N(R3).

Более предпочтительно X в формуле (IV) означает C(R3R3a) и R3a означает N(R2b)C(O)4.

Более предпочтительно X в формуле (IV) является C(R3R3a) и R3a заменен на L2∗.

Даже более предпочтительно X в формуле (IV) является C(R3R3a), R3a является N(R2b)-L2∗.

Предпочтительно L в формуле (IV) также не замещен.

Предпочтительно L2∗ в формуле (IV) содержит тиоловую группу.

Предпочтительно L2∗ в формуле (IV) содержит малеимидную группу.

Гидрогель для пролекарства согласно настоящему изобретению может быть получен способами приготовления в виде микрочастиц. В предпочтительном варианте осуществления изобретения реакционноспособный гидрогель имеет определенную форму, такую как ячейка или стент. Наиболее предпочтительно гидрогель сформирован в виде шариков из микрочастиц, которые могут быть введены в виде подкожной или внутримышечной инъекции посредством стандартного шприца. Такие мягкие шарики могут иметь диаметр между 1 и 500 микрометрами.

Предпочтительно микрочастицы имеют диаметр между 10 и 100 микрометрами, если их суспендируют в изотоничной водной буферной смеси, более предпочтительно диаметр составляет между 20 и 100 микрометрами, наиболее предпочтительно диаметр составляет между 25 и 80 микрометрами.

Предпочтительно микрочастицы могут быть введены посредством инъекции шприцом с внутренним диаметром иглы менее чем 0,3 мм, более предпочтителен внутренний диаметр иглы менее чем 0,175 мм и наиболее предпочтительно внутренний диаметр иглы составляет менее чем 0,16 мм.

Понятно, что термины “могут быть введены посредством инъекции”, “инъецируемые” или “подача” относится к комбинации факторов, таких как определенное усилие, применяемое к поршню шприца, содержащего биоразрушаемый гидрогель согласно изобретению, набухающий в жидкости при определенной концентрации (масс./об.) и при определенной температуре, игла заданного внутреннего диаметра, соединенная с выходным отверстием такого шприца, и время, требуемое для выдавливания определенного объема биоразрушаемого гидрогеля согласно изобретению из шприца через иглу.

Для того чтобы произвести подачу, объем 1 мл пролекарств инсулина согласно изобретению, набухающих в воде до концентрации по меньшей мере 5% (масс./об.) и содержащихся в шприце, имеющем поршень диаметром 4,7 мм, может быть выдавлен при комнатной температуре в течение 10 секунд с применением усилия, менее чем 50 ньютон.

Предпочтительно подачу осуществляют для пролекарства инсулина согласно изобретению, набухающего в воде до концентрации приблизительно 10% (масс./об.).

Кроме того, одноступенчатый способ осуществляют, чтобы избирательно ацилировать единственную свободную ε-аминогруппу, обнаруженную в В-цепи инсулина и его аналогов, ацилирующим средством, содержащим защищенную тиоловую или другую функциональную группу. Относительно рекомбинантного человеческого инсулина, инсулина гларгина и инсулина аспарта, сайтом ацилирования является ε-аминогруппа LysB29, в случае инсулина лизпро, сайтом ацилирования является ε-аминогруппа LysB28, и в случае инсулина глулизина, сайтом ацилирования является ε-аминогруппа LysB3. Понятно, что указанный способ не ограничивается упомянутым ранее инсулином и аналогами инсулина, но может быть использован для других аналогов инсулина, поскольку они содержат ε-аминогруппы, и специалист в данной области сможет идентифицировать соответствующий остаток лизина, подходящий для ацилирования.

Таким образом, другим аспектом настоящего изобретения является способ ацилирования ε-аминогруппы инсулина или аналога инсулина, имеющего одну или более свободных α-аминогрупп и свободную ε-аминогруппу, ацилирующим средством, содержащим одну или более защищенных функциональных групп, который включает взаимодействие инсулина или аналога инсулина с подходящим ацилирующим средством, содержащим одну или более защищенных функциональных групп, при рН от 8,0 до ниже 9,0 в полярном растворителе. Понятно, что следует использовать только такие защитные группы, которые является устойчивыми в описанных выше условиях.

Реакцию осуществляют путем взаимодействия ацилирующего средства, такого как линкерный реагент, который содержит одну или более защищенных функциональных групп, с ε-аминогруппой инсулина или аналога инсулина при щелочных условиях с рН, колеблющемся приблизительно от 8,00 до ниже 9,0, предпочтительно от 8,0 до 8,9, более предпочтительно от 8,3 до 8,7, в полярном растворителе, таком как водные смеси, например, метанола, этанола, пропанола, изопропанола, ДМСО, ДМФ, NMP, диметилацетамида, ацетонитрила.

Другим аспектом настоящего изобретения является вещество инсулин, характеризующееся наличием ацильной группы, связанной с ε-азота инсулина или аналога инсулина, и где такая ацильная группа имеет одну или более защищенных функциональных групп.

Другим аспектом настоящего изобретения является фармацевтическая композиция, содержащая пролекарство согласно настоящему изобретению или его фармацевтически приемлемую соль вместе с фармацевтически приемлемым наполнителем. Фармацевтическая композиция также описана в следующих параграфах.

Композиция пролекарства инсулин-гидрогель может быть представлена в виде суспензионной композиции или в виде сухой композиции. Предпочтительно, фармацевтическая композиция пролекарства инсулин-гидрогель является сухой композицией. Подходящими способами сушки являются, например, сушка распылением и лиофилизация (сушка вымораживанием). Предпочтительно фармацевтическую композицию пролекарства инсулин-гидрогель сушат лиофилизацией.

Предпочтительно пролекарство инсулин-гидрогель достаточно дозируют в композиции для достижения терапевтически эффективного количества инсулина в течение по меньшей мере трех дней в один прием. Более предпочтительно одного приема пролекарства инсулин-гидрогель достаточно для одной недели.

Фармацевтическая композиция пролекарства инсулин-гидрогель согласно настоящему изобретению содержит один или более наполнителей.

Наполнители, используемые в парентеральных композициях, могут быть классифицированы как буферные средства, средства, изменяющие изотоничность, консерванты, стабилизирующие средства, противопоглощающие средства, средства, защищающие от окисления, загустители/повышающие вязкость средства или другие дополнительные средства. В некоторых случаях указанные ингредиенты могут иметь двойные или тройные функции. Композиции пролекарств инсулин-гидрогель согласно настоящему изобретению содержат один или более чем один наполнителей, выбранных из группы, состоящей из следующего:

(i) Буферные средства: физиологически допустимые буферы для поддержания рН в желаемом диапазоне, такие как фосфат натрия, бикарбонат, сукцинат, гистидин, цитрат и ацетат, сульфат, нитрат, хлорид, пируват. Антациды, такие как Mg(OH)2 или ZnCO3, также могут быть использованы. Буферную емкость можно регулировать, чтобы подобрать условия, наиболее чувствительные к рН-стабильности.

(ii) Средства, изменяющие изотоничность: чтобы снизить до минимума боль, возникающую в результате клеточного повреждения из-за разницы осмотического давления при инъекции препарата-депо. Глицерин и хлорид натрия являются примерами. Эффективные концентрации можно определить путем осмометрии, используя допустимую осмоляльность 285-315 мОсмол/кг сыворотки.

(iii) Консерванты и/или противомикробные средства: многодозовые парентеральные препараты требуют добавления консервантов при достаточной концентрации для снижения риска заражения больных инфекциями при инъецировании, и поэтому были установлены соответствующие регламентирующие требования. Обычные консерванты включают м-крезол, фенол, метилпарабен, этилпарабен, пропилпарабен, бутилпарабен, хлорбутанол, бензиловый спирт, фенилмеркурнитрат, тимерозол, сорбиновую кислоту, сорбат калия, бензойную кислоту, хлоркрезол и бензалкония хлорид.

(iv) Стабилизирующие средства: стабилизация достигается путем усиления белок-стабилизирующих сил, дестабилизацией денатурированного состояния или путем прямого связывания наполнителей с белком. Стабилизирующими средствами могут быть аминокислоты, такие как аланин, аргинин, аспарагиновая кислота, глицин, гистидин, лизин, пролин, сахара, такие как глюкоза, сахароза, трегалоза, полиолы, такие как глицерин, маннит, сорбит, соли, такие как фосфат калия, сульфат натрия, хелатирующие средства, такие как ЭДТА, гексафосфат, лиганды, такие как ионы двухвалентных металлов (цинк, кальций и т.д.), другие соли или органические молекулы, такие как фенольные производные. Кроме того, олигомеры или полимеры, такие как циклодекстрины, декстран, дендримеры, ПЭГ или PVP или протамин или HAS могут быть использованы.

(v) Противопоглощающие средства: главным образом, ионные и неионные поверхностно-активные вещества или другие белки или растворимые полимеры используют для покрытия или адсорбции конкурентно на внутренней поверхности контейнера с композицией. Например, полоксамер (Плюроник F-68), ПЭГ додециловый сложный эфир (Brij 35), полисорбат 20 и 80, декстран, полиэтиленгликоль, ПЭГ-полигистидин, БСА и HSA и желатины. Выбор концентрации и тип наполнителя зависит от эффекта, которого следует избегать, но обычно монослой поверхностно-активного вещества формируется у поверхности немного выше СМС-величины.

(vi) Лио- и/или криопротектанты: В процессе сушки замораживанием или распылением наполнители могут противодействовать дестабилизирующим эффектам, возникающим в результате расщепления водородных связей и удаления воды. С этой целью сахара и полиолы могут быть использованы, но соответствующие положительные эффекты также наблюдали при использовании поверхностно-активных веществ, аминокислот, неводных растворителей и других пептидов. Трегалоза является наиболее эффективным средством для снижения вызванной увлажнением агрегации и также улучшает термостабильность, потенциально появляющуюся при воздействии воды на гидрофобные группы белка. Маннит и сахароза также могут быть использованы либо как единственный лио/криопротектант, либо в комбинации с любым другим средством, где более высокие отношения маннит:сахароза, как известно, усиливают физическую стабильность лиофилизированного материала. Маннит также можно комбинировать с трегалозой. Трегалоза также может быть комбинирована с сорбитом, или сорбит используют в качестве единственного протектанта. Крахмал или производные крахмала также могут быть использованы.

(vii) Средства, защищающие от окисления: антиоксиданты, такие как аскорбиновая кислота, эктоин, метионин, глутатион, монотиоглицерин, морин, полиэтиленимин (PEI), пропилгаллат, витамин E, хелатирующие средства, такие как лимонная кислота, ЭДТА, гексафосфат, тиогликолевая кислота.

(viii) Загустители или повышающие вязкость средства: для торможения оседания частиц в пузырьке и шприце, и их используют, чтобы облегчить перемешивание и ресуспендирование частиц и сделать возможным более легкое инъецирование (т.е. малое усилие, создаваемое на поршень шприца). Подходящими загустителями или повышающими вязкость средствами являются, например, карбомерные загустители, подобные карбополу 940, карбополу Ultrez 10, производные целлюлозы, подобные гидроксипропилметилцеллюлозе (гипромеллоза, HPMC) или диэтиламиноэтилцеллюлозе (DEAE или DEAE-C), коллоидный силикат магния (Veegum) или силикат натрия, гидроксиапатитовый гель, трикальцийфосфатный гель, ксантаны, каррагенаны, подобные Satia gum UTC 30, алифатические поли(гидроксикислоты), такие как поли(D,L- или L-молочная кислота) (PLA) и поли(гликолевая кислота) (PGA) и их сополимеры (PLGA), терполимеры D,L-лактида, гликолида и капролактона, полоксамеры, гидрофильные блоки поли(оксиэтилена) и гидрофобные блоки поли(оксипропилена) для получения трехблочных сополимеров поли(оксиэтилен)-поли(оксипропилен)-поли(оксиэтилен) (например, Pluronic®), сополимер простого и сложного эфиров, такой как сополимер полиэтиленгликольтерефталат/полибутилентерефталат, изобутират ацетата сахарозы (SAIB), декстран или его производные, комбинации декстранов и ПЭГ, полидиметилсилоксан, коллаген, хитозан, поливиниловый спирт (PVA) и производные, полиалкилимиды, поли(акриламид-со-диаллилдиметиламмоний (DADMA)), поливинилпирролидон (PVP), гликозаминогликаны (GAG), такие как дерматансульфат, хондроитинсульфат, кератансульфат, гепарин, гепарансульфат, гиалуронан, ABA трехблочные или AB блочные сополимеры, состоящие из гидрофобных A-блоков, таких как полилактид (PLA) или поли(лактид-со-гликолид) (PLGA), и гидрофильных B-блоков, таких как полиэтиленгликоль (PEG) или поливинилпирролидон. Такие блок-сополимеры, а также описанные выше полоксамеры могут проявлять способность к обратимому терморегулируемому гелеобразованию (жидкое состояние при комнатной температуре для облегчения введения и гелеобразное состояние при температуре выше температуры перехода золь-гель при температуре тела после инъекции).

(ix) Способствующее проникновению или диффундирующее средство: средства, изменяющие проницаемость соединительной ткани посредством гидролиза компонентов внеклеточного матрикса в интерстициальном пространстве, такие как, но не ограниченные ими, гиалуроновая кислота, полисахарид, обнаруженные в межклеточном пространстве соединительной ткани. Способствующее проникновению средство, такое как, но не ограниченное им, гиалуронидаза, временно уменьшает вязкость внеклеточного матрикса и способствует диффузии инъецируемых лекарственных средств.

(x) Другие дополнительные средства: такие как смачивающие средства, изменяющие вязкость средства, антибиотики, гиалуронидаза. Кислоты и основания, такие как хлористоводородная кислота и гидроксид натрия, являются вспомогательными средствами, необходимыми для регулирования рН в процессе производства.

Предпочтительно композиция пролекарства инсулин-гидрогель содержит один или более чем один загуститель и/или изменяющее вязкость средство.

Термин “наполнитель” предпочтительно относится к разбавителю, адъюванту или носителю, с которым терапевтическое средство вводят. Таким фармацевтическим связующим могут быть стерилизованные жидкости, такие как вода и масла, включающие продукты нефтепереработки, масла животного, растительного или искусственного происхождения, включающие, но не ограничивающиеся ими, арахисовое масло, соевое масло, минеральное масло, кунжутное масло и тому подобное. Вода является предпочтительным наполнителем, когда фармацевтическую композицию вводят перорально. Физиологический раствор и водный раствор декстрозы являются предпочтительными наполнителями, когда фармацевтическую композицию вводят внутривенно. Физиологический раствор и водный раствор декстрозы и глицерина предпочтительно используют в качестве жидких связующих для инъецируемых растворов. Подходящие фармацевтические связующие включают крахмал, глюкозу, лактозу, сахарозу, желатин, солод, рис, муку, мел, силикагель, стеарат натрия, глицеринмоностеарат, тальк, хлорид натрия, сухое обезжиренное молоко, глицерин, пропиленгликоль, воду, этанол и тому подобного. Композиция, если желательно, также может содержать небольшие количества увлажняющих или эмульгирующих средств или регулирующие рН буферные средства. Указанные композиции могут быть изготовлены в виде растворов, суспензий, эмульсий, таблеток, пилюль, капсул, порошков, препаратов замедленного высвобождения и тому подобного. Композиция может быть изготовлена в виде суппозитория, с обычными связывающими средствами и связующими, такими как триглицериды. Пероральный препарат может включать обычные связующие, такие как фармацевтической чистоты маннит, лактозу, крахмал, стеарат магния, сахарид натрия, целлюлозу, карбонат магния и т.д. Примерами подходящих фармацевтических связующих являются вещества, описанные в “Remington's Pharmaceutical Sciences” автором E.W. Martin. Такие композиции будут содержать терапевтически эффективное количество терапевтического средства, предпочтительно в очищенном виде, вместе с подходящим количеством связующего с тем, чтобы приобрести форму для соответствующего введения больному. Препарат должен соответствовать способу введения.

В общем варианте осуществления настоящего изобретения фармацевтическая композиция согласно настоящему изобретению, приготовлена ли она в сухом виде или в виде суспензии или в другом виде, может быть предназначена для однократного или многократного приема.

В одном варианте осуществления настоящего изобретения сухая композиция пролекарства инсулин-гидрогель предназначена в виде однократной дозы, что означает, что контейнер, в котором она находится, содержит одну фармацевтическую дозу.

Таким образом, в другом аспекте настоящего изобретения композиция предоставлена в виде композиции, содержащей разовую дозу.

Предпочтительно суспензионная композиция является композицией, предназначенной для многократного приема, что означает, что она содержит более чем одну терапевтическую дозу. Предпочтительно, композиция для многократного приема содержит по меньшей мере 2 дозы. Такая композиция для многократного приема инсулин-гидрогель может либо быть использована для разных больных по необходимости, либо может быть предназначена для использования одним больным, где остающиеся дозы хранятся после употребления первой дозы до тех пор, пока не потребуются.

В другом аспекте настоящего изобретения композиция содержится в контейнере. Предпочтительно контейнер представляет собой двухкамерный шприц. В частности, сухая композиция согласно настоящему изобретению содержится в первой камере двухкамерного шприца, и раствор для реконструкции содержится во второй камере двухкамерного шприца.

До использования сухой композиции пролекарства инсулин-гидрогель больным по необходимости сухую композицию реконструируют. Реконструкцию можно осуществлять в контейнере, в котором сухая композиция, содержащая пролекарство инсулин-гидрогель, упакована, таком как пузырек, шприц, двухкамерный шприц, ампула и картридж. Реконструкцию осуществляют путем добавления предопределенного количества растворителя к сухой композиции. Растворителями являются стерилизованные жидкости, такие как вода или буфер, которые также могут содержать добавки, такие как консерванты и/или противомикробные средства. Если композиция, содержащая пролекарство инсулин-гидрогель, представлена в виде однократной дозы, растворитель может содержать один(одно) или более консервантов и/или противомикробных средств. Предпочтительно растворителем является стерилизованная вода. Если композиция, содержащая пролекарство инсулин-гидрогель, представлена в виде композиции, включающей множество доз, предпочтительно, чтобы растворитель содержал один или более консервант и/или противомикробное средство, такое как, например, бензиловый спирт и крезол.

Дополнительный аспект настоящего изобретения относится к способу введения восстановленной композиции, содержащей пролекарство инсулин-гидрогель. Композиция, содержащая пролекарство инсулин-гидрогель, может быть введена посредством инъекции или инфузии, включающей внутрикожное, подкожное, внутримышечное, внутривенное, внутрикостное и внутрибрюшинное введение.

Другим аспектом является способ получения восстановленной композиции, содержащей терапевтически эффективное количество пролекарства инсулин-гидрогель и, необязательно, одно или более фармацевтически приемлемых связующих, где инсулин временно связан с гидрогелем, способ, включающий следующие стадии:

• контакт композиции согласно настоящему изобретению с раствором для реконструкции.

Другим аспектом является восстановленная композиция, содержащая терапевтически эффективное количество пролекарства инсулин-гидрогель и, необязательно, одно или более фармацевтически приемлемых связующих, где инсулин временно связан с гидрогелем, получаемым описанным выше способом.

Другим аспектом настоящего изобретения является способ производства сухой композиции, содержащей пролекарство инсулин-гидрогель. В одном варианте осуществления изобретения такую суспензионную композицию приготавливают путем

(i) смешивания пролекарства инсулин-гидрогель с одним или более наполнителями,

(ii) перенос количества, эквивалентного разовой дозе или множеству доз, в подходящий контейнер,

(iii) сушка композиции в указанном контейнере, и

(iv) герметичная упаковка контейнера.

Подходящими контейнерами являются пузырьки, шприцы, двухкамерные шприцы, ампулы и картриджи.

Другим аспектом является набор из элементов. В случае, когда устройством для введения является только шприц для подкожных введений, тогда набор может включать шприц, иглу и контейнер, содержащий сухую композицию, включающую пролекарство инсулин-гидрогель, для использования со шприцом, и второй контейнер, содержащий растворитель. В более предпочтительных вариантах осуществления изобретения инъекционным устройством является устройство, отличное от простого шприца для подкожных инъекций, и, таким образом, отдельный контейнер с восстановленным пролекарством инсулин-гидрогель приспосабливают для подключения к инъекционному устройству, так что при использовании устройства жидкая композиция в контейнере находится в жидкостном патрубке, соединенном с отверстием устройства для инъекции. Примеры устройств для введения включают, но не ограничиваются ими, шприцы для подкожных инъекций и шприц-ручки. В частности, предпочтительными устройствами для инъекций являются шприц-ручки, в случае которых контейнером является картридж, предпочтительно картридж одноразового действия.

Предпочтительный набор элементов включает иглу и контейнер, содержащий композицию согласно настоящему изобретению и необязательно также содержащий растворитель, причем контейнер приспособлен для использования с иглой. Предпочтительно контейнером является двухкамерный шприц.

В другом аспекте изобретение предоставляет картридж, содержащий композицию, включающую пролекарство инсулин-гидрогель, описанную выше, для использования со шприцом-ручкой. Картридж может содержать одноразовую дозу или множество доз инсулина.

В одном варианте осуществления настоящего изобретения суспензионная композиция, содержащая пролекарство инсулин-гидрогель, не только включает пролекарство инсулин-гидрогель и одно или более чем одно связующее, но также другие биологически активные средства, либо в их свободной форме, либо в виде пролекарств. Предпочтительно, таким дополнительным одним или более одного биологически активным средством является пролекарство, более предпочтительно гидрогелевое пролекарство. Такие биологически активные средства включают, но не ограничиваются ими, соединения следующих классов:

(i) сульфонилмочевины, такие как, например, хлорпропамид, толазамид, толбутамид, глибурид, глипизид, глимепирид и тому подобное,

(ii) меглитиниды, такие как, например, репаглинид,

(iii) глюкагоноподобный пептид-1 (GLP-1) и его миметики, глюкозо-инсулинотропный пептид (GIP) и его миметики, эксендин и его миметики и ингибиторы дипептилпротеазы (DPPIV),

(iv) бигуаниды, такие как, например, метформин,

(v) тиазолидиндионы, такие как, например, розиглитазон, пиоглитазон, троглитазон, изаглитазон (известный как MCC-555), 2-[2-[(2R)-4-гексил-3,4-дигидро-3-оксо-2H-1,4-бензоксазин-2-ил]этокси]бензолуксусная кислота и тому подобное,

(vi) GW2570 и тому подобное,

(vii) модуляторы рецептора ретиноида-Х (RXR), такие как, например, таргретин, 9-цис-ретиноевая кислота и тому подобное,

(viii) другие инсулин-сенсибилизирующие средства, такие как, например, INS-1, ингибиторы PTP-1B, ингибиторы GSK3, ингибиторы гликогенфосфорилазы, ингибиторы фруктозо-1,6-бисфосфатазы и тому подобное,

(ix) инсулины, включающие инсулины регулярного или короткого действия, промежуточного действия и длительного действия инсулины, ингалируемый инсулин и аналоги инсулина, такие как молекулы инсулина с минорными различиями в природной последовательности аминокислот,

(x) малая молекула имитирует инсулин, включающая, но не ограниченная ими, L-783281, TE-17411 и тому подобное,

(xi) ингибиторы котранспортера Na-глюкозы, такие как T-1095, T-1095A, флоризин и тому подобное,

(xii) агонисты амилина, которые включают, но не ограничиваются ими, прамлинтид и тому подобное,

(xiii) антагонисты глюкагона, такие как AY-279955, и тому подобное.

Кроме антидиабетических средств, биоактивными соединениями могут быть средства от ожирения, такие как орлистат, ингибитор панкреатической липазы, который предотвращает расщепление и абсорбцию жира; или сибутрамин, подавляющее аппетит средство и ингибитор обратного захвата серотонина, норэпинефрин и дофамин в головном мозге, факторы роста, увеличивающие мобилизацию жира (например, гормон роста, IGF-1, фактор, высвобождающий гормон роста), оксинтомодулин и модуляторы грелина. Другие потенциальные биоактивные средства от ожирения включают, но не ограничиваются ими, подавляющие аппетит средства, действующие посредством адренергических механизмов, такие как бензфетамин, фенметразин, фентермин, диэтилпропион, мазиндол, сибутрамин, фенилпропаноламин или эфедрин; подавляющие аппетит средства, действующие посредством серотонинергических механизмов, такие как квипазин, флуоксетин, сертралин, фенфлурамин или дексфенфлурамин; подавляющие аппетит средства, действующие посредством дофаминовых механизмов, например, апоморфин; подавляющие аппетит средства, действующие посредством гистаминергических механизмов (например, миметики гистамина, модуляторы Н3-рецепторов); усиливающие расход энергии средства, такие как агонисты бета-3 аденергических рецепторов и стимуляторы функции разобщающего белка; лептин и миметики лептина (например, метрелептин); антагонисты нейропептида Y; модуляторы рецепторов меланокортина-1, -3 и -4; агонисты холецистокинина; миметики глюкагоно-подобного пептида-1 (GLP-1) и аналоги (например, эксендин); андрогены (например, дегидроэпиандростерон и производные, такие как этиохоландион), тестостерон, анаболические стероиды (например, оксандролон) и стероидные гормоны; антагонисты рецептора галанина; цитокиновые средства, такие как цилиарный нейротрофический фактор; ингибиторы амилазы; агонисты/миметики энтеростатина; антагонисты орексина/гипокретина; антагонисты урокортина; агонисты бомбезина; модуляторы протеинкиназы А; миметики кортикотропин-рилизинг фактора; миметики кокаин- и амфетамин-регулируемого транскрипта; миметики пептида, кодируемого геном кальцитонина; и ингибиторы синтазы жирных кислот.

В альтернативном варианте осуществления изобретения композицию, содержащую пролекарство инсулин-гидрогель согласно настоящему изобретению, комбинируют со вторым биологически активным соединением таким способом, что пролекарство инсулин-гидрогель вводят больному по необходимости вначале с последующим введением второго соединения. Альтернативно, композицию, содержащую пролекарство инсулин-гидрогель, вводят больному по необходимости после введения другого соединения тому же больному.

Еще другим аспектом настоящего изобретения является пролекарство согласно настоящему изобретению или фармацевтическая композиция согласно настоящему изобретению для использования в качестве лекарственного препарата.

Еще другим аспектом настоящего изобретения является пролекарство согласно настоящему изобретению или фармацевтическая композиция согласно настоящему изобретению для использования в способе лечения или предотвращения заболеваний или нарушений, которые можно лечить инсулином.

Такими заболеваниями или нарушениями являются, например, гипергликемия, предиабет, нарушение толерантности к глюкозе, диабет типа I, диабет типа II, синдром X, ожирение, гипертензия.

Пациентами, требующими лечения композициями инсулина длительного действия, описанными в настоящем изобретении, являются пациенты с высоким риском развития сопутствующих заболеваний. Соответственно, комбинацию инсулина длительного действия согласно настоящему изобретению с соответствующими биоактивными соединениями можно использовать, например, для предотвращения, замедления развития или лечения заболеваний и нарушений, выбранных из группы, состоящей из гипертензии (включающей, но не ограничивающейся ими, изолированную систолическую гипертензию и семейную дислипидемическую гипертензию), застойной сердечной недостаточности, гипертрофии левого желудочка, болезни периферических артерий, диабетической ретинопатии, дегенерации желтого пятна, катаракты, диабетической нефропатии, гломерулосклероза, хронической почечной недостаточности, диабетической нейропатии, синдрома Х, предменструального синдрома, ишемической болезни сердца, стенокардии, тромбоза, атеросклероза, инфаркта миокарда, преходящего нарушения мозгового кровообращения, удара, рестеноза сосуда, гипергликемии, гиперинсулинемии, гиперлипидемии, гипертриглицеридемии, инсулинорезистентности, нарушения метаболизма глюкозы, состояний нарушения толерантности к глюкозе, нарушенной гликемии натощак, ожирения, эректильной дисфункции, кожных заболеваний и нарушений со стороны соединительной ткани, диабетической стопы и язвенного колита, эндотелиальной дисфункции и нарушения податливости сосудов.

Предотвращение, замедление развития или лечение заболеваний и нарушений, выбранных из указанной выше группы, может быть достигнуто путем комбинирования композиции, содержащей инсулин длительного действия согласно настоящему изобретению по меньшей мере с одним биоактивным соединением, выбранным из классов лекарственных средств, используемых для лечения описанных выше состояний, включая антагонисты АТ1-рецептора; ингибиторы ангиотензин-превращающего фермента (АСЕ); ингибиторы ренина; блокаторы бета-адренергических рецепторов; блокаторы альфа-адренергических рецепторов; блокаторы кальциевых каналов; ингибиторы альдостеронсинтазы; антагонисты рецепторов альдостерона; ингибиторы нейтральной эндопептидазы (NEP); ингибиторы двойного действия ангиотензин-превращающего фермента/нейтральной эндопептидазы (ACE/NEP); антагонисты рецепторов эндотелина; диуретики; статины; нитраты; антикоагулянты; натрийуретические пептиды; препараты наперстянки; модуляторы PPAR.

В случае биологически активных средств пролекарства, особенно пролекарства, включающие гидрогель, содержат одну или более кислотных или основных групп, изобретение также включает их соответствующие фармацевтически или токсикологически приемлемые соли, в частности, их фармацевтически приемлемые соли. Таким образом, пролекарства, которые содержат кислотные группы, могут быть использованы согласно изобретению, например, в качестве солей щелочных металлов, солей щелочноземельных металлов или аммониевых солей. Точнее, примеры таких солей включают натриевые соли, калиевые соли, кальциевые соли, магниевые соли или соли с аммиаком или органическими аминами, такими как, например, этиламин, этаноламин, триэтаноламин или аминокислоты. Пролекарства, которые содержат одну или более основных групп, т.е. групп, которые могут быть протонированы, могут быть представлены и использованы согласно изобретению в виде их аддитивных солей с неорганическими или органическими кислотами. Примеры подходящих кислот включают хлористоводородную кислоту, бромистоводородную кислоту, фосфорную кислоту, серную кислоту, азотную кислоту, метансульфокислоту, пара-толуолсульфокислоту, нафталиндисульфокислоты, щавелевую кислоту, уксусную кислоту, винную кислоту, молочную кислоту, салициловую кислоту, бензойную кислоту, муравьиную кислоту, пропионовую кислоту, триметилуксусную кислоту, диэтилуксусную кислоту, малоновую кислоту, янтарную кислоту, пимелиновую кислоту, фумаровую кислоту, малеиновую кислоту, яблочную кислоту, сульфаминовую кислоту, фенилпропионовую кислоту, глюконовую кислоту, аскорбиновую кислоту, изоникотиновую кислоту, лимонную кислоту, адипиновую кислоту и другие кислоты, известные специалисту в данной области. Если пролекарства одновременно содержат кислотные и основные группы в молекуле, изобретение также включает, кроме указанных выше солевых форм, внутренние соли или бетаины (цвиттерионы). Соответствующие соли могут быть получены общепринятыми способами, известными специалисту в данной области, подобно, например, взаимодействию их с органической или неорганической кислотой или основанием в растворителе или диспергирующем средстве, или анионному обмену или катионному обмену с другими солями. Настоящее изобретение также включает все соли пролекарств, которые из-за их низкой физиологической совместимости не используются прямо в качестве фармацевтических препаратов, но которые могут быть использованы, например, в качестве промежуточных соединений для химических реакций или для приготовления фармацевтически приемлемых солей.

Термин “фармацевтически приемлемый” означает, что он утвержден надзорным органом, таким как EMEA (Европа) и/или FDA (США) и/или любым другим национальным надзорным органом, для использования у животных, предпочтительно у людей.

Еще другим аспектом настоящего изобретения является способ лечения, контролирования, замедления или предотвращения у больного млекопитающего, предпочтительно у человека, при необходимости лечения одного или более состояний, включающий введение указанному больному терапевтически эффективного количества пролекарства согласно настоящему изобретению или фармацевтической композиции согласно настоящему изобретению или его фармацевтически приемлемой соли.

На фиг.1a представлена UPLC хроматограмма конъюгата инсулин-линкер 12a.

На фиг.1b представлена UPLC хроматограмма конъюгата инсулин-линкер 12b.

На фиг.2 представлена средняя концентрация инсулина в плазме животного 1-10 после однократной подкожной дозы испытуемого препарата 11a, содержащего 6 мг инсулина, у здоровых крыс в течение 2-недельного периода (планки погрешностей даны как ± стандартное отклонение, которое определено для всех 10 животных, t0 величины взяты в течение 3 дней до дозировки).

На фиг.3 показана средняя концентрация инсулина в плазме животного 1-8 после однократной дозы подкожно испытуемого препарата 11da, содержащего 3 мг инсулина, у здоровых крыс в течение периода 13 дней (планки погрешностей даны как ± стандартное отклонение, которое определено для всех 8 животных, t0 величины взяты в течение 1 дня до дозировки).

На фиг.4 показана концентрация инсулина в плазме (квадраты серого цвета) и уровень глюкозы в крови (кружки черного цвета) после однократной дозы подкожно испытуемого препарата 11da, содержащего 6,4 мг инсулина, у крыс с диабетом (n=7) (планки погрешностей даны как ± стандартное отклонение, которое определено для всех 7 животных, t0 величины взяты в течение 4 дней до дозировки).

На фиг.5 показан средний уровень инсулина в плазме после однократной дозы подкожно, содержащей 8 мг/кг испытуемого препарата 11db, у здоровых крыс в течение первых 24 часов после дозировки (анализ выброса). 8 крыс разделяли на 2 группы и образцы крови для фармакокинетики отбирали, чередуя между обеими группами. Ни в одной из групп не был заметен эффект выброса (планки погрешностей даны как ± стандартное отклонение, которое определено для всех животных на группу, t0 величины взяты в течение 1 дня до дозировки).

На фиг.6 показана концентрация инсулина в плазме (квадраты серого цвета) уровень глюкозы в крови (кружки черного цвета) в течение 4-недельного периода после подкожных доз 8 мг/кг испытуемого препарата 11da, вводимых один раз в неделю в течение 3 недель, у крыс с диабетом (n=8) (планки погрешностей даны как ± стандартное отклонение, которое определено для всех 8 животных, t0 величины взяты в течение 3 дней до дозировки).

На фиг.7 показана средняя концентрация инсулина в плазме животного 1-8 (животное 1-4 и животное 5-8 для 0,3, 1 ч, 2 и 4 ч величины, соответственно) после однократной инъекции подкожно инсулина 12 мг/кг, содержащегося в испытуемом препарате 11dc, у здоровых крыс в течение периода 13 дней (планки погрешностей даны как ± стандартное отклонение, которое определено для всех 8 животных, t0 величины взяты в течение 4 дней до дозировки).

На фиг.8 показано наложение высвобождения инсулина и деградации гидрогеля инсулин-линкер-гидрогеля 11а. Количество инсулина, содержащееся в инсулин-линкер-гидрогеле (треугольники), и высвобождение каркасных фрагментов (кружочки) при инкубации инсулин-линкер-гидрогеля при рН 7,4 и 37°С отложено на графике против времени инкубации.

На фиг.9 представлен график, изображающий кривые усилия против скорости потока при использовании иглы 30 G. Символьные знаки: черные квадраты = этиленгликоль; черные треугольники = вода; черные точки = пролекарство инсулин-гидрогель.

Примеры

Материалы и методы

Рекомбинантный человеческий инсулин получали от компании Biocon Ltd., Bangalore, India.

Продукт ПЭГ-амин, представленный 4 ветвями полимера, 5 кДа получали от компании JenKem Technology, Beijing, P.R. China.

N-(3-малеимидопропил)-21-амино-4,7,10,13,16,19-гексаоксагенэйкозановой кислоты NHS-сложный эфир (Mal-ПЭГ6-NHS) получали от компании Celares GmbH, Berlin, Germany.

2-хлортритилхлоридную смолу, HATU, N-циклогексилкарбодиимид-N'-метилполистирол и аминокислоты приобретали от компании Merck Biosciences GmbH, Schwalbach/Ts, Germany, если не указано иное.

Fmoc(NMe)-Asp(OtBu)-OH получали от компании Bachem AG, Bubendorf, Switzerland. S-тритил-6-меркаптогексановую кислоту приобретали от компании Polypeptide, Strasbourg, France. Используемые аминокислоты были L-конфигурации, если не указано иное.

Все другие вещества были от компании Sigma-ALDRICH Chemie GmbH, Taufkirchen, Germany.

Твердофазный синтез осуществляли на 2-хлортритилхлоридной смоле (TCP) с нагрузкой 1,3 ммоль/г. Шприцы, снабженные полипропиленовыми фриттами, использовали в качестве реакционных сосудов.

Посадку первой аминокислоты на смолы осуществляли согласно инструкциям производителей.

Удаление группы Fmoc:

Для удаления Fmoc-защитной группы, смолу перемешивали со смесью 2/2/96 (об./об./об.) пиперидин/DBU/ДМФ (два раза, 10 мин каждый раз) и промывали ДМФ (десять раз).

Удаление Fmoc-группы у Fmoc-Aib-нагруженных смол:

Удаление Fmoc-группы у иммобилизованного Fmoc-Aib-OH достигали путем перемешивания смолы в смеси ДМФ/пиперидин 4/1 (об./об.) при 50°С в течение 20 мин (2 раза).

Протокол расщепления для 2-хлортритилхлоридной смолы:

по окончании синтеза, смолу промывали DCM, сушили в вакууме и обрабатывали два раза в течение 30 минут смесью 6/4 (об./об.) DCM/HFIP. Элюаты объединяли, летучие соединения удаляли в токе азота, и полученный сырой продукт очищали ОФ-ВЭЖХ. Фракции после ВЭЖХ, содержащие продукт объединяли и лиофилизировали.

Аминсодержащие продукты, полученные в виде ТФУ-солей, превращали в соответствующие HCl-соли, используя ионообменную смолу (Discovery DSC-SAX, Supelco, USA). Указанную стадию осуществляли в случае, если остаточная кислота ТФУ, как полагали, препятствует, например, последующей реакции сочетания.

Очистка посредством ОФ-ВЭЖХ:

ОФ-ВЭЖХ осуществляли на колонке 100×20 мм или 100×40 мм C18 ReproSil-Pur 300 ODS-3 5 мкм (Dr. Maisch, Ammerbuch, Germany), соединенной с системой Waters 600 ВЭЖХ и детектором абсорбции 2487 фирмы Waters. Линейные градиенты раствора A (0,1% ТФУ в H2O) и раствора B (0,1% ТФУ в ацетонитриле) использовали. Фракции с ВЭЖХ, содержащие продукт, лиофилизировали.

Флэш-хроматография:

Очистки флэш-хроматографией осуществляли посредством системы lsolera One system из Biotage AB, Sweden, используя силикагельные патроны Biotage KP-Sil и н-гептан и этилацетат в качестве элюентов. Продукты подвергали детекции при 254 нм.

Относительно шариков гидрогеля, шприцы, снабженные полипропиленовыми фриттами, использовали в качестве реакционных сосудов или на стадиях промывки.

Аналитические методы

Аналитическую сверхэффективную ЖХ (UPLC) осуществляли посредством системы Waters Acquity, снабженной колонкой Waters BEH300 C18 (2,1×50 мм, размер частиц 1,7 мкм), соединенной с масс-спектрометром LTQ Orbitrap Discovery от компании Thermo Scientific.

МС (масс-спектрометрия) ПЭГ-продуктов обнаружила серию фрагментов (CH2CH2O)n вследствие полидисперсности ПЭГ исходных материалов. Для облегчения интерпретации данных, только один единственный характерный сигнал m/z представлен в примерах. МС конъюгатов инсулина представлена для характерных изотопов и относится к аддуктам, включающим четыре протона [M+4H]4+.

Гель-фильтрацию (SEC) осуществляли, используя систему Amersham Bioscience AKTA основная, снабженную колонкой Superdex200 5/150 GL (Amersham Bioscience/GE Healthcare) с входным фильтром 0,45 мкм, если не указано иное. В качестве подвижной фазы использовали 20 мМ фосфата натрия, 140 мМ NaCl, pH 7,4.

Пример 1

Синтез каркасного реагента 1g

Каркасный реагент 1g синтезировали из ПЭГ5000-амина, представленного в виде 4 ветвей полимеров, согласно следующей схеме:

Для синтеза соединения 1b ПЭГ5000-амин, представленный в виде 4 ветвей полимеров (молекулярная масса приблизительно 5200 г/моль, 5,20 г, 1,00 ммоль, HCl-соль), растворяли в 20 мл ДМСО (безводный). Boc-Lys(Boc)-OH (2,17 г, 6,25 ммоль) в 5 мл ДМСО (безводный), EDC HCl (1,15 г, 6,00 ммоль), HOBt-H2O (0,96 г, 6,25 ммоль) и коллидин (5,20 мл, 40 ммоль) добавляли. Реакционную смесь перемешивали в течение 30 мин при кт. Реакционную смесь разбавляли 1200 мл дихлорметана и промывали 600 мл 0,1н H2SO4 (2×), насыщенным раствором соли (1×), 0,1M NaOH (2×) и смесью 1/1 (об./об.) насыщенный раствор соли/вода (4×). Водные слои вновь экстрагировали 500 мл DCM. Органические фазы сушили над Na2SO4, фильтровали и упаривали с получением 6,3 г сырого продукта 1b в виде бесцветного масла. Соединение 1b очищали ОФ-ВЭЖХ.

Выход 3,85 г (59%) бесцветного стеклообразного продукта 1b.

МС: m/z 1294,4 = [M+5H]5+ (вычислено = 1294,6).

Соединение 1c получали путем перемешивания 3,40 г соединения 1b (0,521 ммоль) в 5 мл метанола и 9 мл 4н HCl в диоксане при кт в течение 15 мин. Летучие вещества удаляли в вакууме. Продукт использовали на следующей стадии без дальнейшей очистки.

МС: m/z 1151,9 = [M+5H]5+ (вычислено = 1152,0).

Для синтеза соединения 1d 3,26 г соединения 1c (0,54 ммоль) растворяли в 15 мл ДМСО (безводный). 2,99 г Boc-Lys(Boc)-OH (8,64 ммоль) в 15 мл ДМСО (безводный), 1,55 г EDC HCl (8,1 ммоль), 1,24 г HOBt-H2O (8,1 ммоль) и 5,62 мл коллидина (43 ммоль) добавляли. Реакционную смесь перемешивали в течение 30 мин при кт.

Реакционную смесь разбавляли 800 мл DCM и промывали 400 мл 0,1н H2SO4 (2×), насыщенным раствором соли (1×), 0,1M NaOH (2×) и смесью 1/1 (об./об.) насыщенный раствор соли/вода (4×). Водные слои вновь экстрагировали 800 мл DCM. Органические фазы сушили с Na2SO4, фильтровали и упаривали с получением стеклообразного сырого продукта.

Продукт растворяли в DCM и осаждали охлажденным (-18°C) диэтиловым эфиром. Указанную процедуру повторяли дважды, и осадок сушили в вакууме.

Выход: 4,01 г (89%) бесцветного стеклообразного продукта 1d, который использовали на следующей стадии без дальнейшей очистки.

МС: m/z 1405,4 = [M+6H]6+ (вычислено = 1405,4).

Соединение 1e получали путем перемешивания раствора соединения 1d (3,96 г, 0,47 ммоль) в 7 мл метанола и 20 мл 4н HCl в диоксане при кт в течение 15 мин. Летучие вещества удаляли в вакууме. Продукт использовали на следующей стадии без дальнейшей очистки.

МС: m/z 969,6 = [M+7H]7+ (вычислено = 969,7).

Для синтеза соединения 1f соединение 1e (3,55 г, 0,48 ммоль) растворяли в 20 мл ДМСО (безводный). Boc-Lys(Boc)-OH (5,32 г, 15,4 ммоль) в 18,8 мл ДМСО (безводный), EDC HCl (2,76 г, 14,4 ммоль), HOBt-H2O (2,20 г, 14,4 ммоль) и 10,0 мл коллидина (76,8 ммоль) добавляли. Реакционную смесь перемешивали в течение 60 мин при кт.

Реакционную смесь разбавляли 800 мл DCM и промывали 400 мл 0,1н H2SO4 (2×), насыщенным раствором соли (1×), 0,1M NaOH (2×) и смесью 1/1 (об./об.) насыщенный раствор соли/вода (4×). Водные слои вновь экстрагировали 800 мл DCM. Органические фазы сушили над Na2SO4, фильтровали и упаривали с получением сырого продукта 1f в виде бесцветного масла.

Продукт растворяли в DCM и осаждали охлажденным (-18°С) диэтиловым эфиром. Указанную стадию повторяли дважды, и осадок сушили в вакууме.

Выход 4,72 г (82%) бесцветного стеклообразного продукта 1f, который использовали на следующей стадии без дальнейшей очистки. Мс: m/z 1505,3 = [M+8H]8+ (вычислено = 1505,4).

Каркасный реагент 1g получали путем перемешивания раствора соединения 1f (молекулярная масса приблизительно 12035 г/моль, 4,72 г, 0,39 ммоль) в 20 мл метанола и 40 мл 4н HCl в диоксане при кт в течение 30 мин. Летучие вещества удаляли в вакууме.

Выход 3,91 г (100%), стеклообразный продукт каркасный реагент 1g.

МС: m/z 977,2 = [M+9H]9+ (вычислено = 977,4).

Альтернативный путь синтеза 1g

Для синтеза соединения 1b к суспензии ПЭГ5000-тетрамина, макромолекула которого состоит из 4 ветвей полимеров (1a) (50,0 г, 10,0 ммоль), в 250 мл изоPrOH (безводный), boc-Lys(boc)-OSu (26,6 г, 60,0 ммоль) и DIEA (20,9 мл, 120 ммоль) добавляли при 45°C и смесь перемешивали в течение 30 мин.

Затем, н-пропиламин (2,48 мл, 30,0 ммоль) добавляли. Через 5 мин раствор разбавляли 1000 мл MTBE и хранили в течение ночи при -20°C без перемешивания. Приблизительно 500 мл супернатанта декантировали и отбрасывали. 300 мл холодного MTBE добавляли и после 1 мин встряхивания продукт собирали фильтрацией через стеклянный фильтр и промывали 500 мл холодного MTBE. Продукт сушили в вакууме в течение 16 ч.

Выход: 65,6 г (74%) 1b в виде белого комковатого твердого вещества.

МС: m/z 937,4 = [M+7H]7+ (вычислено = 937,6).

Соединение 1c получали путем перемешивания соединения 1b с предыдущей стадии (48,8 г, 7,44 ммоль) в 156 мл 2-пропанола при 40°C. Смесь, состоящую из 196 мл 2-пропанола и 78,3 мл ацетилхлорида, добавляли при перемешивании в течение 1-2 мин. Полученный раствор перемешивали при 40°С в течение 30 мин и охлаждали до -30°C в течение ночи без перемешивания. Холодный MTBE 100 мл добавляли, суспензию встряхивали в течение 1 мин и охлаждали в течение 1 ч при -30°С. Продукт собирали фильтрацией через стеклянный фильтр и промывали 200 мл холодного MTBE. Продукт сушили в вакууме в течение 16 ч.

Выход: 38,9 г (86%) 1c в виде белого порошка

МС: m/z 960,1 = [M+6H]6+ (вычислено = 960,2).

Для синтеза соединения 1d к суспензии 1c с предыдущей стадии (19,0 г, 3,14 ммоль) в 80 мл 2-пропанола, boc-Lys(boc)-OSu (16,7 г, 37,7 ммоль) и DIEA (13,1 мл, 75,4 ммоль) добавляли при 45°C и смесь перемешивали в течение 30 мин при 45°C. Далее, н-пропиламин (1,56 мл, 18,9 ммоль) добавляли. Через 5 мин из раствора выпадал осадок при добавлении 600 мл холодного MTBE, и смесь центрифугировали (3000 мин-1, 1 мин). Осадок сушили в вакууме в течение 1 ч и растворяли в 400 мл ТГФ. Диэтиловый эфир 200 мл добавляли, и продукт охлаждали до -30°C в течение 16 ч без перемешивания. Суспензию фильтровали через стеклянный фильтр, и осадок промывали 300 мл холодного MTBE. Продукт сушили в вакууме в течение 16 ч.

Выход: 21,0 г (80%) 1d в виде белого твердого вещества.

МС: m/z 1405,4 = [M+6H]6+ (вычислено = 1405,4).

Соединение 1e получали путем растворения соединения 1d с предыдущей стадии (15,6 г, 1,86 ммоль) в 3н HCl в метаноле (81 мл, 243 ммоль) и перемешивания в течение 90 мин при 40°С. MeOH 200 мл и 700 мл i-PrOH добавляли и смесь хранили в течение 2 ч при -30°C. Для полноты кристаллизации 100 мл MTBE добавляли и суспензию хранили при -30°C в течение ночи. Холодный MTBE 250 мл добавляли, суспензию встряхивали в течение 1 мин и фильтровали через стеклянный фильтр, и осадок промывали 100 мл холодного MTBE. Продукт сушили в вакууме.

Выход: 13,2 г (96%) 1e в виде белого порошка.

МС: m/z 679,1 = [M+10H]10+ (вычислено = 679,1).

Для синтеза соединения 1f к суспензии 1e с предыдущей стадии (8,22 г, 1,12 ммоль) в 165 мл 2-пропанола, boc-Lys(boc)-OSu (11,9 г, 26,8 ммоль) и DIEA (9,34 мл, 53,6 ммоль) добавляли при 45°С и смесь перемешивали в течение 30 мин. Далее, н-пропиламин (1,47 мл, 17,9 ммоль) добавляли. Через 5 мин раствор охлаждали до -18°С в течение 2 ч, затем 165 мл холодного MTBE добавляли, суспензию встряхивали в течение 1 мин и фильтровали через стеклянный фильтр. Далее, осадок на фильтре промывали смесью 4×200 мл холодный MTBE/i-PrOH 4:1 и 1×200 мл холодным MTBE. Продукт сушили в вакууме в течение 16 ч.

Выход: 12,8 г (90%) 1f в виде бледно-желтого комковатого твердого вещества.

МС: m/z 1505,3 = [M+8H]8+ (вычислено = 1505,4).

Каркасный реагент 1g получали путем растворения ПЭГ 5кДа(-LysLys2Lys4(boc)8)4 (1f), макромолекула которого состоит из 4 ветвей полимеров (15,5 г, 1,29 ммоль), в 30 мл MeOH и охлаждения до 0°C. 4н HCl в диоксане (120 мл, 480 ммоль, охлажденный до 0°C) добавляли в течение 3 мин, и баню со льдом отставляли. Через 20 мин 3н HCl в метаноле (200 мл, 600 ммоль, охлажденный до 0°С) добавляли в течение 15 мин и раствор перемешивали в течение 10 мин при комнатной температуре. Продукт из раствора осаждали добавлением 480 мл холодного MTBE и центрифугировали при 3000 об./мин в течение 1 мин. Осадок сушили в вакууме в течение 1 ч и вновь растворяли в 90 мл MeOH, осаждали 240 мл холодного MTBE и суспензию центрифугировали при 3000 об/мин в течение 1 мин. Продукт 1g сушили в вакууме.

Выход: 11,5 г (89%) в виде бледно-желтых хлопьев.

МС: m/z 1104,9 = [M+8H]8+ (вычислено = 1104,9).

Пример 2

Синтез сшивающего реагента 2d

Сшивающий реагент 2d получали из монобензилового эфира адипиновой кислоты (English, Arthur R. et al., Journal of Medicinal Chemistry, 1990, 33(1), 344-347) и ПЭГ2000 согласно следующей схеме:

Раствор ПЭГ 2000 (2a) (11,0 г, 5,5 ммоль) и полуэфира бензиладипата (4,8 г, 20,6 ммоль) в дихлорметане (90,0 мл) охлаждали до 0°C. Дициклогексилкарбодиимид (4,47 г, 21,7 ммоль) добавляли с последующим добавлением каталитического количества DMAP (5 мг), и раствор перемешивали и оставляли достигать комнатной температуры в течение ночи (12 ч). Колбу оставляли при +4°С в течение 5 ч. Твердое вещество фильтровали и растворитель полностью удаляли дистилляцией в вакууме. Остаток растворяли в 1000 мл смеси 1/1 (об./об.) диэтиловый эфир/этилацетат и оставляли при кт в течение 2 часов, в течение которого небольшое количество хлопьевидного твердого вещества образовывалось. Твердое вещество удаляли фильтрацией через слой Celite®. Раствор хранили в прочно закрытой колбе при -30°C в морозильнике в течение 12 ч до завершения кристаллизации. Кристаллический продукт фильтровали через стеклянную фритту и промывали охлажденным диэтиловым эфиром (-30°C). Осадок с фильтра сушили в вакууме. Выход: 11,6 г (86%) 2b в виде бесцветного твердого вещества. Продукт использовали без дальнейшей очистки на следующей стадии.

МС: m/z 813,1 = [M+3H]3+ (вычислено = 813,3).

В 500-мл стеклянном химическом реакторе, ПЭГ2000-бис-адипиновой кислоты бис-бензиловый эфир 2b (13,3 г, 5,5 ммоль) растворяли в этилацетате (180 мл), и добавляли 10% палладий-на-угле (0,4 г). Раствор подвергали гидрированию при давлении 6 бар, 40°С до тех пор, пока потребление водорода не заканчивалось (5-12 ч). Катализатор удаляли фильтрацией через слой Celite®, и растворитель упаривали в вакууме. Выход: 12,3 г (количественный) 2c в виде желтоватого масла. Продукт использовали без дальнейшей очистки на следующей стадии.

МС: m/z 753,1 = [M+3H]3+ (вычислено = 753,2).

Раствор ПЭГ2000-бис-адипиновой кислоты полуэфир 2c (9,43 г, 4,18 ммоль), N-гидроксисукцинимида (1,92 г, 16,7 ммоль) и дициклогексилкарбодиимида (3,44 г, 16,7 ммоль) в 75 мл DCM (безводный) перемешивали в течение ночи при комнатной температуре. Реакционную смесь охлаждали до 0°C, и осадок отфильтровывали. DCM упаривали, и остаток кристаллизовали из ТГФ.

Выход: 8,73 г (85%) сшивающего реагента 2d в виде бесцветного твердого вещества.

МС: m/z 817,8 = [M+3H]3+ (вычислено = 817,9 г/моль).

Пример 3

Получение гидрогелевых шариков (3) и (3a), содержащих свободные аминогруппы

Раствор 275 мг 1g и 866 мг 2d в 14 мл ДМСО добавляли к раствору 100 мг Arlacel P135 (Croda International PIc) в 60 мл гептана. Смесь перемешивали при 700 об/мин посредством специальной металлической мешалки в течение 10 мин при 25°С с образованием суспензии. N,N,N',N'-тетраметилэтилендиамин 1,0 мл добавляли для осуществления реакции полимеризации. Через 2 ч скорость перемешивания снижали до 400 об/мин, и смесь перемешивали в течение дополнительных 16 ч. Добавляли 1,5 мл уксусной кислоты и затем через 10 мин добавляли 50 мл воды. Через 5 мин перемешивание останавливали и водную фазу сливали.

Для фракционирования шариков по размеру суспензию вода-гидрогель просеивали влажной на стальных ситах 75, 50, 40, 32 и 20 мкм меш. Фракции шариков, которые оставались на ситах 32, 40 и 50 мкм меш, объединяли и промывали 3 раза водой, 10 раз этанолом и сушили в течение 16 ч при 0,1 мбар с получением 3 в виде белого порошка.

3a получали, как описано для 3, за исключением использования 1200 мг 1g, 3840 мг 2d, 28,6 мл ДМСО, 425 мг Arlacel P135, 100 мл гептана и 4,3 мл TMEDA. Для определения добавляли 6,6 мл уксусной кислоты и затем через 10 мин добавляли 50 мл воды и 50 мл насыщенного водного раствора хлорида натрия.

Содержание аминогрупп гидрогеля определяли путем конъюгирования fmoc-аминокислоты со свободными аминогруппами гидрогеля и последующего fmoc-определения, как описано Gude, M., J. Ryf, et al. (2002) Letters in Peptide Science 9(4): 203-206. Содержание аминогрупп 3 и 3a было определено и составляло между 0,11 и 0,16 ммоль/г.

Пример 4

Получение функционализированных малеимидом гидрогелевых шариков (4) и (4a) и (4aa) и определение степени замещения малеимидом

Раствор 600 мг Mal-ПЭГ6-NHS (1,0 ммоль) в 4,5 мл смеси 2/1 (об./об.) ацетонитрил/вода добавляли к 200 мг сухих гидрогелевых шариков 3. Добавляли 500 мкл натрийфосфатного буфера (pH 7,4, 0,5M) и суспензию перемешивали в течение 30 мин при комнатной температуре. Шарики 4 промывали пять раз каждый смесью 2/1 (об./об.) ацетонитрил/вода, метанолом и смесью 1/1/0,001 (об./об./об.) ацетонитрил/вода/ТФУ.

4a синтезировали, как описано выше, за исключением использования 3a вместо 3.

Альтернативно, гидрогелевые шарики 3a предварительно промывали смесью 99/1 (об./об.) ДМСО/DIEA, промывали ДМСО и инкубировали в течение 45 мин с раствором Mal-ПЭГ6-NHS (2,0 экв. относительно теоретического количества аминогрупп гидрогеля) в ДМСО. Шарики 4aa промывали два раза ДМСО и три раза сукцинатом pH 3,0 (20 мМ, 1 мМ ЭДТА, 0,01% твин-20). Образец инкубировали в натрийфосфатном буфере pH 6,0 (50 мМ, 50 мМ этаноламин, 0,01% твин-20) в течение 1 ч при кт и промывали пять раз сукцинатом натрия рН 3,0 (20 мМ, 1 мМ ЭДТА, 0,01% твин-20).

Для определения содержания малеимидных групп аликвоту гидрогелевых шариков 4, 4a или 4aa, соответственно, лиофилизировали и взвешивали. Другую аликвоту гидрогелевых шариков 4, 4a или 4aa, соответственно, подвергали взаимодействию с избытком меркаптоэтанола (в 50 мМ натрийфосфатном буфере, 30 мин при кт) и расход меркаптоэтанола определяли, используя тест Эллмана (Ellman, G.L. et al., Biochem. Pharmacol., 1961, 7, 88-95). Содержание малеимида было определено и составляло между 0,11 и 0,13 ммоль/г сухого гидрогеля.

Пример 5

Синтез линкерного реагента 5d

Линкерный реагент 5d синтезировали согласно следующей схеме:

Синтез промежуточного линкерного реагента 5a:

4-метокситритилхлорид (3 г, 9,71 ммоль) растворяли в DCM (20 мл) и добавляли по каплям к раствору этилендиамина (6,5 мл, 97,1 ммоль) в DCM (20 мл). Через два часа раствор выливали в диэтиловый эфир (300 мл) и промывали три раза смесью 30/1 (об./об.) насыщенный раствор соли/0,1M раствор NaOH (50 мл каждый) и один раз насыщенным раствором соли (50 мл). Органическую фазу сушили над Na2SO4 и летучие вещества удаляли при пониженном давлении с получением Mmt-защищенного промежуточного соединения (3,18 г, 9,56 ммоль).

Mmt-защищенное промежуточное соединение (3,18 г, 9,56 ммоль) растворяли в безводном DCM (30 мл). 6-(тритилмеркапто)капроновую кислоту (4,48 г, 11,47 ммоль), PyBOP (5,67 г, 11,47 ммоль) и DIEA (5,0 мл, 28,68 ммоль) добавляли, и смесь перемешивали в течение 30 мин при кт. Раствор разбавляли диэтиловым эфиром (250 мл) и промывали три раза смесью 30/1 (об./об.) насыщенный раствор соли/0,1M раствор NaOH (50 мл каждый) и один раз насыщенным раствором соли (50 мл). Органическую фазу сушили над Na2SO4, и летучие вещества удаляли при пониженном давлении. 5a очищали флэш-хроматографией.

Выход: 5,69 г (8,09 ммоль).

МС: m/z 705,4 = [M+H]+ (вычислено = 705,0).

Синтез промежуточного линкерного реагента 5b:

К раствору 5a (3,19 г, 4,53 ммоль) в безводном ТГФ (50 мл) добавляли BH3∙ТГФ (1M раствор, 8,5 мл, 8,5 ммоль) и раствор перемешивали в течение 16 часов при кт. Далее, BH3∙ТГФ (1M раствор, 14 мл, 14 ммоль) добавляли и перемешивали в течение 16 часов при кт. Реакцию гасили добавлением метанола (8,5 мл), N,N-диметилэтилендиамин (3 мл, 27,2 ммоль) добавляли, и раствор нагревали с обратным холодильником и перемешивали в течение трех часов. Смесь разбавляли этилацетатом (300 мл) при кт, промывали насыщенным водным раствором Na2CO3 (2×100 мл) и насыщенным водным раствором NaHCO3 (2×100 мл). Органическую фазу сушили над Na2SO4 и летучие вещества упаривали при пониженном давлении с получением сырого аминсодержащего промежуточного соединения (3,22 г).

Аминсодержащее промежуточное соединение растворяли в DCM (5 мл), Boc2O (2,97 г, 13,69 ммоль), растворенный в DCM (5 мл) и DIEA (3,95 мл, 22,65 ммоль), добавляли и смесь перемешивали при кт в течение 30 мин. Смесь очищали флэш-хроматографией с получением сырого Boc- и Mmt-защищенного промежуточного соединения (3 г).

МС: m/z 791,4 = [M+H]+, 519,3 = [M-Mmt+H]+ (вычислено = 791,1).

0,4M водный раствор HCl (48 мл) добавляли к раствору Boc- и Mmt-защищенного промежуточного соединения в ацетонитриле (45 мл). Смесь разбавляли ацетонитрилом (10 мл) и перемешивали в течение одного часа при кт. Далее, величину pH реакционной смеси доводили до рН 5,5 путем добавления 5M раствора NaOH, ацетонитрил удаляли при пониженном давлении, и водный раствор экстрагировали DCM (4×100 мл). Объединенные органические фазы сушили над Na2SO4 и летучие вещества удаляли при пониженном давлении. Сырое промежуточное соединение 5b использовали без дальнейшей очистки.

Выход: 2,52 г (3,19 ммоль).

МС: m/z 519,3 = [M+H]+ (MW вычислено = 518,8 г/моль).

Синтез промежуточного линкерного реагента 5c:

5b (780 мг, 0,98 ммоль, ~65% чистоты) и NaCNBH3 (128 мг, 1,97 ммоль) растворяли в безводном метаноле (13 мл). Раствор 2,4-диметоксибензальдегида (195 мг, 1,17 ммоль) в DCM (2 мл) добавляли и смесь перемешивали в течение 2 ч при кт. Растворители упаривали при пониженном давлении и сырой продукт растворяли в DCM и промывали насыщенным раствором NaCO3. Водную фазу экстрагировали три раза DCM и объединенные органические фазы промывали насыщенным раствором соли, сушили над MgSO4 и концентрировали при пониженном давлении. 5c очищали флэш-хроматографией, используя DCM и MeOH в качестве элюентов.

Выход: 343 мг (0,512 ммоль).

МС: m/z 669,37 = [M+H]+, (вычислено = 669,95).

Синтез линкерного реагента 5d:

Fmoc-Aib-нагруженную TCP смолу (980 мг, ~0,9 ммоль) обрабатывали смесью ДМФ/пиперидин для удаления защиты, промывали ДМФ (5 раз) и DCM (6 раз) и сушили в вакууме. Смолу обрабатывали раствором пара-нитрофенилхлорформиата (364 мг, 1,81 ммоль) и коллидина (398 мкл, 3,0 ммоль) в безводном ТГФ (6 мл) и встряхивали в течение 30 мин. Раствор реагента удаляли фильтрацией и смолу промывали ТГФ (5 раз) до добавления раствора амина 5c (490 мг, 0,7 ммоль) и DIEA (1,23 мл, 7,1 ммоль) в безводном ТГФ (6 мл). После встряхивания в течение 18 ч при кт раствор реагента удаляли фильтрацией и смолу промывали DCM (5 раз). Линкерный реагент отщепляли от смолы и очищали ОФ-ВЭЖХ. Фракции продукта доводили до pH 6 путем добавления насыщенного водного раствора NaHCO3 и концентрировали при пониженном давлении. Образовавшуюся суспензию распределяли между насыщенным водным раствором NaCl и DCM, и водный слой экстрагировали DCM. Объединенные органические фракции концентрировали досуха с получением линкерного реагента 5d.

Выход: 230 мг (0,29 ммоль).

МС m/z 798,41 = [M+H]+, (вычислено = 798,1).

Пример 6

Синтез линкерного реагента 6c

Линкерный реагент 6c синтезировали согласно следующей схеме:

Синтез амина 6a:

Трифенилметантиол (11,90 г, 43,08 ммоль) суспендировали в ДМСО (40 мл). DBU (7,41 мл, 49,55 ммоль) и 6-бромгексилфталимид (13,32 г, 42,94 ммоль) добавляли и смесь оставляли для взаимодействия в течение приблизительно 15 мин. Реакционную смесь распределяли между этилацетатом (700 мл) и 0,1M HCl (200 мл). Водную фазу экстрагировали этилацетатом (3×50 мл) и объединенные органические фракции промывали насыщенным раствором NaHCO3 (80 мл) и насыщенным раствором соли (80 мл), сушили над MgSO4, фильтровали и концентрировали. Сырое желтое масло перекристаллизовывали из смеси н-гептан/этилацетат. Промежуточное соединение 6-(S-тритил)меркаптогексилфталимид получали в виде белого твердого вещества (13,3 г, 26,4 ммоль, 62%).

6-(S-тритил)меркаптогексилфталимид (14,27 г, 28,2 ммоль) суспендировали в этаноле (250 мл). Гидрат гидразина (3,45 мл, 70,5 ммоль) добавляли и смесь нагревали с обратным холодильником в течение 2 ч. Смесь фильтровали и фильтрат концентрировали в вакууме. Хлороформ (180 мл) добавляли к остаточному маслу и образовавшуюся суспензию перемешивали при комнатной температуре в течение 1,5 ч. Смесь фильтровали и фильтрат экстрагировали водой (60 мл) и насыщенным раствором соли (60 мл), сушили над MgSO4 и концентрировали с получением сырого 6-(тритилмеркапто)гексиламина (10,10 г, 26,87 ммоль, 95%).

МС: m/z 376,22 = [M+H]+, (вычислено = 376,20).

DIEA (1,41 мл, 8,11 ммоль) и н-бутилхлорформиат (908 мкл, 7,14 ммоль, в 1 мл ТГФ) добавляли к охлажденному (0°C) раствору 6-(тритилмеркапто)гексиламина (2,44 г, 6,49 ммоль) в ТГФ (50 мл). LiAlH4 (1M в ТГФ, 9,74 мл, 9,47 ммоль) добавляли через 30 мин и смесь нагревали с обратным холодильником в течение 90 мин. Добавление воды, 3,75M водного раствора NaOH и воды привело к образованию осадка, который удаляли из смеси фильтрованием. Фильтрат концентрировали в вакууме с получением 6a.

Выход: 2,41 г (6,20 ммоль).

МС: m/z 390,22 = [M+H]+, (вычислено = 390,22).

Синтез промежуточного линкерного реагента 6b:

К раствору 6a (2,1 г, 5,31 ммоль) добавляли 2-бромэтилфталимид (1,96 Г, 7,7 ммоль) и K2CO3 (1,09 г, 7,9 ммоль) и смесь нагревали с обратным холодильником в течение 6 ч. После фильтрования и концентрирования, сырую смесь распределяли между этилацетатом и насыщенным водным раствором NaHCO3. Сырое промежуточное соединение (2-(N-метил-N-(6-тритилмеркаптогексил)амино)этил)фталимид очищали флэш-хроматографией.

Выход: 1,23 г (2,18 ммоль).

МС: m/z: 563,27 = [M+H]+, (вычислено = 563,27).

К раствору (2-(N-метил-N-(6-тритилмеркаптогексил)амино)этил)фталимида (672 мг, 1,19 ммоль) в этаноле (12 мл) добавляли моногидрат гидразина (208 мкл, 4,17 ммоль) и смесь нагревали с обратным холодильником в течение 1 ч. Реакционную смесь фильтровали, концентрировали, и N-(2-аминоэтил)-N-(6-тритилмеркаптогексил)амин очищали ОФ-ВЭЖХ.

Выход: 624 мг (0,944 ммоль).

МС: m/z 433,27 = [M+H]+, (вычислено = 433,26).

К раствору N-(2-аминоэтил)-N-(6-тритилмеркаптогексил)амина (151 мг, 0,229 ммоль) и NaCNBH3 (30 мг, 0,463 ммоль) в безводном MeOH (6 мл) добавляли раствор 2,4-диметоксибензальдегида в безводном CH2Cl2 (0,6 мкл). После перемешивания в течение 1 ч при кт, реакционную смесь концентрировали, вновь растворяли в 2 мл смеси вода/ацетонитрил 1/9 (об./об.) и 6b очищали ОФ-ВЭЖХ.

Выход: 177 мг (0,219 ммоль).

МС: m/z 583,33 = [M+H]+, (вычислено = 583,33).

Синтез линкерного реагента 6c

Линкерный реагент 6c получали из Fmoc-Aib-нагруженной смолы (704 мг, ~0,6 ммоль), как описано для 5d, за исключением использования амина 6b (в виде ТФУ-соли, 430 мг, 0,53 ммоль) вместо 5c.

Выход: 285 мг (0,330 ммоль).

МС: m/z 712,37 = [M+H]+, (вычислено = 712,37).

Пример 7

Синтез линкерного реагента 7f

Линкерный реагент 7f синтезировали согласно следующей схеме:

К охлажденному (0°С) раствору N-метил-N-boc-этилендиамина (0,5 мл, 2,79 ммоль) и NaCNBH3 (140 мг, 2,23 ммоль) в MeOH (10 мл) и уксусной кислоте (0,5 мл) добавляли раствор 2,4,6-триметоксибензальдегида (0,547 мг, 2,79 ммоль) в EtOH (10 мл). Смесь перемешивали при кт в течение 2 ч, подкисляли 2M HCl (1 мл) и нейтрализовали насыщенным водным раствором Na2CO3 (50 мл). Упариванием всех летучих веществ, экстракцией DCM образовавшейся водной суспензии и концентрированием органических фракций получали N-метил-N-boc-N'-tmob-этилендиамин (7a) в виде сырого масла, которое очищали ОФ-ВЭЖХ.

Выход: 593 мг (1,52 ммоль).

МС: m/z 377,35 = [M+Na]+, (вычислено = 377,14).

N-Fmoc-N-Me-Asp(OtBu)-OH (225 мг, 0,529 ммоль) растворяли в ДМФ (3 мл) и добавляли 7a (300 мг, 0,847 ммоль), HATU (201 мг, 0,529 ммоль) и коллидин (0,48 мл, 3,70 ммоль). Смесь перемешивали при кт в течение 2 ч с получением 7b. Для удаления fmoc, пиперидин (0,22 мл, 2,16 ммоль) добавляли, и перемешивание продолжали в течение 1 ч. Уксусную кислоту (1 мл) добавляли и 7c очищали ОФ-ВЭЖХ.

Выход: 285 мг (0,436 ммоль в виде ТФУ-соли).

МС: m/z 562,54 = [M+Na]+, (вычислено = 562,67).

6-тритилмеркаптогексановую кислоту (0,847 г, 2,17 ммоль) растворяли в безводном ДМФ (7 мл). HATU (0,825 г, 2,17 ммоль) и коллидин (0,8 мл, 6,1 ммоль) и 7c (0,78 г, 1,44 ммоль) добавляли. Реакционную смесь перемешивали в течение 60 мин при кт, подкисляли AcOH (1 мл) и очищали ОФ-ВЭЖХ. Фракции продукта нейтрализовали насыщенным водным раствором NaHCO3 и концентрировали. Оставшуюся водную фазу экстрагировали DCM, и 7d выделяли при упаривании растворителя.

Выход: 1,4 г (94%).

Мс: m/z 934,7 = [M+Na]+, (вычислено = 934,5).

К раствору 7d (1,40 мг, 1,53 ммоль) в MeOH (12 мл) и H2O (2 мл) добавляли LiOH (250 мг, 10,4 ммоль) и реакционную смесь перемешивали в течение 14 ч при 70°C. Смесь подкисляли AcOH (0,8 мл) и 7e очищали ОФ-ВЭЖХ. Фракции продукта нейтрализовали насыщенным водным раствором NaHCO3 и концентрировали. Водную фазу экстрагировали DCM и 7e выделяли при упаривании растворителя.

Выход: 780 мг (60%).

МС: m/z 878,8 = [M+Na]+, (вычислено = 878,40).

К раствору 7e (170 мг, 0,198 ммоль) в безводном DCM (4 мл) добавляли DCC (123 мг, 0,59 ммоль) и N-гидроксисукцинимид (114 мг, 0,99 ммоль) и реакционную смесь перемешивали при кт в течение 1 ч. Смесь фильтровали и фильтрат подкисляли 0,5 мл AcOH и 7f очищали ОФ-ВЭЖХ. Фракции продукта нейтрализовали насыщенным водным раствором NaHCO3 и концентрировали. Оставшуюся водную фазу экстрагировали DCM и 7f выделяли при упаривании растворителя.

Выход: 154 мг (0,161 ммоль).

Мс: m/z 953,4 = [M+H]+, (вычислено = 953,43).

Альтернативно, линкерный реагент 7f синтезировали согласно следующей процедуре:

Альтернативная реакционная схема:

К раствору N-метил-N-boc-этилендиамина (2 г, 11,48 ммоль) и NaCNBH3 (819 мг, 12,63 ммоль) в MeOH (20 мл) добавляли 2,4,6-триметоксибензальдегид (2,08 мг, 10,61 ммоль) порциями. Смесь перемешивали при кт в течение 90 мин, подкисляли 3M HCl (4 мл) и перемешивали еще 15 мин. Реакционную смесь добавляли к насыщенному раствору NaHCO3 (200 мл) и экстрагировали 5× CH2Cl2. Объединенные органические фазы сушили над Na2SO4, и растворители упаривали в вакууме. Образовавшийся N-метил-N-boc-N′-tmob-этилендиамин (7a) полностью сушили в высоком вакууме и использовали в следующей реакции без дальнейшей очистки.

Выход: 3,76 г (11,48 ммоль, 89% чистоты, 7a: сдвоенный Tmob-защищенный продукт = 8:1)

МС: m/z 355,22 = [M+H]+, (вычислено = 354,21).

К раствору 7a (2 г, 5,65 ммоль) в CH2Cl2 (24 мл), COMU (4,84 г, 11,3 ммоль), N-Fmoc-N-Me-Asp(OBn)-OH (2,08 г, 4,52 ммоль) и коллидин (2,65 мл, 20,34 ммоль) добавляли. Реакционную смесь перемешивали в течение 3 ч при кт, разбавляли CH2Cl2 (250 мл) и промывали 3× 0,1M H2SO4 (100 мл) и 3× насыщенным раствором соли (100 мл). Водные фазы экстрагировали CH2Cl2 (100 мл). Объединенные органические фазы сушили над Na2SO4, фильтровали, и остаток концентрировали до объема 24 мл. 7g очищали, используя флэш-хроматографию.

Выход: 5,31 г (148%, 6,66 ммоль).

Мс: m/z 796,38 = [M+H]+ (вычислено = 795,37).

К раствору 7g [5,31 г, макс. 4,51 ммоль относительно N-Fmoc-N-Me-Asp(OBn)-OH] в ТГФ (60 мл), DBU (1,8 мл, 3% об./об.) добавляли. Раствор перемешивали в течение 12 мин при кт, разбавляли CH2Cl2 (400 мл) и промывали 3× 0,1M H2SO4 (150 мл) и 3× насыщенным раствором соли (150 мл). Водные фазы экстрагировали CH2Cl2 (100 мл). Объединенные органические фазы сушили над Na2SO4 и фильтровали. 7h выделяли при упаривании растворителя и использовали на следующей стадии без дальнейшей очистки.

МС: m/z 574,31 = [M+H]+, (вычислено = 573,30).

7h (5,31 г, 4,51 ммоль, неочищенный) растворяли в ацетонитриле (26 мл) и COMU (3,87 г, 9,04 ммоль), 6-тритилмеркаптогексановую кислоту (2,12 г, 5,42 ммоль) и коллидин (2,35 мл, 18,08 ммоль) добавляли. Реакционную смесь перемешивали в течение 4 ч при кт, разбавляли CH2Cl2 (400 мл) и промывали 3× 0,1M H2SO4 (100 мл) и 3× насыщенным раствором соли (100 мл). Водные фазы экстрагировали CH2Cl2 (100 мл). Объединенные органические фазы сушили над Na2SO4, фильтровали и 7i выделяли при упаривании растворителя. Продукт 7i очищали флэш-хроматографией.

Выход: 2,63 г (62%, 94% чистоты).

MS: m/z 856,41 = [M+H]+, (вычислено = 855,41).

К раствору 7i (2,63 г, 2,78 ммоль) в i-PrOH (33 мл) и H2O (11 мл) добавляли LiOH (267 мг, 11,12 ммоль) и реакционную смесь перемешивали в течение 70 мин при кт. Смесь разбавляли CH2Cl2 (200 мл) и промывали 3× 0,1M H2SO4 (50 мл) и 3× насыщенным раствором соли (50 мл). Водные фазы экстрагировали CH2Cl2 (100 мл). Объединенные органические фазы сушили над Na2SO4, фильтровали и 7e выделяли при упаривании растворителя. 7j очищали флэш-хроматографией.

Выход: 2,1 г (88%).

МС: m/z 878,4 = [M+Na]+, (вычислено = 878,40).

К раствору 7e (170 мг, 0,198 ммоль) в безводном DCM (4 мл) добавляли DCC (123 мг, 0,59 ммоль) и каталитическое количество DMAP. Через 5 мин N-гидроксисукцинимид (114 мг, 0,99 ммоль) добавляли и реакционную смесь перемешивали при кт в течение 1 ч. Реакционную смесь фильтровали, растворитель удаляли в вакууме и остаток поглощали 90% ацетонитрилом плюс 0,1% ТФУ (3,4 мл). Сырую смесь очищали ОФ-ВЭЖХ. Фракции продукта нейтрализовали 0,5M фосфатным буфером pH 7,4 и концентрировали. Остающуюся водную фазу экстрагировали DCM и 7f выделяли при упаривании растворителя.

Выход: 154 мг (81%).

Мс: m/z 953,4 = [M+H]+, (вычислено = 953,43).

Пример 8

Синтез конъюгатов N αА1 -инсулин-линкер 8b и 8c

Синтез защищенного конъюгата инсулин-линкер

Линкерный реагент 5d растворяли в DCM (20 мг/мл) и активировали N-циклогексилкарбодиимид-N'-метилполистироловой смолой (1,9 ммоль/г, 10 экв.) в течение 1 ч. Раствор активированного линкерного реагента добавляли к раствору инсулина (1,2 экв.) и DIEA (3,5 экв.) в ДМСО (100 мг инсулина/мл) и смесь встряхивали при кт в течение 45 мин. Раствор подкисляли уксусной кислотой, DCM упаривали при пониженном давлении и NαА1-сопряженный защищенный конъюгат инсулин-линкер 8a очищали ОФ-ВЭЖХ.

Лиофилизированный 8a обрабатывали смесью 90/10/2/2 (об./об./об./об.) HFIP/ТФУ/вода/триэтилсилан (2 мл/100 мг 8a) в течение 45 мин при кт. Реакционную смесь разбавляли водой, и все летучие вещества удаляли в токе азота. NαА1-сопряженный конъюгат инсулин-линкер 8b очищали ОФ-ВЭЖХ.

8b: Выход: 139 мг (0,023 ммоль) из 62 мг (0,078 ммоль) линкера 5d

МС: m/z 1524,45 = [M+4H]4+ (вычислено = 1524,75).

NαА1-сопряженный конъюгат инсулин-линкер 8c синтезировали, как описано для 8b, за исключением использования 6c (72 мг, 0,101 ммоль) вместо 5d.

8c: Выход: 237 мг (0,039 ммоль).

МС: m/z 1528,23 = [M+4H]4+ (вычислено = 1528,28).

Пример 9

Синтез конъюгата N αВ1 -инсулин-линкер 9

Nα-Boc-GlyA1-Nε-boc-Lys829-инсулин с двойной защитой получали, как описано ранее (J. Markussen, J. Halstrøm, F.C. Wiberg, L. Schäffer, J. Biol. Chem. 1991, 266, 18814-18818). Линкерный реагент 5d (0,04 ммоль) растворяли в DCM (0,5 мл) и активировали N-циклогексилкарбодиимид-N'-метилполистироловой смолой (0,205 ммоль) при кт в течение 2 ч. Полученный раствор активированного линкерного реагента добавляли к раствору бис-boc-защищенного инсулина (24 мг, 0,004 ммоль) и DIEA (5 мкл, 0,0229 ммоль) и встряхивали при кт в течение 1 ч. Реакционную смесь подкисляли 100 мкл уксусной кислоты и защищенный конъюгат инсулин-линкер очищали ОФ-ВЭЖХ.

Выход: 5 мг (0,00075 ммоль).

МС: m/z 1660,27 = [M+4H]4+ (вычислено = 1660,43).

Лиофилизированный защищенный конъюгат инсулин-линкер обрабатывали 1 мл смеси 90/10/2/2 (об./об./об./об.) HFIP/ТФУ/вода/TES при кт в течение 45 мин. Реакционную смесь разбавляли 0,5 мл воды, и все летучие вещества удаляли в токе азота. NαВ1-сопряженный конъюгат инсулин-линкер 9 очищали ОФ-ВЭЖХ.

Выход: 4 мг (0,0007 ммоль).

МС: m/z 1524,46 = [M+4H]4+ (вычислено = 1524,75).

Пример 10

Синтез конъюгата N εВ29 -инсулин-линкер 10

Инсулин (644 мг, 0,111 ммоль) растворяли в 6,5 мл ДМСО. Охлажденный (4°С) 3 мл 0,5М натрийборатный буфер (pH 8,5) и 7f (70 мг, 0,073 ммоль) в 2,5 мл ДМСО добавляли и смесь перемешивали в течение 5 мин при кт. AcOH 400 мкл добавляли и защищенный конъюгат инсулина очищали ОФ-ВЭЖХ.

Выход: 172 мг (0,025 ммоль).

МС: m/z 1662,27 = [M+4H]4+ (вычислено = 1662,48).

Удаление защитных групп осуществляли путем обработки лиофилизированных фракций продукта 6 мл смеси 90/10/2/2 (об./об./об./об.) HFIP/ТФУ/TES/вода в течение 1 ч при кт. NεВ29-сопряженный конъюгат инсулин-линкер 10 очищали ОФ-ВЭЖХ.

Выход: 143 мг (0,023 ммоль).

Мс: m/z 1531,46 = [M+4H]4+ (вычислено = 1531,71).

Пример 11

Получение инсулин-линкер-гидрогеля 11a, 11b, 11с, 11d, 11da, 11db и 11dc

Сухим гидрогелем 4, функционализированным малеимидом (82 мг, 10,3 мкмоль малеимидогрупп), наполняли шприц, снабженный фриттой для фильтрования. Раствор инсулин-линкер-тиол 8b (27,8 мг, 4,6 мкмоль) в 1,0 мл смеси ацетонитрил/вода/ТФУ 1/1/0,001 (об./об./об.) добавляли и суспензию инкубировали в течение 5 мин при кт. Ацетатный буфер (0,4 мл, pH 4,8, 1,0M) добавляли и образец инкубировали при кт в течение 1 ч. Расход тиола контролировали по тесту Эллмана. Гидрогель промывали 10 раз смесью 1/0,43/0,001 (об./об./об.) ацетонитрил/вода/ТФУ и 2 раза смесью 1/1/0,2/0,25 (об./об./об./об.) 1,0M саркозин pH 7,4/ацетонитрил/0,5M фосфатный буфер pH 7,4/вода. И, наконец, гидрогель суспендировали в растворе саркозина и инкубировали в течение 2 ч при кт.

Инсулин-линкер-гидрогель 11a промывали 10 раз смесью ацетонитрил/вода/ТФУ 1/1/0,001 (об./об./об.) и хранили при 4°С.

Содержание инсулина определяли путем тотального гидролиза аликвоты инсулин-линкер-гидрогель при восстановленных условиях при pH 12 и последующего количественного анализа А-цепи инсулина и В-цепи инсулина посредством ОФ-ВЭЖХ.

Нагрузка инсулина в препарате 11a: 175 мг инсулина/г инсулин-линкер-гидрогеля.

Количество инсулина в суспензии 11a в 10 мМ натрийацетатном буфере pH 5, 135 мМ хлорида натрия: 12 мг инсулина на 1 мл суспензии 11a.

Препараты 11b, 11с и 11d получали, как описано выше, за исключением использования 8c, 9 и 10, соответственно, вместо 8b. Препарат 11da получали, как описано выше, за исключением использования 10 и 4a вместо 8b и 4.

Препарат 11db получали следующим образом: Суспензией гидрогеля, функционализированного малеимидом, 4a в HCl рН 2,5, 0,01% твин-20 (5,0 мл, 119 мкмоль малеимидогрупп) наполняли шприц, снабженный фильтром. Раствор инсулин-линкер-тиол 10 (166 мг, 24,4 мкмоль) в 8,0 мл HCl pH 2,5, 0,01% твин-20 добавляли, и суспензию инкубировали в течение 5 мин при кт. Натрийсукцинатный буфер (3,9 мл, pH 4,0, 150 мМ; 1 мМ EDTA, 0,01% твин-20) добавляли до достижения pH 3,6, и образец инкубировали при кт в течение 90 мин. Расход тиола контролировали по тесту Эллмана. Гидрогель промывали 10 раз натрийсукцинатным буфером (pH 3,0, 50 мМ; 1 мМ EDTA, 0,01% твин-20) и 3 раза натрийсукцинатным буфером (pH 3,0, 50 мМ; 1 мМ ЭДТА, 0,01% твин-20), содержащим 200 мМ ацетилцистеина. И, наконец, гидрогель суспендировали в буфере, содержащем ацетилцистеин, и инкубировали в течение 1 ч при кт.

Инсулин-линкер-гидрогель 11db промывали 10 раз сукцинатным буфером (pH 3,0, 50 мМ; 1 мМ ЭДТА, 0,01% твин-20) и 8 раз натрийацетатным буфером (pH 5,0, 10 мМ; 130 мМ NaCl, 0,01% твин-20).

Нагрузка инсулина в препарате 11db: 6,12 мг инсулина на мл суспензии инсулин-линкер-гидрогель.

Препарат 11dc получали следующим образом: Суспензию гидрогеля, функционализированного малеимидом, 4a в HCl рН 2,5, 0,01% твин-20 (58,3 мл, 958 мкмоль малеимидогрупп) добавляли к реактору для твердофазного синтеза. Раствор инсулин-линкер-тиол 10 (117 мл, 460 мкмоль) в HCl рН 2,5, 0,01% твин-20 добавляли к 4a. Суспензию инкубировали при кт в течение 5 мин. Сукцинатный буфер (4,8 мл, pH 4,0, 150 мМ; 1 мМ ЭДТА, 0,01% твин-20) добавляли до достижения pH 3,6, и суспензию инкубировали при кт в течение 90 мин.

Расход тиола контролировали по тесту Эллмана. Гидрогель промывали 10 раз сукцинатным буфером (pH 3,0, 50 мМ; 1 мМ ЭДТА, 0,01% твин-20) и 2 раза сукцинатным буфером (pH 3,0, 50 мМ; 1 мМ ЭДТА, 0,01% твин-20), содержащим 10 мМ меркаптоэтанола. И, наконец, гидрогель суспендировали в буфере, содержащем меркаптоэтанол, и инкубировали в течение 3 ч при кт.

Инсулин-линкер-гидрогель 11dc промывали 10 раз сукцинатным буфером (pH 3,0, 50 мМ; 1 мМ ЭДТА, 0,01% твин-20) и 6 раз буфером сукцинат/трис (pH 5,0, 10 мМ; 85 г/л трегалозы, 0,01% твин-20).

Нагрузка инсулина в препарате 11dc: 18,7 мг инсулина на мл суспензии инсулин-линкер-гидрогель.

Альтернативно, микрочастицы гидрогеля, дериватизированного малеимидом, 4aa могут быть использованы вместо .

Пример 12

Кинетика высвобождения in vitro

Инсулин-линкер-гидрогель 11a, 11b, 11с и 11d, соответственно (инсулин-линкер-гидрогель, содержащий приблизительно 1 мг инсулина), суспендировали в 2 мл 60 мМ фосфата натрия, 3 мМ ЭДТА, 0,01% твин-20, pH 7,4, и инкубировали при 37°С. Суспензии центрифугировали в определенные интервалы времени и супернатант анализировали ОФ-ВЭЖХ при 215 нм и ESI-МС. УФ-сигналы, коррелирующие с высвобождением инсулина, интегрировали и данные откладывали на графике против времени инкубации. Программу обработки кривых использовали для расчета соответствующего полупериода высвобождения.

In vitro время полужизни для временных точек 16 дней, 10 дней, 30 дней и 14 дней определяли для 11a, 11b, 11c и 11d, соответственно.

Альтернативно, инсулин-линкер-гидрогель 11db переносили в шприцы, снабженные фильтрами, суспендировали в 6 мл 60 мМ фосфата натрия, 3 мМ ЭДТА, 0,01% твин-20, pH 7,4 и инкубировали при 37°С. При определенных временных точках супернатант заменяли и высвобожденный инсулин количественно определяли ОФ-ВЭЖХ при 215 нм. Количество высвобожденного инсулина откладывали на графике против времени инкубации. Программу обработки кривых применяли и in vitro полупериод для временной точки 15 дней определяли для препарата 11db.

Альтернативно, инсулин-линкер-гидрогель 11db загружали в хроматографическую колонку и помещали в инкубатор с контролируемой температурой (37°С). Натрий фосфат (pH 7,4, 60 мМ; 3 мМ ЭДТА, 0,01% твин-20) пропускали через колонку с насосом с постоянной скоростью потока 0,25 мл/ч (номинальная) и собирали снаружи инкубатора. При определенных временных точках, раствор анализировали ОФ-ВЭЖХ при 215 нм. Количество высвобожденного инсулина откладывали на графике против времени инкубации. Программу обработки кривых использовали и in vitro полупериод для временной точки 13 дней определяли для 11db.

Пример 13

Синтез конъюгата LysB29-линкера и инсулина (12а) и LysB28-линкера и инсулина лизпро (12b):

Синтез конъюгата LysB29-линкера и инсулина (12a)

Инсулин 1,2 г (0,206 ммоль, 0,85 экв.) растворяли в ДМСО при кт. Через 30 мин раствор охлаждали до 0°С, в то же время боратный буфер (0,5M, pH 8,5, 21,6 мл) добавляли в течение периода 4,40 мин. Температуру раствора поддерживали между 25 и 28°С. Линкерный реагент 7f 228 мг (0,239 ммоль, 1 экв.), растворенный в 40 мл ДМСО, добавляли независимо от времени в течение периода 3 мин. Баню со льдом отставляли и реакционную смесь перемешивали в течение 5 мин при кт. Реакцию гасили добавлением 70 мл MeCN/H2O (1:1, 0,1% ТФУ) и 400 мкл AcOH. Препарат 12a очищали ОФ-ВЭЖХ (растворитель A: H2O с 0,1% ТФУ, растворитель B: MeCN с 0,1% ТФУ, градиент: 30-80% B в течение 14 мин, скорость потока: 40 мл/мин).

Региоселективность согласно данным анализа UPLC (до очистки ОФ-ВЭЖХ): 0,70% 7f связывается с GlyA1 инсулина и 76,2% 7f связывается с LysB29 инсулина (см. фиг.1а).

Выход: 862 мг (ТФУ-соль, 60%).

МС [M+H]1/4+ = 1662,25 г/моль ((MW+H)1/4 вычислено = 1662,35 г/моль).

Синтез конъюгата LysB28-линкера и инсулина лизпро (12b)

Инсулин лизпро 0,347 г (0,059 ммоль, 0,85 экв.) 1,2 г (0,206 ммоль, 0,85 экв.) растворяли в 6 мл ДМСО при кт. Через 30 мин раствор охлаждали до 0°С, в то же время боратный буфер (0,5M, pH 8,5, 21,6 мл) добавляли в течение периода 1,40 мин. Температуру раствора поддерживали между 25 и 30°С. Раствор 67 мг (0,070 ммоль, 1 экв.) 7f, растворенного в 8 мл ДМСО, добавляли независимо от времени в течение периода 2 мин. Баню со льдом отставляли и реакционную смесь перемешивали в течение 5 мин при кт. Реакцию гасили добавлением 20 мл MeCN/H2O (1:1, 0,1% ТФУ) и 1 мл AcOH. Препарат 12b очищали ОФ-ВЭЖХ (растворитель A: H2O с 0,1% ТФУ, растворитель B: MeCN с 0,1% ТФУ, градиент: 30-80% B в течение 14 мин, скорость потока: 40 мл/мин).

Региоселективность согласно данным анализа UPLC (до очистки ОФ-ВЭЖХ): 1,3% продукта составлял 7f, связанный с GlyA1 инсулина лизпро, 76,7% продукта составлял 7f, связанный с LysB29 инсулина лизпро (см. фиг.1b).

Выход: 305 мг (ТФУ-соль, 72%).

МС [M+H]1/4+ = 1662,25 г/моль ((MW+H)1/4 вычислено = 1662,35 г/моль).

Пример 14

Фармакокинетические исследования на крысах

Фармакокинетику препарата 11da определяли путем измерения концентрации инсулина в плазме после подкожной инъекции однократной дозы крысам.

Одну группу, состоящую из 10 крыс самцов линии Вистар (200-250 г), использовали для изучения уровней инсулина в плазме в течение периода 14 дней. Каждому из животных вводили подкожно одну инъекцию 500 мкл суспензии препарата 11а в ацетатном буфере, рН 5, содержащем 6 мг инсулина (12 мг инсулина/мл). Из расчета на животное и временную точку, 200 мкл крови отбирали сублингвально с получением 100 мкл плазмы с Li-гепарином. Образцы собирали до инъекции и после 4 ч, 1, 2, 3, 4, 7, 9, 11 и 14 дней после инъекции. Образцы плазмы замораживали в течение 15 мин после забора крови и хранили при -80°С до анализа.

Концентрации инсулина в плазме измеряли, используя набор ELISA для сверхчувствительного анализа инсулина (Mercodia) согласно протоколу производителя. Образцы плазмы разбавляли в буфере ELISA (1:5 и 1:10 с калибратором 0) до измерения. Концентрации инсулина рассчитывали, исходя из калибровочной кривой, построенной на основании измерения стандартов инсулина в двух параллельных определениях, и приближения величин, используя линейную регрессию. Концентрацию инсулина определяли как среднюю величину, вычисленную на основании двух независимых серий разведений, скорректированную с помощью соответственного фактора разведения и отложенную на графике против времени. Усредненные концентрации инсулина в плазме для каждой временной точки получали путем расчета средней величины для всех используемых животных, как показано на фиг.2.

В течение 14 дней наблюдали отсутствие выброса и замедленное высвобождение инсулина.

Пример 15

Фармакокинетические изучения на крысах

Фармакокинетику препарата 11da определяли путем измерения концентраций инсулина в плазме в течение периода 13 дней у здоровых крыс.

8 крысам линии Вистар (приблизительно 250 г весом) вводили подкожно одноразовую инъекцию 500 мкл испытуемого препарата 11da в ацетатном буфере рН 5, содержащем 3 мг инсулина (приблизительно 12 мг/кг). Из расчета на животное и временную точку 200 мкл крови отбирали из хвостовой вены с получением приблизительно 100 мкл плазмы с Li-гепарином. Образцы собирали 1 день до и 4 ч, 1 день, 2 дня, 3 дня, 6 дней, 7 дней, 8 дней, 10 дней и 13 дней после введения испытуемого препарата. Образцы плазмы замораживали и хранили при -80°С до анализа. Содержание инсулина в образцах плазмы измеряли, используя набор ELISA для сверхчувствительного анализа человеческого инсулина (DRG Instruments GmbH, Germany) согласно протоколу производителя. Контрольные пробы (калибратор 0) включали в калибровочную кривую и вычитали из величин, полученных для образцов, и калибровочные кривые строили, используя полиномиальное уравнение 3-го порядка. До анализа образцы плазмы встряхивали и разбавляли в реакционных пробирках (1:5 и 1:10 с калибратором 0). Для анализа OD при 450 нм измеряли посредством считывающего устройства для титрационных микропланшетов (Tecan Ultra) без коррекции опорной длины волны. Результаты исследования содержания инсулина вплоть до 13-го дня для всех животных представлены на фиг.3.

После одноразовой подкожной инъекции 500 мкл препарата 11da, который содержал 3 мг инсулина, средний уровень инсулина в плазме поднялся до максимальной величины приблизительно 500 пМ на день 1. Как предполагали, концентрация инсулина в плазме впоследствии снижалась постоянно в течение 2 недель. Отношение пика к минимуму на графике уровней инсулина в плазме в течение первой недели исследования составляло приблизительно 1,7.

Пример 16

Исследования фармакокинетики и фармакодинамики на крысах

Количество и биоактивность высвобожденного инсулина исследовали путем анализа концентрации инсулина в плазме и эффекта снижения глюкозы в крови в фармакокинетическом/фармакодинамическом изучении при использовании диабетических крыс линии Sprague-Dawley (SD).

С этой целью диабет вызывали у 8 крыс введением стрептозотоцина (STZ) и всех животных с уровнями глюкозы в крови, составляющими выше 350 мг/дл на день 0, включали в данное исследование. 7 из 8 крыс SD становились диабетическими, и им вводили подкожно инъекции 500 мкл испытуемого препарата 11da в ацетатном буфере рН 5, содержащем 6,4 мг инсулина. Из расчета на животное и временную точку 200 мкл крови отбирали из хвостовой вены с получением приблизительно 100 мкл плазмы с Li-гепарином. Образцы собирали 4 дня до и 2 ч, 1 день, 2 дня, 3 дня, 6 дней, 7 дней, 8 дней, 10 дней и 13 дней после введения испытуемого препарата. Образцы плазмы замораживали и хранили при -80°С до анализа. Уровень глюкозы в крови из хвостовой вены измеряли посредством устройства AccuChek Comfort 3 раза до инъекции и 2 ч, 1 день, 2 дня, 3 дня, 6 дней, 7 дней, 8 дней, 10 дней, 13 дней, 15 дней, 17 дней, 20 дней, 22 дня и 24 дня после введения испытуемого препарата. Содержание инсулина в образцах плазмы измеряли, используя набор ELISA с человеческим инсулином (DRG Instruments GmbH, Germany), согласно инструкциям производителя. Контрольные пробы (калибратор 0) включали в калибровочную кривую и вычитали из величин, полученных для образцов, и калибровочные кривые строили, используя полиномиальное уравнение 3-го порядка. До анализа образцы плазмы встряхивали и разбавляли в реакционных пробирках (1:5 и 1:10 с калибратором 0). Для анализа OD при 450 нм измеряли посредством считывающего устройства для титрационных микропланшетов (Tecan Ultra) без коррекции опорной длины волны. Уровень инсулина в плазме контролировали в течение 2 недель и уровень глюкозы в крови в течение 3-недельного периода, как показано на фиг.4.

После одноразовой подкожной инъекции инсулин-гидрогель 11da уровень глюкозы в крови эффективно понижался в течение периода 10 дней с величинами ниже 100 мг/дл без каких-либо признаков гипогликемии. Вследствие более высокой дозировки, составляющей 6,4 мг инсулина на животное, максимальная концентрация инсулина в плазме составляла приблизительно 800 пМ на день 1 и постоянно снижалась в течение 2 недель до величины приблизительно 300 пМ. Одновременно значения глюкозы в крови начинали повышаться после 10 дней и достигали уровней в крови до приема инсулина после 3 недель.

Пример 17

Фармакокинетические исследования в течение 24 часов (изучение выброса) на крысах

Для того чтобы удостовериться, что инсулин высвобождается из инсулин-линкер-гидрогеля без выброса, концентрацию инсулина в плазме контролировали в течение периода 24 часа у здоровых крыс.

8 крыс линии Sprague-Dawley (200-250 г массы тела) разделяли на 2 группы и вводили одноразовую подкожную инъекцию 2 мл испытуемого препарата 11db в ацетатном буфере рН 5 на кг массы тела. Испытуемый препарат содержал 4 мг/мл инсулина так, что каждое животное получало 8 мг инсулина на кг массы тела. Из расчета на животное и временную точку 200 мкл крови отбирали из хвостовой вены с получением приблизительно 100 мкл плазмы с Li-гепарином. Образцы из группы А собирали до приема препарата и 5 мин, 30 мин, 2 ч, 4 ч и 8 ч после применения испытуемого препарата и для группы В до приема препарата и 15 мин, 1 ч, 3 ч, 6 ч и 24 ч после введения испытуемого препарата. Образцы плазмы замораживали и хранили при -80°С до анализа. Содержание инсулина в образцах плазмы измеряли, используя набор ELISA для сверхчувствительного анализа человеческого инсулина (DRG Instruments GmbH, Germany) согласно протоколу производителя. Контрольные пробы (калибратор 0) включали в калибровочную кривую и вычитали из величин, полученных для образцов, и калибровочные кривые строили, используя полиномиальное уравнение 3-го порядка. До анализа образцы плазмы встряхивали и разбавляли в реакционных пробирках (1:5 и 1:10 с калибратором 0). Для анализа OD при 450 нм измеряли посредством считывающего устройства для титрационных микропланшетов (Tecan Ultra) без коррекции опорной длины волны. Результат представлен на фиг.5 и четко указывает, что инсулин высвобождается без какого-либо выброса.

Пример 18

Фармакокинетическое и фармакодинамическое исследование введения многократной дозы крысам

Фармакокинетику и фармакодинамику после введения доз 11da 1 раз в неделю в течение 3 недель определяли путем измерения концентраций инсулина в плазме и уровней глюкозы в крови в течение периода 4 недель у диабетических крыс.

8 крыс линии Sprague-Dawley использовали со средней массой тела 239 г. Диабет вызывали введением стрептозотоцина (STZ) и всех животных с уровнями глюкозы в крови, составляющими выше 350 мг/дл на день 0 (день инъекции испытуемого препарата), включали в исследование. 8 из 8 крыс, которых обрабатывали STZ, становились диабетическими, и им вводили подкожно 1 раз в неделю в течение 3 недель инъекции на день 0, 7 и 14 2 мл испытуемого препарата 11da в ацетатном буфере рН 5 на кг массы тела. При концентрации инсулина 4 мг/мл в испытуемом препарате во вводимой дозе концентрация составляла 8 мг инсулина на кг массы тела. Из расчета на животное и временную точку 200 мкл крови отбирали из хвостовой вены с получением приблизительно 100 мкл плазмы с Li-гепарином. Образцы из группы А собирали 3 дня до и вплоть до 28 дней после введения испытуемого препарата. Образцы плазмы замораживали и хранили при -80°С до анализа. Уровень глюкозы в крови из хвостовой вены измеряли посредством устройства AccuChek Comfort 3 раза до инъекции и вплоть до 30 дней после инъекции. Содержание инсулина в образцах плазмы измеряли, используя набор ELISA для анализа человеческого инсулина (DRG Instruments GmbH, Germany) согласно протоколу производителя. Контрольные пробы (калибратор 0) включали в калибровочную кривую, и вычитали из величин, полученных для образцов, и строили калибровочные кривые, используя полиномиальное уравнение 3-го порядка. До анализа образцы плазмы встряхивали и разбавляли в реакционных пробирках (1:5 и 1:10 с калибратором 0). Для анализа OD при 450 нм измеряли посредством считывающего устройства для титрационных микропланшетов (Tecan Ultra) без коррекции опорной длины волны. Уровень инсулина в плазме и уровень глюкозы в крови контролировали в течение 4-недельного периода, и результаты представлены на фиг.6.

Форма кривых указывает, что высвобожденный инсулин был биоактивным на основании неуклонного снижения уровня глюкозы в крови до величин приблизительно 100 мг/дл после 3-й инъекции, который оставался низким в течение приблизительно недели. В то же самое время максимальная концентрация инсулина повышалась постоянно, начиная от 200 пМ после первой дозы и 300 пМ после второй дозы до 400 пМ после третьей дозы и далее уменьшалась вновь в течение 2 недель до значений, составляющих ниже 100 пМ.

Пример 19

Фармакокинетическое исследование на крысах

Фармакокинетику 11dc определяли путем измерения концентраций инсулина в плазме в течение периода 13 дней у здоровых крыс.

8 крыс линии Вистар (масса тела приблизительно 230 г) получали одноразовую подкожную инъекцию 2 мл/кг испытуемого препарата 11dc в сукцинатном буфере рН 5 (10 мМ сукцинат/трис, 85 г/л трегалозы, 0,01% твин-20, pH 5,0), содержащем 3 мг инсулина (доза 12 мг/кг). Из расчета на животное и временную точку 200 мкл крови отбирали из хвостовой вены с получением приблизительно 100 мкл плазмы с Li-гепарином. Образцы собирали 4 дня до и 0,3 ч (4 животных), 1 ч (4 животных), 2 ч (4 животных), 4 ч (4 животных), 1 день, 2 дня, 3 дня, 6 дней, 8 дней, 10 дней и 13 дней после введения испытуемого препарата. Образцы плазмы замораживали и хранили при -80°С до анализа. Содержание инсулина в образцах плазмы измеряли, используя набор ELISA для сверхчувствительного анализа человеческого инсулина (DRG Instruments GmbH, Germany) согласно протоколу производителя. Контрольные пробы (калибратор 0) включали в калибровочную кривую и вычитали из величин, полученных для образцов, и калибровочные кривые строили, используя полиномиальное уравнение 3-го порядка. До анализа образцы плазмы встряхивали и разбавляли в реакционных пробирках (1:5 и 1:10 с калибратором 0). Для анализа OD при 450 нм измеряли посредством считывающего устройства для титрационных микропланшетов (Tecan Ultra) без коррекции опорной длины волны. Результаты содержания инсулина в плазме вплоть до дня 13 для всех животных представлены на фиг.7.

После одноразовой подкожной инъекции 12 мг/кг 11dc средний уровень инсулина в плазме поднимался до максимальной величины приблизительно 500 пМ на день 1. Как и предполагали, концентрация инсулина в плазме впоследствии снижалась постоянно в течение 2 недель. Отношение пика к минимальной величине на кривой инсулина в плазме в течение первой недели составляло приблизительно 1,4.

Пример 20

Реальное время высвобождения инсулина и деградация гидрогеля при рН 7,4

Инсулин-линкер-гидрогель 11a (730 мкл, содержащий 3,19 мг инсулина) в ацетатном буфере pH 5,0 (10 мМ, 130 мМ NaCl, 0,01% (масс./об.) твин-20) помещали в пробирку для приготовления образца, промывали 3× буфером для высвобождения pH 7,4 (60 мМ фосфат натрия, 3 мМ ЭДТА, 0,01% (масс./об.) твин-20) и доливали до объема 1,00 мл. Аликвоту суспензии (0,5 мл, 1,59 мг инсулина) загружали в хроматографическую колонку и помещали в инкубатор с контролируемой температурой (37°C). Буфер для высвобождения (pH 7,4) пропускали через колонку с насосом с постоянной скоростью потока 0,25 мл/ч (номинальная) и собирали снаружи инкубатора. При определенных временных точках раствор анализировали ОФ-ВЭЖХ (215 нм). Количество высвобожденного инсулина откладывали на графике против времени инкубации и программу обработки кривых использовали для оценки соответствующего полупериода высвобождения. Определяли полупериод высвобождения для временной точки 9,4 дня для высвобождения инсулина.

После 39 дней инкубации при 37°С суспензию гидрогеля переносили в пробирку для приготовления образца, остаточный гидрогель вымывали из колонки буфером для высвобождения рН 7,4, и объем образца доводили 1,00 мл. Две аликвоты (300 мкл каждая) переносили в стерилизованные пробирки для приготовления образца, объем доводили до 1,5 мл и инкубировали при 37°С. Образцы отбирали при временных интервалах и анализировали гель-фильтрационной хроматографией. УФ-сигналы, соответствующие высвобожденным водорастворимым продуктам деградации гидрогеля, содержащим один или более каркасных фрагментов (соответствующие реакционноспособным функциональным группам), интегрировали, и величины откладывали против времени инкубации, см. фиг.8.

Пример 21

Способность пролекарства инсулин-линкер-гидрогель к введению посредством инъекции

Пролекарство инсулин-линкер-гидрогель 11dc 5 мл (распределение шариков по размеру 32-75 мкм, 18 мг инсулина/мл) в буфере янтарная кислота/трис рН 5,0 (10 мМ, 40 г/л маннита; 10 г/л дигидрата трегалозы; 0,05% твин-20) использовали. Суспензию пролекарства инсулин-линкер-гидрогель набирали в 1-мл шприц (длина 57 мм) иглой 20 G. Иглу 20 G заменяли иглой 30 G и размещали в рабочую часть шприца (Aqua Computer GmbH&Co. KG), и измерение начинали со скорости поршня 172 мм/мин (равно 50 мкл/сек) (стенд для испытания усилия: Мультитест 1-d, программа записи данных: EvaluatEmperor Lite, версия 1,16-015, прибор для измерения усилия: BFG 200н (все Mecmesin Ltd., UK). Эксперименты с увеличивающимися скоростями поршня, представленными в таблице ниже, осуществляли с новым образцом пролекарства инсулин-линкер-гидрогель. Эксперименты с водой и этиленгликолем осуществляли соответственно. Для всех экспериментов была использована одинаковая игла 30 G. Усилие против скорости потока при использовании иглы 30 G представлено на фиг.9.

Скорость потока (сек/мл) Скорость потока (мкл/сек) Скорость поршня (мм/мин) Усилие/Н (вода) Усилие/Н 11dc Усилие/Н (этилен-гликоль)
6 167 573 13 36 83
8 125 430 10 29 62
10 100 344 7 24 51
15 67 229 4 22 35
20 50 172 3 17 27

Сокращения:

AcOH уксусная кислота
AcOEt этилацетат
Aib 2-аминоизомасляная кислота
Bn бензил
Boc трет-бутилоксикарбонил
COMU (1-циано-2-этокси-2-оксоэтилиденаминоокси)диметиламиноморфолино-карбения гексафторфосфат
DBU 1,3-диазабицикло[5.4.0]ундецен
DCC N,N-дициклогексилкарбодиимид
DCM дихлорметан
DIEA диизопропилэтиламин
DMAP диметиламинопиридин
DMF N,N-диметилформамид (ДМФ)
Dmob 2,4-диметоксибензил
DMSO диметилсульфоксид (ДМСО)
EDC 1-этил-3-(3-диметиламинопропил)карбодиимид
EDTA этилендиаминтетрауксусная кислота (ЭДТА)
Eq стехиометрический эквивалент (экв.)
ESI-MS масс-спектрометрия с ионизацией электрораспылением
EtOH этанол
Fmoc 9-флуоренилметоксикарбонил
HATU O-(7-азабензотриазол-1-ил)-N,N,N',N'-тетраметилурония гексафторфосфат
HFIP гексафторизопропанол
HPLC высокоэффективная жидкостная хроматография (ВЭЖХ)
HOBt N-гидроксибензотриазол
i-PrOH 2-пропанол
LCMS масс-спектрометрия, соединенная с жидкостной хроматографией
MaI 3-малеимидопропил
Mal-PEG6-NHS N-(3-малеимидопропил)-21-амино-4,7,10,13,16,19-гексаоксагенэйкозановой кислоты NHS-сложный эфир
Me метил
MeCN ацетонитрил
MeOH метанол
Mmt 4-метокситритил
MS масс-спектр/масс-спектрометрия (МС)
MTBE метил трет-бутиловый эфир
MW молекулярная масса
n.d. не определяли
NHS N-гидроксисукцинимид
OD оптическая плотность
OBu бутилокси
OtBu трет-бутилокси
PEG поли(этиленгликоль) (ПЭГ)
Phth фтал-
PyBOP бензотриазол-1-илокситриспирролидинофосфония гексафторфосфат
RP-HPLC высокоэффективная жидкостная хроматография с обращенной фазой (ОФ-ВЭЖХ)
rpm оборотов в минуту (об/мин)
RT комнатная температура (кт)
SEC гель-фильтрация
Su сукцинимидил
TCP 2-хлортритилхлоридная смола
TES триэтилсилан
TFA трифторуксусная кислота (ТФУ)
THF тетрагидрофуран (ТГФ)
TMEDA N,N,N'N'-тетраметилэтилендиамин
Tmob 2,4,6-триметоксибензил
Trt трифенилметил, тритил
UPLC сверхэффективная жидкостная хроматография
UV ультрафиолет (УФ)
VIS видимый

1. Конъюгат инсулин-линкер D-L или его фармацевтически приемлемая соль, где
D представляет собой фрагмент инсулина и
-L представляет собой биологически неактивный линкерный фрагмент -L1, представленный формулой (I)

где пунктирная линия указывает на место присоединения к одной из аминогрупп инсулина путем образования амидной связи;
X является C(R3R3a) или N(R3);
R1a, R3a независимо выбирают из группы, состоящей из Н, NH(R2b), N(R2b)C(O)R4 и C1-4алкила;
R1, R2, R2a, R2b, R3, R4 независимо выбирают из группы, состоящей из Н и C1-4алкила;
где L1 замещен одним элементом L2-Z при условии, что водород, отмеченный звездочкой в формуле (I), не заменен заместителем, и где
L2 является простой химической связью или L2 означает C1-20алкильную цепь, которая необязательно прерывается одной или более группами, независимо выбранными из -О- и С(О)N(R3aa); необязательно замещена одной или более группами, независимо выбранными из ОН и С(О)N(R3aaR3aaa); и где R3aa, R3aaa независимо выбраны из группы, состоящей из Н и C1-4алкила; и
Z означает гидрогель, содержащий каркасный фрагмент, который имеет четвертичный атом углерода C(A-Hyp)4, где каждая группа А независимо выбрана из формулы (СН2)n1(ОСН2СН2)nX1-, где n1 равно 1 или 2; n является целым числом в диапазоне от 5 до 50 и X1 является химической функциональной группой, ковалентно связывающей А и Hyp, где каждый фрагмент Hyp содержит от 5 до 32 лизинов.

2. Конъюгат инсулин-линкер по п. 1, где в формуле (I) группа R2 заменена L2-Z.

3. Конъюгат инсулин-линкер по п. 1, где в формуле (I) группа R1 заменена L2-Z.

4. Конъюгат инсулин-линкер по любому из пп. 1-3, где в формуле (I) группа X является N(R3).

5. Конъюгат инсулин-линкер по любому из пп. 1-3, где в формуле (I) группа X является C(R3R3a) и R3a является N(R2b)С(О)R4.

6. Конъюгат инсулин-линкер по п. 1, где X является C(R3R3a) и группа R3a заменена L2-Z.

7. Конъюгат инсулин-линкер по п. 1, где X является C(R3R3a), R3a является N(R2b)-L2-Z.

8. Конъюгат инсулин-линкер по п. 1, где фрагмент инсулина присоединен к L1 через азот NαA1.

9. Конъюгат инсулин-линкер по п. 1, где инсулин является рекомбинантным человеческим инсулином.

10. Конъюгат инсулин-линкер по п. 9, где рекомбинантный человеческий инсулин присоединен к L1 через азот боковой цепи лизина фрагмента инсулина.

11. Конъюгат инсулин-линкер по п. 1, где гидрогель состоит из каркасных фрагментов, взаимосвязанных гидролитически разрушаемыми связями.

12. Конъюгат инсулин-линкер по п. 11, где каркасные фрагменты имеют молекулярную массу в диапазоне от 1 кДа до 20 кДа.

13. Конъюгат инсулин-линкер по п. 11, где каркасные фрагменты связаны вместе через фрагменты сшивающего реагента, каждый фрагмент сшивающего реагента оканчивается по меньшей мере двумя из гидролитически разрушаемых связей.

14. Конъюгат инсулин-линкер по п. 13, где фрагменты сшивающего реагента имеют молекулярную массу в диапазоне от 0,5 кДа до 5 кДа.

15. Конъюгат инсулин-линкер по п. 11, где группа L2 связана с каркасным фрагментом.

16. Конъюгат инсулин-линкер по п. 1, где группа L2 присоединена к Z через концевую группу, имеющую следующую структуру

где пунктирные линии указывают на место присоединения к L2 и Z соответственно.

17. Конъюгат инсулин-линкер по п. 1 формулы (IIa)

где Nε-инсулин относится к инсулину, соединенному через боковую цепь одного остатка лизина.

18. Конъюгат инсулин-линкер по п. 1 или 2 формулы (IIb)

19. Конъюгат инсулин-линкер по п. 17, где гидрогелем является биоразрушаемый нерастворимый в воде гидрогель, основанный на поли(этиленгликоле) (ПЭГ).

20. Конъюгат инсулин-линкер по п. 17, где гидрогель состоит из каркасных фрагментов, взаимосвязанных гидролитически разрушаемыми связями.

21. Конъюгат инсулин-линкер по п. 11 или 20, где каркасные фрагменты содержат ветвящуюся сердцевину следующей формулы:

где пунктирная линия указывает на место присоединения к остальной части каркасного фрагмента.

22. Конъюгат инсулин-линкер по п. 11 или 20, где каркасные фрагменты включают структуру следующей формулы:

где n является целым числом от 5 до 50 и пунктирная линия указывает на место присоединения к остальной части молекулы.

23. Конъюгат инсулин-линкер по п. 11 или 20, где каркасный фрагмент включает гиперразветвленный фрагмент Hyp.

24. Конъюгат инсулин-линкер по п. 23, где каркасный фрагмент включает гиперразветвленный фрагмент Hyp следующей формулы:

где пунктирные линии указывают на место присоединения к остальной части молекулы и атомы углерода, отмеченные звездочками, указывают на S-конфигурацию.

25. Конъюгат инсулин-линкер по п. 20, где каркасные фрагменты присоединены по меньшей мере к одному спейсеру следующей формулы:

где одна из пунктирных линий указывает на место присоединения к гиперразветвленному фрагменту Hyp и вторая пунктирная линия указывает на место присоединения к остальной части молекулы и где m является целым числом от 2 до 4.

26. Конъюгат инсулин-линкер по п. 20, где каркасные фрагменты присоединены по меньшей мере к одному спейсеру следующей формулы:

где пунктирная линия, отмеченная звездочкой, указывает на связь между гидрогелем и N тиосукцинимидной группы по п. 16, где другая пунктирная линия указывает на присоединение к Hyp и где p является целым числом от 0 до 10.

27. Конъюгат инсулин-линкер по п. 13, где каркасные фрагменты связаны вместе посредством фрагментов сшивающего реагента, включающих следующую структуру:

где q является целым числом от 3 до 100.

28. Конъюгат инсулин-линкер по п. 1 в виде микрочастиц.

29. Конъюгат инсулин-линкер по п. 28, где микрочастицы имеют диаметр между 20 и 100 мкм.

30. Конъюгат инсулин-линкер по п. 28, где микрочастицы могут быть введены путем инъекции через иглу менее чем 0,6 мм внутреннего диаметра.

31. Конъюгат инсулин-линкер по п. 28, где микрочастицы могут быть введены путем инъекции через иглу менее чем 0,3 мм внутреннего диаметра.

32. Конъюгат инсулин-линкер по п. 28, где микрочастицы могут быть введены путем инъекции через иглу менее чем 0,2 мм внутреннего диаметра.

33. Конъюгат инсулин-линкер формулы (IIIa)

где Nε-инсулин относится к инсулину, соединенному через боковую цепь одного остатка лизина.

34. Конъюгат инсулин-линкер формулы (IIIb)

35. Фармацевтическая композиция, предназначенная для применения в способе лечения или предотвращения заболеваний или нарушений, которые можно лечить инсулином, содержащая конъюгат инсулин-линкер по любому из пп. 1-32 или его фармацевтически приемлемую соль вместе с фармацевтически приемлемым наполнителем.

36. Фармацевтическая композиция по п. 35, где фармацевтическая композиция является сухой.

37. Фармацевтическая композиция по п. 36, где фармацевтическая композиция высушена посредством лиофилизации.

38. Фармацевтическая композиция по любому из пп. 35-37, где конъюгат инсулин-линкер содержится в композиции в достаточной степени, чтобы доставить терапевтически эффективное количество инсулина по меньшей мере в течение трех дней в один прием.

39. Фармацевтическая композиция по любому из пп. 35-37, где она является однодозовой композицией.

40. Фармацевтическая композиция по любому из пп. 35-37, где она является композицией, состоящей из множества доз.

41. Фармацевтическая композиция по любому из пп. 35-37, содержащая одно или более дополнительных биологически активных средств, или их свободную форму, в виде конъюгатов инсулин-линкер, особенно в виде гидрогелевых конъюгатов инсулин-линкер, и где одно или более дополнительных биологически активных средств выбирают из группы, состоящей из сульфонилмочевин, таких как, например, хлорпропамид, толазамид, толбутамид, глибурид, глипизид, глимепирид и тому подобное; меглитинидов, таких как, например, репаглинид; глюкагоноподобного пептида-1 (GLP-1) и его миметиков, глюкозоинсулинотропного пептида (GIP) и его миметиков, эксендина и его миметиков и ингибиторов протеазы дипептидилпептидазы (DPPIV); бигуанидов, таких как, например, метформин; тиазолидиндионов, таких как, например, розиглитазон, пиоглитазон, троглитазон, изаглитазон (известный как МСС-555), 2-[2-[(2R)-4-гексил-3,4-дигидро-3-оксо-2Н-1,4-бензоксазин-2-ил]этокси]бензолуксусная кислота и тому подобное; GW2570 и тому подобное; модуляторов рецептора ретиноида-X (RXR), таких как, например, таргретин, 9-цис-ретиноевая кислота и тому подобное; других инсулин-сенсибилизирующих средств, таких как, например, INS-1, ингибиторы РТР-1B, ингибиторы GSK3, ингибиторы гликогенфосфорилазы, ингибиторы фруктозо-1,6-бисфосфатазы и тому подобное; инсулинов, включающих инсулины регулярного или короткого действия, промежуточного действия и длительного действия инсулины, ингалируемый инсулин и аналоги инсулина, такие как молекулы инсулина с минорными различиями в природной последовательности аминокислот; малой молекулы, имитирующей инсулин, включающей, но не ограниченной ими, L-783281, ТЕ-17411 и тому подобное; ингибиторов котранспортера Na-глюкозы, таких как Т-1095, Т-1095А, флоризин и тому подобное; агонистов амилина, которые включают, но не ограничиваются ими, прамлинтид и тому подобное; антагонистов глюкагона, таких как AY-279955, и тому подобное; антидиабетических средств, таких как орлистат, ингибитор панкреатической липазы; сибутрамина; норэпинефрина и дофамина; гормона роста, IGF-1, фактора, высвобождающего гормон роста; оксинтомодулина и модуляторов грелина; подавляющих аппетит средств, таких как бензфетамин, фенметразин, фентермин, диэтилпропион, мазиндол, сибутрамин, фенилпропаноламин или эфедрин; подавляющих аппетит средств, таких как квипазин, флуоксетин, сертралин, фенфлурамин или дексфенфлурамин; подавляющих аппетит средств, таких как апоморфин; подавляющих аппетит средств, таких как миметики гистамина, модуляторы рецепторов H3; усиливающих расход энергии средств, таких как агонисты бета-3 аденергических рецепторов и стимуляторы функции разобщающего белка; лептина и миметиков лептина (например, метрелептин); антагонистов нейропептида Y; модуляторов рецепторов меланокортина-1, 3 и 4; агонистов холецистокинина; миметиков глюкагоноподобного пептида-1 и аналогов, подобных, например, эксендину; андрогенов, таких как дегидроэпиандростерон и производные, такие как этиохоландион; тестостерона, анаболических стероидов, таких как оксандролон и стероидные гормоны; антагонистов рецептора галанина; цитокиновых средств, таких как цилиарный нейротрофический фактор; ингибиторов амилазы.

42. Контейнер, содержащий фармацевтическую композицию по пп. 35-41, предназначенный для применения в способе лечения или предотвращения заболеваний или нарушений, которые можно лечить инсулином.

43. Контейнер по п. 42, где контейнер представляет собой двухкамерный шприц.

44. Суспензия, предназначенная для применения в способе лечения или предотвращения заболеваний или нарушений, которые можно лечить инсулином, содержащая фармацевтическую композицию по пп. 35 и 38-41.

45. Способ приготовления суспензии по п. 44, включающий стадии восстановлений сухой фармацевтической композиции по п. 36 или 37 путем добавления восстанавливающего раствора.

46. Набор, предназначенный для применения в способе лечения или предотвращения заболеваний или нарушений, которые можно лечить инсулином, включающий иглу и контейнер, содержащий восстанавливающий раствор и сухую композицию по п. 36 или 37 для использования с иглой.

47. Набор по п. 46, где контейнер представляет собой двухкамерный шприц и где одна из двух камер двухкамерного шприца содержит сухую фармацевтическую композицию и вторая камера указанного двухкамерного шприца содержит восстанавливающий раствор.

48. Конъюгат инсулин-линкер по п. 1, предназначенный для применения в способе лечения или предотвращения заболеваний или нарушений, которые можно лечить инсулином.

49. Реагент инсулин-линкер D-L*, предназначенный для получения конъюгата по п. 1, где
D представляет собой фрагмент инсулина и
L* является биологически неактивным линкерным реагентом, представленным формулой (IV)

где пунктирная линия указывает на место присоединения к одной из аминогрупп инсулина путем образования амидной связи;
X означает C(R3R3a) или N(R3);
R1a, R3a независимо выбирают из группы, состоящей из Н, NH(R2b), N(R2b)C(O)R4 и C1-4алкила;
R1, R2, R2a, R2b, R3, R4 независимо выбирают из группы, состоящей из Н и C1-4алкила;
где реагент L* замещен одной группой L2* и необязательно дополнительно замещен при условии, что водород, отмеченный звездочкой в формуле (IV), не заменен заместителем, и где
L2* является спейсером, соединенным с L* и содержащим химическую функциональную группу, предназначенную для конъюгирования с реакционноспособным биоразрушаемым гидрогелем.

50. Реагент инсулин-линкер по п. 49, где в формуле (IV) R2 заменен L2*.

51. Реагент инсулин-линкер по п. 50, где в формуле (IV) R1 заменен L2*.

52. Реагент инсулин-линкер по любому из пп. 49-51, где в формуле (IV) X является N(R3).

53. Реагент инсулин-линкер по любому из пп. 49-51, где в формуле (IV) X является C(R3R3a) и R3a является N(R2b)С(О)R4.

54. Реагент инсулин-линкер по п. 49, где X является C(R3R3a) и R3a заменен L2*.

55. Реагент инсулин-линкер по п. 49, где X является C(R3R3a), R3a является N(R2b)-L2*.

56. Реагент инсулин-линкер по любому из пп. 49-51, где L* дополнительно не замещен.

57. Реагент инсулин-линкер по любому из пп. 49-51, где L2* содержит тиоловую группу.

58. Реагент инсулин-линкер по любому из пп. 49-51, где L2* содержит малеимидную группу.

59. Способ получения конъюгата инсулин-линкер по любому из пп. 1-32 и 48, включающий стадии:
(a) контактирования водной суспензии, содержащей функционализированные малеимидом микрочастицы гидрогеля, с раствором, содержащим реагент инсулин-линкер по п. 57, при температурах между комнатной температурой и 4°C в буферном водном растворе при pH 2-5, приводящего к образованию конъюгата инсулин-линкер-гидрогель;
(b) необязательно, обработки конъюгата инсулин-линкер-гидрогель со стадии (а) тиолсодержащим соединением молекулярной массой от 34 Да до 500 Да при температурах между комнатной температурой и 4°C в буферном водном растворе при pH 2-5.

60. Способ получения конъюгата инсулин-линкер по любому из пп. 1-32 и 48, включающий стадии:
(a) контактирования водной суспензии, содержащей функционализированные тиолом микрочастицы гидрогеля, с раствором, содержащим реагент инсулин-линкер по п. 58, при температурах между комнатной температурой и 4°C в буферном водном растворе при pH 2-5, что приводит к образованию конъюгата инсулин-линкер-гидрогель;
(b) необязательно, обработки конъюгата инсулин-линкер-гидрогель со стадии (а) малеимидсодержащим соединением молекулярной массой от 100 до 300 Да при температурах между комнатной температурой и 4°C в буферном водном растворе при pH 2-5.

61. Способ приготовления инъецируемого иглой конъюгата инсулин-линкер, включающий стадии:
(a) получения конъюгата инсулин-линкер по п. 28 в виде микрочастиц;
(b) просеивания микрочастиц;
(c) отбора фракции с диаметром шариков конъюгата инсулин-линкер между 25 и 80 мкм;
(d) суспендирования фракции шариков со стадии (с) в водном буферном растворе, подходящем для инъецирования.

62. Инъецируемый иглой конъюгат инсулин-линкер, приготовленный способом по п. 61.

63. Конъюгат инсулин-линкер по п. 62, инъецируемый посредством иглы с внутренним диаметром менее чем 300 мкм.

64. Конъюгат инсулин-линкер по п. 62, инъецируемый посредством иглы с внутренним диаметром менее чем 225 мкм.

65. Конъюгат инсулин-линкер по п. 62, инъецируемый посредством иглы с внутренним диаметром менее чем 175 мкм.



 

Похожие патенты:

Изобретение относится к соединению формулы (I), его стереоизомерам или фармацевтически приемлемым солям, где Y означает -СН2-, -CHF- или -CF2-; m=1, n=1 или 2, и p представляют собой целые числа, независимо выбранные из 0, 1 или 2; X означает связь, C1-C5-алкилен или -С(=O)-; R1 означает водород, группы, выбранные из алкила, -S(O)PR10, -NR10S(O)pR11, -CN, -NR10R11, -NR10COR11 или 5-6-членного гетероциклического кольца с 1-4 гетероатомами, выбранными из N, О и S, которое необязательно замещено алкокси, гидрокси, гидроксилалкилом, галогеналкилом, циклоалкилом, арилом, арилалкилом, 6-членным гетероарильным циклом с 1-2 атомами азота или одним или более оксо, алкилом, галогеном; причем заместители необязательно дополнительно замещены одним или несколькими атомами галогена; R2, R3 и R4 независимо означают водород или алкил; R2 и R4 могут быть объединены вместе с образованием необязательно замещенного 6-7-членного цикла с 1 гетероатомом, выбранным из N и О, где заместители выбраны из одного или более оксо или алкила; R5 означает водород или алкильную группу; R6 означает водород или алкил; R7 означает водород или алкил; R8 означает -CN; R10 и R11 независимо означают водород или необязательно замещенные группы, выбранные из алкила, циклоалкила, циклоалкилалкила, арила, арилалкила и 6-членного гетероциклила с одним атомом азота; когда группы R10 и R11 являются замещенными, причем заместители представляют собой один или несколько заместителей, выбранных из галогенов, циано, оксо (=O), тиоксо (=S), тиоалкила, амино, алкила, галогеналкила и -SO2Ra; где Ra означает алкил; причем указанные алкильные группы представляют собой C1-C6 алкильные группы; указанные циклоалкильные группы представляют собой C3-C10 циклоалкильные группы; указанные арильные группы представляют собой C6-C10 арильные группы; причем указанные галогены выбраны из фтора, хлора, брома и иода.

Изобретение относится к новым производным хромена формулы I или его солям, где: каждый из R1 и R3, независимо, обозначает водород, С1-4алкил, гидроксил, С1-4алкоксил, С1-4алкоксиС1-4алкил, галогенС1-4алкил, гидроксиС1-4алкил, галоген или Cy2; R2 обозначает водород; Cy1 обозначает моноциклический 5- или 6-членный гетероцикл, насыщенный или частично ненасыщенный, который может быть связан с остальной частью молекулы по любому доступному атому N, где Cy1 может содержать 1 или 2 гетероатома, выбранных из N и О, и где Cy1, необязательно, имеет один или более заместителей R4; каждый Cy2, независимо, обозначает фенил или ароматический 5- или 6-членный цикл, который может быть связан с остальной частью молекулы по любому доступному атому С или N, где Cy2 может содержать в общей сложности 1 или 2 гетероатома, выбранных из N и О, и где Cy2 необязательно имеет один или более заместителей R4; каждый R4, независимо, обозначает С1-4алкил, гидроксил, С1-4алкоксил, галогенС1-4алкил, гидроксиС1-4алкил или галоген; n равен от 0 до 2; m равен 0 или 1.

Настоящая группа изобретений относится к медицине, а именно к терапии и фармакологии, и может быть использована для повышения фармакологической активности действующего вещества лекарственного средства.

Группа изобретений относится к медицине, а именно к терапии и эндокринологии, и может быть использована для предотвращения тяжелой симптоматической гипогликемии, связанной с концентрацией глюкозы в плазме ниже 50 мг/дл, при сахарном диабете 2 типа.

Настоящее изобретение относится к соединениям формулы (I), где А1 и R1, R2, R3, R4 и R5 определены в формуле изобретения, которые являются предпочтительными ингибиторами цистеинпротеазы катепсина, в частности цистеинпротеазы катепсина S или L, что делает их полезными в качестве лекарственных средств, особенно для лечения диабета, атеросклероза, аневризмы брюшной аорты, периферического артериального заболевания или диабетической нефропатии.

Изобретение относится к медицине и заключается в клатратных комплексах арабиногалактана или гуммиарабика с 20-гидроксиэкдизоном. Комплексы обладают противодиабетической активностью и гиполипидемическим действием.

Изобретение относится к соединениям структурной формулы I, которые обладают ингибирующей активностью в отношении JNK киназы. В формуле I m, n, p равно 0; X представляет собой СН или N; R3 представляет собой: С1-6алкилсульфонил-С1-6алкил или тетрагидротиофенил-1,1-оксид-С1-6алкил; R5 представляет собой группу формулы (а) или (b), где q равно 0 или 1; r равно 0 или 1; Y представляет собой: NR9 или CR10R11; каждый из R6 и R7 независимо представляет собой: водород, карбокси-группу, карбокси-С1-6алкиловый эфир или С1-6алкил, или же R6 и R7 совместно образуют С1-2алкиленовую группу; R8, R9, R10представляет собой: водород или C1-6алкил; и R11 представляет собой водород, С1-6алкокси-группу, NH2C(O)-, C1-6алкил, гидрокси-С1-6алкил, карбокси-группу, карбокси-С1-6алкил, карбокси-С1-6алкиловый эфир или карбокси-С1-6алкил-С1-6алкиловый эфир.

Предложено применение инекальцитола для лечения и/или предупреждения рахита, остеопороза, остеомаляции, псориаза, аутоиммунных заболеваний, таких как рассеянный склероз или диабет 1 типа, гиперпаратиреоза, доброкачественной гиперплазии простаты, любого вида рака в дозах, содержащих между 1,5 мг/день и 4 мг с периодичностью, выбираемой из: через день, один раз в день и два раза в день.

Изобретение относится к 3-ациламинопиридин-2(1H)-ону и его новым производным, которые могут являться потенциальными лекарственными препаратами для лечения диабета II типа. где X - -(СН2)n-n=0-2, -СН(ОСН3)-, -СН=СН-; Y - 1-адамантил, 4-изопропилфенил, 3-(метоксиметил)-4-метоксифенил, 3-(4-метил-1H-пиразол-1-ил)метил-4-метоксифенил, 4-(дифторметокси)фенил, 3,5-диметилизоксазол-4-ил, 3,5-диметил-4-нитро-1H-пиразол-1-ил, 3-трифторметил-1H-пиразол-1-ил, 1-этил-3-трифторметил-1H-пиразол-5-ил, 1-бензил-5-метил-1H-1,2,3-триазол-4-ил; Z - 4-пиридил, бром.

Настоящее изобретение относится к новым циклопентил- и циклогептилпиразоловым производным формулы I, где А и R1-R4 определены в формуле изобретения, или их фармацевтически приемлемым солям.

Изобретение относится к конъюгатам, в частности представлен никотиновый гаптен-носитель формулы (III): W представляет собой -О- и находится в положении 5 пиридинового кольца; -(спейсер)- представляет собой С1-С8алкиленовую группу, С3-С10циклоалкиленовую группу или С1-С12алкиленовую группу, прерванную 1-4 атомами кислорода и возможно прерванную группой -N(H)C(O)-; X* представляет собой -NH- или -S-; m означает 1; n означает целое число от 1 до 1000; и Y представляет собой возможно модифицированный белок-носитель, выбранный из бактериальных анатоксинов, иммуногенных веществ, вирусов, вирусоподобных частиц, белковых комплексов, белков, полипептидов, липосом и иммуностимулирующих комплексов, которые могут быть использованы для приготовления вакцин для лечения и/или предупреждения никотиновой зависимости.

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Изобретение относится к пролекарствам метилфенидата, в которых метилфенидат конъюгирован по меньшей мере с одним третичным амином и оксокислотой. Пролекарства обладают повышенной водорастворимостью и биодоступностью по сравнению с немодифицированным метилфенидатом.

Группа изобретений относится к медицине и касается композиции для подкожного введения, содержащей ПЭГинтерферон альфа и вспомогательные вещества, в частности, динатрия эдетата дигидрат, натрия ацетата тригидрат, уксусную кислоту ледяную, осмотический агент.

Изобретение относится к медицине, а именно к средствам, обладающим противоопухолевым действием. Предложено новое противоопухолевое средство, содержащее 6-амино-12-(α-L-арабинопиранозил)индоло[2,3-а]пирроло[3,4-с]карбазол-5,7-дион, диметилсульфоксид и поливинилпирролидон и при следующих соотношениях компонентов (мг): 6-амино-12-(α-L-арабинопиранозил)индоло[2,3-а]пирроло[3,4-с]карбазол-5,7-дион 8,1-9,9 диметилсульфоксид 95,0-125,0 поливинилпирролидон 540,0-660,0 Созданное новое противоопухолевое средство из группы производных индолокарбазолов позволяет расширить спектр противоопухолевых препаратов.

Изобретение относится к области генной инженерии и биохимии, конкретно к созданию малотоксичного катионного дендримерного пептида со структурной формулой (Arg)8(Lys)4(Lys)2LysAlaCys-NH2 (Фиг.
Изобретение относится к фармацевтической промышленности и представляет собой средство для лечения и профилактики дисбактериоза кишечника, характеризующееся тем, что оно представлено в виде таблетки и содержит Bifidobacterium bifidum штамм №1, лиофилизированный в среде культивирования с активностью 1×104-1×1010 КОЕ /г, кальция стеарат, тальк, топинамбур и лактозу, причем компоненты в средстве находятся в определенном соотношении в мас.

Настоящее изобретение относится к парентеральным составам для введения некоторых производных, образованных 1-β-D-арабинофуранозилцитозином (цитарабином) и насыщенными и мононенасыщенными жирными кислотами с длинной цепью (элацитарабин).
Изобретение относится к фармацевтической промышленности и представляет собой средство для лечения и профилактики зудящих дерматозов, содержащее эффективное количество уроновой кислоты или ее лактона в водном растворе и фармацевтически приемлемые добавки.

Изобретение относится к области химии и химико-фармацевтической промышленности. Описаны новые клатратные комплексы 7-бром-5-(орто-хлорфенил)-2,3-дигидро-1H-1,4-бензодиазепин-2-она с циклодекстрином, которые могут найти применение в фармацевтической промышленности, и способы их получения.
Группа изобретений относится к области фармацевтики и медицины и касается способа получения фармацевтической готовой лекарственной формы, содержащей производное инсулина, при этом способ включает растворение производного инсулина в воде, подведение рН раствора до значения выше рН 7,2, добавление содержащего цинк раствора в течение периода более чем одна минута при постоянном перемешивании и подведение рН до значения в диапазоне от 7,0 до 7,8 и при этом производное инсулина содержит молекулу инсулина, в которой имеется боковая цепь, присоединенная к ε-аминогруппе остатка Lys, присутствующего в В-цепи инсулина человека или его аналога, при этом боковая цепь имеет общую формулу: W-X-Y-Z.
Наверх