Вакцина против pcsk9



Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9
Вакцина против pcsk9

 


Владельцы патента RU 2538162:

Пфайзер Вэксинс ЭлЭлСи (US)

Изобретение относится к области иммунологии и биотехнологии. Представлен иммуноген для индуцирования иммунного ответа против белка PCSK9, содержащий антигенный пептид PCSK9, выбранный из группы, состоящей из раскрытых в описании SEQ ID NO: 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 314, 318 и 319, содержащих аминокислотную последовательность TRFHRQ, и SEQ ID NO: 182, 183, 184, 185, 186, 187, 188, 317, 401, 402 и 403, содержащих аминокислотную последовательность SIPWNLE, где указанный антигенный пептид PCSK9 конъюгирован с иммуногенным носителем, выбранным из CRM197 или Qbeta вирусоподобной частицы (VLP). Описана композиция для индуцирования иммунного ответа против белка PCSK9, содержащая по меньшей мере два иммуногена в иммунологически эффективных количествах, где первый иммуноген представляет собой указанный иммуноген. Раскрыта композиция для индуцирования иммунного ответа против белка PCSK9, содержащая по меньшей мере два иммуногена в иммунологически эффективных количествах, где первый иммуноген выбран из группы иммуногенов, содержащих аминокислотную последовательность SIPWNLE, и где второй иммуноген выбран из группы иммуногенов, содержащих аминокислотную последовательность TRFHRQ; и где композиция может содержать дополнительно по меньшей мере один адъювант. Также представлена фармацевтическая композиция для предупреждения, лечения или облегчения PCSK9-связанных расстройств, содержащая: в терапевтически эффективном количестве указанный иммуноген, или одну из указанных композиций и фармацевтически приемлемый эксципиент. Изобретение позволяет получить эффективную вакцину против расстройств, связанных с взаимодействием белка PCSK9 с его рецептором LDLR. 7 н. и 17 з.п. ф-лы, 19 ил., 6 табл., 9 пр.

 

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к обеспечению новых иммуногенов, содержащих антигенный пептид PCSK9, предпочтительно связанный с иммуногенным носителем для предупреждения, лечения и облегчения PCSK9-связанных расстройств. Изобретение также относится к способам изготовления этих лекарственных средств, их иммуногенным композициям и фармацевтическим композициям и их применению в медицине.

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

Пропротеин-конвертаза субтилизин/кексин 9 типа (называемая в дальнейшем "PCSK9"), также известная как нервная апоптоз-регулируемая конвертаза 1 ("NARC-i"), представляет собой протеиназа K-подобную субтилазу, идентифицированную в качестве как 9-го члена семейство PCSK млекопитающих; см. Seidah et al., 2003, PNAS 100:928-933. Ген PCSK9 расположен на человеческой хромосоме 1р33-р34.3. PCSK9 экспрессируется в клетках, способных к пролиферации и дифференцировке, включающих, например, гепатоциты, мезенхимальные клетки почек, интестинальные клетки подвздошной кишки и эпителий толстой кишки, а также эмбриональные нейроны мозгового пузыря.

Первоначальный синтез PCSK9 представлен в форме неактивного предшественника фермента, или зимогена, с молекулярной массой примерно 72 кДа, который подвергается аутокаталитическому, внутримолекулярному процессингу в эндоплазматическом ретикулуме ("ЭР") для активации его функциональных свойств. Последовательность гена для человеческого PCSK9, которая имеет длину примерно 22 т.п.н. с 12 экзонами, кодирующими 692-аминокислотный белок, можно найти, например, под депозитарным №NP_777596.2. Последовательности нуклеиновых кислот PCSK9 человека, мыши и крысы были депонированы; см., например, GenBank номера доступа: АХ 127530 (также АХ207686), АХ207688 и АХ207690, соответственно.

Человеческий PCSK9 представляет собой секретируемый белок, экспрессирующийся главным образом в почках, печени и кишечнике. Он имеет три домена: ингибиторный продомен (аминокислоты 1-152; включающие сигнальную последовательность по аминокислотам 1-30), каталитический домен (аминокислоты 153-448) и С-концевой домен длиной 210 остатков (аминокислоты 449-692), который богат цистеиновыми остатками. PCSK9 синтезируется в виде зимогена, который подвергается аутокаталитическому расщеплению между продоменом и каталитическим доменом в эндоплазматическом ретикулуме. Продомен остается связанным со зрелым белком после расщепления и комплекс секретируется. Цистеии-богатый домен может играть роль, аналогичную Р-(процессинг) доменам других Фурин/Кексин/Субтилизин-подобных сериновых протеаз, которые, по-видимому, необходимы для сворачивания и регуляции активированных протеаз. Мутации в PCSK9 ассоциированы с аномальными уровнями холестерина липопротеинов низкой плотности (LDL-c) в плазме крови (Horton et al., 2006 Trends. Biochem. Sci, 32(2):71-77).

PCSK9, которому приписывается роль в дифференцировке гепатоцитов и нервных клеток (Seidah et al., выше), высоко экспрессируется в эмбриональной печени и в значительной степени вовлечен в гомеостаз холестерина.

Весьма желательна идентификация соединений и/или агентов, эффективных в лечении сердечно-сосудистых заболеваний. Снижение уровней холестерина LDL, как уже было продемонстрировано в клинических испытаниях, непосредственно связано с частотой коронарных приступов; Law et al., 2003 BMJ 326: 1423-1427. Более того, недавно было показано, что умеренное пожизненное снижение уровней холестерина LDL в плазме по существу коррелировало со значительным снижением частоты коронарных приступов; Cohen et al., выше. Это было обнаружено даже в популяциях с высокой распространенностью факторов риска сердечно-сосудистых заболеваний, не связанных с липидами; выше.

Соответственно, огромное значение имеет идентификация терапевтического агента, обеспечивающего контроль уровней холестерина LDL.

Соответственно, огромное значение имеет изготовление лекарственного средства, которое ингибирует или противодействует активности PCSK9 и соответствующей роли, которую PCSK9 играет при различных терапевтических состояниях.

Экспрессия или повышающая регуляция PCSK9 ассоциирована с повышенными уровнями холестерина LDL в плазме, а ингибирование или отсутствие экспрессии PCSK9 ассоциировано с низкими уровнями холестерина LDL в плазме. Примечательно, что более низкие уровни холестерина LDL, ассоциированные с вариациями в последовательности PCSK9, обеспечивало защиту против заболевания коронарной артерии; Cohen, 2006 N. Engl. J. Med. 354: 1264-1272.

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к иммуногену, содержащему антигенный пептид PCSK9 и возможно иммуногенный носитель.

Изобретение также относится к способам получения такого антигенного пептида PCSK9, возможно связанного с иммуногенным носителем.

Изобретение также относится к иммуногенным композициям, содержащим такой антигенный пептид PCSK9, возможно связанный с иммуногенным носителем, возможно содержащим один или несколько адъювантов, предпочтительно один или два адъюванта.

Другой аспект изобретения относится к фармацевтическим композициям, содержащим антигенный пептид PCSK9 согласно изобретению, или его иммуногенную композицию, а также к медицинским применениям таких композиций.

В частности, изобретение относится к антигенному пептиду PCSK9 по изобретению или его иммуногенной или фармацевтической композиции для применения в качестве лекарственного средства, предпочтительно для лечения, облегчения или профилактики PCSK9-связанных расстройств.

В частности, изобретение относится к антигенному пептиду PCSK9 по изобретению или его иммуногенной или фармацевтической композиции для применения в качестве лекарственного средства, предпочтительно для лечения, облегчения или профилактики заболеваний, ассоциированных с повышенным уровнем холестерина.

Антигенные пептиды PCSK9 по изобретению особенно подходят для лечения пациентов-людей, имеющих повышенный уровень холестерина LDL или состояние, ассоциированное с повышенным уровнем холестерина LDL, например, липидное расстройство (например, гиперлипидемию, гиперлипидемию I типа, II типа, III типа, IV типа или V типа, вторичную гипертриглицеридемию, гиперхолестеринемию, семейную гиперхолестеринемию, ксантоматоз, дефицит холестеринацетилтрансферазы) или подверженных риску их развития. Антигенный пептид PCSK9 по изобретению также подходит для лечения пациентов-людей, имеющих атеросклеротические состояния (например, атеросклероз), заболевание коронарной артерии, сердечно-сосудистое заболевание, и пациентов, подверженных риску развития этих расстройств, например, в связи с присутствием одного или более факторов риска (например, гипертензии, курения, диабета, ожирения или гипергомоцистеинемии).

В еще одном аспекте в настоящем изобретении предложено применение антигенного пептида PCSK9 по изобретению или его иммуногенной композиции или фармацевтической композиции в изготовлении лекарственного средства для лечения болезни Альцгеймера.

В одном из воплощений антигенный пептид PCSK9 или его иммуногенную композицию или фармацевтическую композицию вводят вместе с другим агентом.

КРАТКОЕ ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ:

Фиг.1: Структура PDB человеческого PCSK9, связанного с доменом EGF-А LDL-R (3BPS), демонстрирующая 5 пептидных последовательностей в PCSK9 (пептид 1-5), выбранных за их причастность к взаимодействию между этими двумя белками.

Фиг.2: Мышей иммунизировали пептидами от VR_9.1 до VR_9.9, конъюгированными с VLP, используя квасцы с CpG в качестве адъюванта, и антительные ответы на полноразмерный рекомбинантный человеческий PCSK9 измеряли путем титрования сывороток в ELISA-анализе. Результаты представлены в виде реципрокных титров для каждой из 6 мышей на группу, с реципрокным титром, измеренным как разведение сыворотки, дающее оптическую плотность считывания 0,5.

Фиг.3: Антительные ответы на полноразмерный рекомбинантный мышиный белок PCSK9, как представлено на Фиг.2.

Фиг.4: Уровни холестерина в плазме измеряли в сыворотках вакцинированных мышей (в тех же образцах, которые использовали для анализов антител на Фиг.2 и 3)

Фиг.5: Образцы плазмы, используемые на Фиг.2-4, тестировали при различных разведениях на их способность ингибировать взаимодействие между рекомбинантным PCSK9 и внеклеточным доменом рецептора LDL, как измерено анализом FRET.

Фиг.6: Разведения образцов плазмы из вакцинаций пептидами VR_9 5 и VR_9.6 в анализе FRET, демонстрирующие дозозависимое ингибирование взаимодействия между PCSK9 и рецептором LDL.

Фиг.7: Комплекс PCSK9 (ленты) и EGF-A (заполненное пространство) из PDB:3BPS. Потенциальные участки PCSK9, которые могут взаимодействовать с доменами LDLR, отличными от EGF-A, показаны эллипсом.

Фиг.8: Представлен комплекс PCSK9 (ленты) и EGF-A (заполненное пространство) с аминокислотами, соответствующими пептидам VR_13/14 (А) и VR_15/16(B) и VR_9.5(C).

Фиг.9 и 10: Ответы антител в плазме у мышей, вакцинированных пептидами VR_9.5 и с VR_9.10 no VR_9.16. Антитела к мышиному PCSK9 измеряли с помощью ELISA-анализа серийных разведении плазмы с использованием полноразмерного мышиного белка PCSK9. Индивидуальные кривые титрования показаны для 8 мышей на группу, где ELISA ответы плазмы мышей, иммунизированных неконъюгированным VLP, показаны в качестве контроля.

Фиг.11: Сывороточные антительные ответы на полноразмерный человеческий белок PCSK9, индуцированные у мышей BALB/c и C57BL/6, вакцинированных либо пептидом VR_9.5, либо VR_9.10, конъюгированным с VLP (с использованием квасцов +/-CpG в качестве адъюванта), либо CRM197 (с использованием TiterMax в качестве адъюванта). Антитела к человеческому PCSK9 измеряли путем титрования сывороток в ELISA-анализе. Результаты представлены в виде log реципрокных титров, определенных при оптической плотности 1,0 для каждой из 8 мышей в группе.

Фиг.12: Сывороточные антительные ответы на полноразмерный мышиный белок PCSK9, индуцированные у мышей BALB/c и C57BL/6, вакцинированных, как описано для Фиг.11. Результаты представлены в виде log реципрокных титров, определенных при оптической плотности 0,5 для каждой из 8 мышей в группе.

Фиг.13: Общие уровни холестерина, измеренные в образцах сыворотки у вакцинированных мышей BALB/c (те же образцы использовали для анализов антител на Фиг.11 и 12).

Фиг.14: Общие уровни холестерина, измеренные в образцах сыворотки у вакцинированных мышей C57BL/6 (те же образцы использовали для анализов антител на Фиг.11 и 12).

Фиг.15: Антительные ответы на полноразмерный человеческий PCSK9, индуцированные у мышей BALB/c, иммунизированных пептидами VR_9.5 или с VR 9.17 по VR,9.35, конъюгированными с VLP, с использованием квасцов плюс CpG в качестве адъюванта. Антитела к человеческому PCSK9 измеряли путем титрования сывороток в ELISA-анализе. Результаты представлены в виде log реципрокных титров, определенных при оптической плотности 1,0 для каждой из 8 мышей а группе.

Фиг.16: Антительные ответы на полноразмерный мышиный PCSK9, индуцированные у мышей BALB/c, иммунизированных, как описано для Фиг, 15, Антитела к мышиному PCSK9 измеряли путем титрования сывороток в ELISA-анализе. Результаты представлены в виде log реципрокных титров, определенных при оптической плотности 0,5 для каждой из 8 мышей в группе.

Фиг.17: Общие уровни холестерина, измеренные в образцах сыворотки от вакцинированных мышей BALB/c (те же образцы использовали для анализов антител на Фиг.15 и 16.

Фиг.18: Комплекс PCSK9 (ленты) и EGF-A (заполненное пространство) с участками PCSK9, содержащими аминокислотные последовательности, связанные с мутациями приобретения (gain-) или потери функции (loss-of-function) и/или поверхностными белками, экспонирующими эпитопы, указанные эллипсами.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Антигенный пептид PCSK9 по изобретению

Настоящее изобретение относится к иммуногену, содержащему антигенный пептид PCSK9, возможно связанный с иммуногенным носителем.

В одном из воплощений антигенный пептид PCSK9 представляет собой участок PCSK9, содержащий от 4 до 20 аминокислот и, при введении субъекту, способный снижать уровень LDL-холестерина в крови указанного субъекта. Предпочтительно, указанный субъект представляет собой млекопитающее, предпочтительно человека. Предпочтительно, указанный антигенный пептид PCSK9 способен снижать уровень LDL-холестерина по меньшей мере на 2%, 5%, 10%, 20%, 30% или 50%.

В одном из воплощений антигенный пептид PCSK9 представляет собой участок PCSK9, который участвует во взаимодействии PCSK9 с рецептором LDL.

В одном из воплощений антигенный пептид PCSK9 представляет собой участок PCSK9, который участвует во взаимодействии PCSK9 с рецептором LDL, содержащий от 4 до 20 аминокислот и, при введении субъекту, способный снижать уровень LDL-холестерина в крови указанного субъекта. Предпочтительно, указанный субъект представляет собой млекопитающее, предпочтительно человека. Предпочтительно, указанный антигенный пептид PCSK9 способен снижать уровень LDL-холестерина по меньшей мере на 2%, 5%, 10%, 20%, 30% или 50%.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93,, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122,123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587 и 588.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:1-312, 330-398, 421, 423, 424, 426 и 428-588.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397 и 398.

В одном из воплощений антигенный пептид PCSK9 представляет собой участок PCSK9, который может участвовать во взаимодействии с доменом EGF-A рецептора LDL. Примеры таких участков представлены на Фиг.1.

В одном из воплощений антигенный пептид PCSK9 представляет собой участок PCSK9, который может участвовать во взаимодействии с доменом EGF-A рецептора LDL, содержащий от 4 до 20 аминокислот и, при введении субъекту, способный снижать уровень LDL-холестерина в крови указанного субъекта. Предпочтительно, указанный субъект представляет собой млекопитающее, предпочтительно человека. Предпочтительно, указанный антигенный пептид PCSK9 способен снижать уровень LDL-холестерина по меньшей мере на 2%, 5%, 10%, 20%, 30% или 50%.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 13, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:1.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22. 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44 и 45.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 15, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:4S.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 и 101.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 14, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:102.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144 145 и 146.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 13, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:147.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166,167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180 и 181.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 13, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:182.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206,207,208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225 и 226.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 13, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:330.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358 и 359.

В предпочтительном воплощении антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:19, 56, 63, 109, 153, 165, 184, 186, 187, 188, 332 и 424.

В предпочтительном воплощении антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:19, 56, 63, 109, 153 и 184.

В предпочтительном воплощении антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:56, 184, 186, 187, 188 и 332.

В наиболее предпочтительном воплощении антигенный пептид PCSK9 представляет собой пептид, имеющий последовательность SEQ ID NO:56.

В более предпочтительном воплощении антигенный пептид PCSK9 представляет собой пептид, имеющий последовательность SEQ ID NO:184 или 187.

В наиболее предпочтительном воплощении антигенный пептид PCSK9 представляет собой пептид, имеющий последовательность SEQ ID NO:184.

В наиболее предпочтительном воплощении антигенный пептид PCSK9 представляет собой пептид, имеющий последовательность SEQ ID NO:332.

В одном из воплощений антигенный пептид PCSK9 выбран из участка PCSK9, который может участвовать во взаимодействии с иным, чем домен EGF-A, участком рецептора LDL. Примеры таких участков представлены на Фиг.7 и 8.

В одном из воплощений антигенный пептид PCSK9 представляет собой участок PCSK9, который может участвовать во взаимодействии с иным, чем домен EGF-A, участком рецептора LDL, содержащий от 4 до 20 аминокислот и, при введении субъекту, способный снижать уровень LDL-холестерина в крови указанного субъекта. Предпочтительно, указанный субъект представляет собой млекопитающее, предпочтительно человека. Предпочтительно, указанный антигенный пептид PCSK9 способен снижать уровень LDL-холестерина по меньшей мере на 2%, 5%, 10%, 20%, 30% или 50%.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 12, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:227.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO: 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261 и 262.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 13, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:263.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306 и 307.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 13, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:360.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397 и 398.

В одном из воплощений антигенный пептид PCSK9 выбран из участка продомена PCSK9 (SEQ ID NO:329).

В одном из воплощений антигенный пептид PCSK9 представляет собой участок продомена PCSK9, содержащий от 4 до 20 аминокислот и, при введении субъекту, способный снижать уровень LDL-холестерина в крови указанного субъекта. Предпочтительно, указанный субъект представляет собой млекопитающее, предпочтительно человека. Предпочтительно, указанный антигенный пептид PCSK9 способен снижать уровень LDL-холестерина по меньшей мере на 2%, 5%, 10%, 20%, 30% или 50%.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:308, 309, 310, 311 и 312.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 12, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:309.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:309, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462 и 463.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 12, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:508.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542 и 543.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 13, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:310.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:310, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506 и 507.

В одном из воплощений антигенный пептид PCSK9 представляет собой пептид, содержащий от 5 до 13, предпочтительно от 6 до 8 последовательных аминокислот фрагмента PCSK9 из SEQ ID NO:544.

В одном из воплощений антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587 и 588.

В предпочтительном воплощении антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:312, 421, 422, 423, 426, 427, 428, 445, 482, 525 и 563.

В более предпочтительном воплощении антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO:445, 482, 525 и 563.

В наиболее предпочтительном воплощении антигенный пептид PCSK9 представляет собой пептид, имеющий последовательность SEQ ID NO:445.

Такие антигенные пептиды PCSK9 могут быть использованы отдельно или в комбинации, предпочтительно при конъюгировании с иммуногенным носителем, для индукции аутоантител против PCSK9 у субъекта с целью лечения, предупреждения или облегчения PCSK9-связанных расстройств.

Специалисту в данной области техники очевидно, какие методы могут быть использованы для подтверждения того, подпадает ли конкретная конструкция под объем настоящего изобретения. Такие методы включают, но не ограничиваются этим, методы, описанные в разделе Примеров настоящей заявки, а также следующее.

Способность антигенного пептида PCSK9 по изобретению индуцировать аутоантитела против PCSK9 можно измерять у мышей, используя тест, описанный в примере 3 настоящей заявки. Способность аутоантител, индуцированных антигенным пептидом PCSK9 по изобретению, уменьшать уровень циркулирующего в плазме холестерина можно измерять у мышей, используя тест, описанный в примере 3. Способность аутоантител, индуцированных антигенным пептидом PCSK9 по изобретению, ингибировать взаимодействие между PCSK9 и рецепторами LDL можно измерять непосредственно, используя тест, описанный в примере 3 (анализ FRET (резонансный перенос энергии флуоресценции)), или опосредованно путем измерения повышающей регуляции рецепторов LDL клеточной поверхности, которая является следствием блокирования PCSK9-опосредованной понижающей регуляции (а также описанной в релевантной литературе либо с использованием клеточных линий in vitro, либо путем измерения уровней рецепторов LDL в биопсиях печени животных, экспрессирующих антитела (например, посредством Вестерн-блоттинга)).

Термин "биологическая активность антигенного пептида PCSK9", при использовании в данной заявке, относится к способности антигенных пептидов PCSK9 по изобретению индуцировать аутоантитела против PCSK9 у пациента.

Предпочтительно, указанный антигенный пептид PCSK9 при введении субъекту, способен снижать уровень LDL-холестерина в крови указанного субъекта. Предпочтительно, указанный субъект представляет собой млекопитающее, предпочтительно человека. Предпочтительно, указанный антигенный пептид PCSK9 способен снижать уровень LDL-холестерина по меньшей мере на 2%, 5%, 10%, 20%, 30% или 50%.

В одном из воплощений антигенные пептиды PCSK9 по настоящему изобретениию имеют такой размер, что они имитируют участок, выбранный из полного домена PCSK9, в котором обнаружен нативный эпитоп. В конкретном воплощении антигенные пептиды PCSK9 по изобретению имеют длину менее 100 аминокислот, предпочтительно менее 75 аминокислот, более предпочтительно менее 50 аминокислот, еще более предпочтительно менее 40 аминокислот.Антигенные пептиды PCSK9 по изобретению имеют длину обычно 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 или 30 аминокислот, предпочтительно от 4 до 20 аминокислот, например, от 6 до 12, от 6 до 8 или от 9 до 12 аминокислот.

Конкретные примеры антигенных пептидов PCSK9 по изобретению предложены в перечне последовательностей и включают пептиды длиной от 5 до 17 аминокислот.

Антигенные пептиды по изобретению включают аминокислотную последовательность, происходящую из участка PCSK9 млекопитающего, предпочтительно PCSK9 человека (SEQ ID NO:399) или PCSK9 мыши (SEQ ID NO:400), более предпочтительно PCSK9 человека, такой происходящий участок PCSK9 либо соответствует аминокислотной последовательности встречающегося в природе PCSK9, либо соответствуют варианту PCSK9, т.е. аминокислотной последовательности встречающегося в природе PCSK9, в которой небольшое число аминокислот было замещено, добавлено или делетировано, но которая сохраняет по существу такие же иммунологические свойства. Кроме того, такой происходящий участок PCSK9 может быть дополнительно модифицирован с помощью аминокислот, особенно на N- и С-концах. для обеспечения конформационного ограничения антигенного пептида PCSK9 и/или для обеспечения связывания антигенного пептида PCSK9 с иммуногенным носителем после проведения соответствующей химии.

Антигенные пептиды PCSK9, описанные в данной заявке, охватывают функционально активные варианты пептидов, происходящие из аминокислотной последовательности PCSK9, в которой аминокислоты были делегированы, вставлены или заменены без существенного уменьшения их иммунологических свойств, т.е. такие функционально активные варианты пептидов сохраняют значительную биологическую активность антигенного пептида PCSK9. Как правило, такие функционально активные варианты пептидов имеют аминокислотную последовательность, гомологичную, предпочтительно высоко гомологичную, аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO:1-312, 330-398 и 420-588.

В одном из воплощений такие функционально активные варианты пептидов демонстрируют по меньшей мере 60%, 65%, 70%, 75%, 80%, 85%, 90% или 95%-ную идентичность с аминокислотной последовательностью, выбранной из группы, состоящей из SEQ ID NO:1-312, 330-398 и 420-588.

Сходство последовательностей полипептидов, которую также называют идентичностью последовательностей, обычно измеряют с использованием программного обеспечения для анализа последовательностей. Программное обеспечение для анализа белка выравнивает сходные последовательности с использованием критериев сходства, относящихся к различным заменам, делециям и другим модификациям, включая консервативные аминокислотные замены. Например, GCG содержит такие программы, как "Gap" и "Bestfit", которые можно использовать с параметрами по умолчанию для определения гомологии последовательностей или идентичности последовательностей между близкородственными полипептидами, такими как гомологичные полипептиды из организмов различных видов, или между белком дикого типа и его мутеином. См., например, GCG версию 6.1. Полипептидные последовательности также можно сравнивать с использованием FASTA. применяя параметры по умолчанию или рекомендованные параметры, программа GCG версии 6.1. FASTA (например, FASTA2 и FASTA3) обеспечивает выравнивания и процентную идентичность последовательностей областей с наилучшим перекрыванием между запросными и поисковыми последовательностями (Pearson, Methods Enzymol. 183:63-98 (1990); Pearson, Methods Mol. Biol. 132:185-219 (2000)). Альтернативный алгоритм при сравнении последовательности по изобретению с базой данных, содержащей большое количество последовательностей из различных организмов, представляет собой компьютерную программу BLAST, особенно blastp или tbiastn с использованием параметров по умолчанию. См., например, Altschul et al., J. Mol. Biol. 215:403-410 (1990); Altschu! et al., Nucleic Acids Res. 25:3389-402 (1997).

Функционально активные варианты содержат встречающиеся в природе функционально активные варианты, такие как аллельные варианты и видовые варианты и не встречающиеся в природе функционально активные варианты, которые могут быть получены, например, методами мутагенеза или прямым синтезом.

Функционально активный вариант отличается от любого из пептидов, представленных в SEQ ID NO:1-312, 330-398 и 420-588, примерно на, например, 1, 2, 3, 4 или 5 аминокислотных остатков и все же сохраняет биологическую активность антигенного PCSK9. Если это сравнение требует выравнивания, то последовательности выравнивают с максимальной гомологией. Сайт вариации может быть представлен в любом месте пептида, пока биологическая активность по существу сходна с пептидом, представленным в SEQ ID NO:1-312, 330-398 и 420-588.

Руководство относительно того, как сделать фенотипически молчащие аминокислотные замены, представлено в Bowie et al., Science, 247: 1306-1310 (1990), которое учит, что существуют две основные стратегии исследования устойчивости аминокислотной последовательности к изменению.

Первая стратегия использует устойчивость к аминокислотным заменам в ходе естественного отбора в процессе эволюции. При сравнении аминокислотных последовательностей в различных видах можно идентифицировать аминокислотные положения, которые были консервативными между видами. Эти консервативные аминокислоты, по-видимому, важны для функции белка. В огличие от этого, аминокислотные положения, в которых замены были допущены естественным отбором, указывают на положения, которые не являются критичными для функции белка. Таким образом, положения, допускающие аминокислотную замену, можно модифицировать, сохраняя при этом специфическую иммуногенную активность модифицированного пептида.

Вторая стратегия использует генную инженерию для введения аминокислотных изменений по конкретным положениям клонированного гена для идентификации участков, критичных для функции белка. Например, можно использовать сайт-направленный мутагенез или аланин-сканирующий мутагенез (Cunningham et al., Science, 244: 1081-1085 (1989). Полученные варианты пептидов затем можно тестировать в отношении специфической биологической активности антигенного PCSK9.

Согласно Bowie и др., эти две стратегии обнаружили, что белки являются неожиданно устойчивыми к аминокислотным заменам. Авторы также указывают, какие аминокислотные изменения, по-видимому, являются допустимыми в некоторых аминокислотных положениях в белке. Например, наиболее замаскированные или внутренние (в третичной структуре белка) аминокислотные остатки требуют неполярных боковых цепей, тогда как некоторые признаки поверхностных или наружных боковых цепей обычно являются консервативными.

Спосбы введения мутации в аминокислоты белка хорошо известны специалистам в данной области См., например, Ausubel (ed.), Current Protocols in Molecular Biology, John Wiley and Sons, Inc. (1994); Т.Maniatis, E.F.Fritsch and J.Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor laboratory, Cold Spring Harbor, N.Y. (1989)).

Мутации также можно вводить с использованием имеющихся в продаже наборов, таких как "QuikChangeTM Site-Directed Mutagenesis Kit" (Stratagene), или непосредственно пептидным синтезом. Получение функционально активного варианта для антигенного пептида PCSK9 путем замены аминокислоты, которая по существу не влияет на функцию указанного антигенного пептида PCSK9, может быть выполнено специалистом в данной области техники.

Тип аминокислотной замены, который можно сделать в одном из пептидов согласно изобретению, представляет собой консервативную аминокислотную замену. "Консервативная аминокислотная замена" представляет собой замену, в которой аминокислотный остаток заменен другим аминокислотным остатком, имеющим группу боковой цепи R) со сходными химическими свойствами (например, зарядом или гидрофобностью). В общем, консервативная аминокислотная замена по существу не изменяет функциональные свойства белка. В тех случаях, когда две или более аминокислотных последовательностей отличаются друг от друга консервативными заменами, процент идентичности последовательностей или степень сходства можно корректировать в сторону увеличения для корректировки консервативной природы замены. Способы осуществления такой корректировки хорошо известны специалистам в данной области техники. См., например, Pearson, Methods Mol. Biol. 243:307-31 (1994).

Примеры групп аминокислот, которые имеют боковые цепи со сходными химическими свойствами, включают 1) алифатические боковые цепи: глицин, эланин, валин, лейцин и изолейцин; 2) элифатические гидроксильные боковые цепи: серин и треонин; 3) амид-содержащие боковые цепи: аспарагин и глутамин; 4) ароматические боковые цепи: фенилаланин, тирозин и триптофан; 5) основные боковые цепи: лизин, аргинин и гистидин; 6) кислотные боковые цепи: аспарагиновая кислота и глутаминовая кислота; и 7) серосодержащие боковые цепи: цистеин и метионин. Предпочтительные группы для консервативных аминокислотных замен представляют собой: валин-лейцин-изолейцин, фенилаланин-тирозин, лизин-аргинин, аланин-валин, глутамат-аспартат и аспарагин-глутамин.

Альтернативно, консервативная замена представляет собой любое изменение, имеющее положительное значение в РАМ250 матрице логарифмического правдоподобия (log-likelihood matrix), описанной в Gonnet et al., Science 256:1443-45 (1992). "Умеренно консервативная" замена представляет собой любое изменение, имеющее неотрицательное значение в РАМ250 матрице логарифмического правдоподобия.

Функционально активный вариант пептида также может быть выделен с использованием метода гибридизации. Кратко, ДНК, имеющую высокую гомологию со всей или с частью последовательности нуклеиновой кислоты, кодирующей интресующий пептид, например SEQ ID NO:1-312, 330-398 и 420-588, используют для получения функционально активного пептида. Поэтому антигенный пептид PCSK9 по изобретению также включает пептиды, которые функционально эквивалентны одному или более чем одному из пептидов SEQ ID NO:1-312, 330-398 и 420-588 и которые кодируются молекулой нуклеиновой кислоты, которая гибридизуется с нуклеиновой кислотой, кодирующей любую из SEQ ID NO:1-312, 330-398 и 420-588 или ее комплементом. Специалист в данной области может легко определить последовательности нуклеиновой кислоты, которые кодируют пептиды по изобретению, с использованием общедоступных таблиц кодонов. Как таковые, эти последовательности нуклеиновой кислоты не представлены в данной заявке.

Жесткость гибридизации для нуклеиновой кислоты, кодирующей пептид, полипептид или белок, который является функционально активным вариантом, представляет собой, например, 10% формамида, 5 × SSPE, 1 × раствор Денхардта и 1 × ДНК спермы лосося (условия низкой жесткости). Более предпочтительными условиями являются 25% формамида, 5 × SSPE, 1 × раствор Денхардта и 1 × ДНК спермы лосося (условия умеренной жесткости), и еще более предпочтительными условиями являются 50% формамида, 5 × SSPE, 1 × раствор Денхардта и 1 × ДНК спермы лосося (условия высокой жесткости). Однако на жесткость гибридизации влияют и некоторые другие факторы, помимо описанной выше концентрации формамида, и специалист в данной области техники может соответственно выбрать эти факторы для достижения сходной жесткости.

Молекулы нуклеиновой кислоты, кодирующие функционально активный вариант, также могут быть выделены методом генной амплификации, таким как ПЦР (полимеразная цепная реакция) с использованием участка молекулы нуклеиновой кислоты ДНК, кодирующей интересующий пептид, полипептид или белок, например, любой из пептидов, представленных в SEQ ID NO:1-312, 330-398 и 420-588, в качестве зонда.

В одном воплощении изобретения пептид по изобретению происходит из природного источника и выделен из млекопитающего, такого как человек, примат, кошка, собака, лошадь, мышь или крыса, предпочтительно из человеческого источника. Пептид по изобретению, таким образом, может быть выделен из клеток или тканей с использованием стандартных методов очистки белка.

Альтернативно, пептиды по изобретению могут быть синтезированы химически или получены с использованием методов рекомбинантной ДНК.

Например, пептид по изобретению может быть синтезирован с помощью твердофазных процедур, хорошо известных в данной области техники. Подходящие синтезы можно выполнять с использованием "Т-boc" или "F-moc" процедур. Циклические пептиды могут быть синтезированы с помощью твердофазной процедуры с использованием хорошо известной "F-moc" процедуры и полиамидной смолы в полностью автоматизированном аппарате. Альтернативно, специалисты в данной области техники знают необходимые лабораторные методы для выполнения процесса вручную. Методы и процедуры твердофазного синтеза описаны в "Solid Phase Peptide Synthesis: A Practical Approach" by E. Atherton and R. C. Sheppard, published by IRL at Oxford University Press (1989) и "Methods in Molecular Biology", Vol.35: Peptide Synthesis Protocols (ed. M.W.Pennington and B.M.Dunn), chapter 7, pp91-171 by D.Andreau et al.

Альтернативно, полинуклеотид, кодирующий пептид по изобретению моет быть введен в экспрессирующий вектор, который можно экспрессировать в подходящей системе экспрессии с использованием методов, хорошо известных в данной области, с последующим выделением или очисткой экспрессированного пептида, полипептида или белка, представляющего интерес. Разнообразные экспрессионные системы бактерий, дрожжей, растений, млекопитающих и насекомых доступны в данной области техники и можно использовать любую такую экспрессионную систему. В некоторых случаях полинуклеотид, кодирующий пептид по изобретению, можно перенести в бесклеточную трансляционную систему.

Антигенные пептиды PCSK9 по изобретению также могут содержать пептиды, которые возникают в результате существования множественных генов, альтернативных транскрипционных событий, событий альтернативного сплайсинга РНК и альтернативных трансляционных и посттрансляционных событий. Пептид можно экспрессировать з системах, например культивируемых клетах, которые приводят по существу к таким же посттрансляционным модификациям, что и в том случае, когда пептид экспрессируется в нативной клетке, или в системах, которые приводят к изменению или пропуску посттрансляционных модификаций, например, гликозилирования или расщепления, присутствующих при экспрессии в нативной клетке.

Антигенный пептид PCSK9 по изобретению может быть получен в виде слитого белка, который содержит другие не-PCSK9 или не-PCSK9-происходящие аминокислотные последовательности, такие как аминокислотные линкеры, или сигнальные последовательности, или иммуногенные носители, как определено в данной заявке, а также лиганды, полезные для очистки белка, такие как глутатион-3-трансферазу, гистидиновую метку и стафилококковый белок А. В слитом белке может присутствовать более чем один антигенный пептид PCSK9 по изобретению. Гетерологичный полипептид может быть слит, например, с N- концом или С-концом пептида по изобретению. Пептид по изобретению также может быть получен в виде слитых белков, содержащих гомологичные аминокислотные последовательности, т.е. другие PCSK9 или PCSK9-происходящие последовательности.

Антигенные пептиды PCSK9 по изобретению могут быть линейными или конформационно ограниченными. Используемый в данной заявке в отношении пептида термин "конформационно ограниченный" означает пептид, в котором трехмерная структура поддерживается по существу в одном пространственном расположении в течение времени. Конформационно ограниченные молекулы могут иметь улучшенные свойства, такие как повышенную аффинность, метаболическую стабильность, проницаемость мембран или растворимость.

Кроме того, такие конформационно ограниченные пептиды, как ожидается, представляют эпитоп антигенного PCSK9 в конформации, сходной с конформацией их нативной петли, таким образом индуцируя более чувствительные антитела против PCSK9 распознавать интактные, нативные собственные молекулы PCSK9 или антитела против PCSK9 с повышенной аффинностью распознавать собственные молекулы PCSK9. Методы конформационных ограничений хорошо известны специалистам и включают, без ограничения, образование мостиков и циклизацию.

Имеется несколько подходов, известных из предшествующего уровня техники, для введения конформационных ограничений в линейный пептид. Например, образование мостиков между двумя соседними аминокислотами в пептиде приводит к локальному конформационному изменению, гибкость которого ограничена по сравнению с обычными пептидами. Некоторые возможности для образования таких мостиков включают введение лактамов и пиперазинонов (см. обзор Giannis and. Kolter, Angew. Chem. int. Ed., 1993,32: 1244).

Используемый в данной заявке в отношении пептида термин "циклический" относится к структуре, включающей внутримолекулярную связь между двумя несмежными аминокислотами или аминокислотными аналогами. Циклизация может осуществляться посредством ковалентной или нековалентной связи. Внутримолекулярные связи включают, но не ограничиваются этим, связи скелета со скелетом, боковой цепи со скелетом, боковой цепи с боковой цепью, боковой цепи с концевой группой, "конец в конец". Способы циклизации включают, без ограничения, образование амидной связи между N-концевым остатком и С-концевым остатком пептида, образование дисульфидной связи между боковыми цепями несмежных аминокислот или аминокислотных аналогов; образование амидной связи между боковыми цепями остатков Lys и Asp/Glu; образование сложноэфирной связи между сериновыми остатками и остатками Asp/Glu; образование лактамной связи, например, между группой боковой цепи одной аминокислоты или его аналога с N-концевым амином аминоконцевого остатка и образование лизинонорлейцина и дитирозиновых связей. Также могут быть использованы углеродные варианты дисульфидных связей, например, этенильная или этильная связь (J. Peptide Sc., 2008, 14, 898-902), а также реакции алкилирования с соответствующим образом полизамещенным электрофильным реагентом, как ди-, три- или тетрагалогеноалкан (PNAS, 2008, 105(40), 15293-15298; ChemBioChem, 2005, 6, 821-824). Для введения конформационных ограничений в пептиды также могут быть использованы различные модифицированные аналоги пролина (Zhang et al., J. Med Chem., 1996,39: 2738-2744; Pfeifer and Robinson, Chem. Comm., 1998, 1977-1978). Химия, которая может быть использована для циклизации пептидов по изобретению, приводит к пептидам, циклизованным связью, включающей, но не ограничивающейся этим, следующие связи: лактамные, гидразоновые, оксимные, тиазолидиновые, тиоэфирные или сульфониевые связи.

Еще один подход в конструировании конформационно ограниченных пептидов, который описан в US 10/114918, заключается в присоединении короткой аминокислотной последовательности, представляющей интерес; к матрице с получением циклического конформационно ограниченного пептида. Такие циклические пептиды не только структурно стабилизированы их матрицами и таким образом обеспечивают трехмерные конформации, которые могли имитировать конформационные эпитопы на нативном белке, таком как на вирусах и паразитах или на собственных белках (аутологичные белки млекопитающих, такие как PCSK9), но они также являются более устойчивыми, чем линейные пептиды, к протеолитической деградации в сыворотке. В US 10/114918 также описан синтез конформационно ограниченных сшитых пептидов посредством получения синтетических аминокислот для связывания скелета с соответственно расположенными аминокислотами с целью стабилизации надвторичной структуры пептидов. Сшивание может быть достигнуто с помощью амидного связывания первичной аминогруппы ортогонально защищенного (2S,3R)-3-аминопролинового остатка с соответствующим образом расположенной карбоксильной группой боковой цепи глутамата. Этого подхода придерживались при получении конформационно ограниченных тетрапептидных повторов CS белка, где по меньшей мере один пролин был заменен (2S,3R)-3-аминопролином и, для того, чтобы ввести карбоксильную группу боковой цепи, глутамат был включен в качестве замены аланина.

Стратегии сшивания также включают применение реакции метатезиса с закрытием цикла по Граббсу (Grubbs) с образованием "закрепленных" ("stapled") пептидов, предназначеных для имитации альфа-спиральных конформации (Angew. Int. Ed. Engl., 1998, 37, 3281; JACS, 2000, 122, 5891); применение полифункционализированных сахаридов; применение триптатиониновой связи (Chemistry Ей. J., 2008, 24, 3404-3409); применение "клик" реакции азидов и алкинов, которые могут быть включены либо в виде аминокислотных остатков боковой цепи, либо расположены в пределах скелета пептидной последовательности (Drug Disc. Today, 2003, 8(24), 1128-1137). Из литературы также известно, что ионы металлов могут стабилизировать ограниченные конформации линейных пептидов посредством секвестрирования специфических остатков, например, гистидина, который находится координацииии с катионами металлов (Angew. Int. Ed. Engl., 2003, 42, 421). Аналогично, функционализацию линейной пептидной последовательности неприродной кислотной и аминной функциональной группой, или полиаминной и поликислотной функциональной группой можно использовать для обеспечения доступа к циклизованным структурам после активации и образования амидной связи.

Согласно одному из воплощений антигенный пептид PCSK9 конформационно ограничен посредством образования внутримолекулярных ковалентных связей двух несмежных аминокислот антигенного пептида PCSK9 друг с другом, например N- и С-концевых аминокислот. Согласно другому воплощению антигенный пептид PCSK9 по изобретению конформационно ограничен посредством посредством образования ковалентной связи с каркасной молекулой. Согласно дополнительному воплощению антигенный пептид PCSK9 является просто ограниченным, т.е. присоединен либо одним концом (С- или N-концом), либо через другую аминокислоту, не расположенную ни на одном из концов, к каркасной молекуле. Согласно другому воплощению антигенный пептид PCSK9 вдвойне ограничен, т.е. присоединен и С-, и N-концами к каркасной молекуле. Согласно другому воплощению антигенный пептид ограничен циклизацией посредством матричного эффекта гетерохиральной дипролиновой единицы (D-Pro-L-Pro) (Spath et al., 1998, Helvetica Chimica Acta 81, p 1726-1738).

Каркас (также называемый "платформой") может представлять собой любую молекулу, которая способна снижать, посредством образования ковалентных связей, число конформаций, которые может принимать антигенный пептид PCSK9. Примеры конформационно ограниченных каркасов включают белки и пептиды, например, липокалин-родственные молекулы, такие как бета-баррель-содержащие тиоредоксиновые и тиоредоксин-подобные белки, нуклеазы (например, РНКаза А), протеазы (например, трипсин), ингибиторы протеаз (например, эглин С), антитела или их структурно жесткие фрагменты, флуоресцентные белки, такие как GFP (зеленый флуоресцентный белок) или YFP (желтый флуоресцентный белок), конотоксины, петлевые участки домена фибронектина типа III, CTL-A4 и вирусоподобные частицы (VLP).

Другие подходящие молекулы платформы включают углеводы, такие как сефароза. Платформа может представлять собой линейную или кольцевую молекулую, например, закрытую с образованием петли. Платформа, как правило, является гетерологичной относительно антигенного пептида PCSK9. Предполагают, что такие конформационно ограниченные пептиды, связанные с платформой, являются более устойчивыми к протеолитической деградации, чем линейный пептид.

Согласно предпочтительному воплощению каркас представляет собой иммуногенный носитель, как определено в настоящей заявке. В другом воплощении антигенный пептид PCSK9 является просто ограниченным на иммуногенном носителе. В другом воплощении антигенный пептид PCSK9 вдвойне ограничен на иммуногенном носителе. Таким образом, антигенный пептид PCSK9 образует конформационно ограниченную петлевую структуру, которая оказалась особенно подходящей структурой в качестве внутриклеточной молекулы распознавания.

Антигенные пептиды PCSK9 по изобретению могут быть модифицированы для удобства конъюгирования с платформой, например, путем добавления концевого цистеина на одном или обоих концах и/или путем добавления линкерной последовательности, такой как двойная глициновая голова или хвост плюс концевой цистеин, линкера, заканчивающегося остатком лизина или любым другим линкером, известным специалистам в данной области техники для выполнения такой функции. Подробная информация о таких линкерах раскрыта ниже. Также можно использовать биортогональную химию (такую как "клик"-реакция, описанная выше) для связывания полной пептидной последовательности с носителем, таким образом избегая любых региохимических и химиоселективных ограничений. Также могут быть использованы жесткие линкеры, такие как описаны в Jones et al. Angew. Chem. Int. Ed. 2002, 41:4241-4244, которые, как известно, вызывают улучшенный иммунный ответ. В другом воплощении антигенный пептид PCSK9 присоединяют к поливалентной матрице, которая сама по себе связана с носителем, таким образом увеличивая плотность антигена (см. ниже). Поливалентная матрица может представлять собой соответствующим образом функционализированный полимер или олигомер, такой как (но не ограничиваясь этим) олигоглутамат или олигохитозан (см. Фиг.19).

Иммуногенный носитель по изобретению

В одном из воплощений настоящего изобретения антигенный пептид PCSK9 по изобретению связан с иммуногенной молекулой-носителем с образованием иммуногенов для протоколов вакцинации, предпочтительно, где молекула-носитель не является родственной молекуле нативного PCSK9.

Термин "иммуногенный носитель" в данной заявке включает такие вещества, которые обладают свойством независимо вызывать иммуногенный ответ у животного-хозяина и которые могут быть коаалентно связаны с пептидом, полипептидом или белком либо непосредственно через образование пептидных или сложноэфирных связей между свободными карбоксильными, амино- или гидроксильными группами в пептиде, полипептиде или белке и соответствующими группами на иммуногенном веществе-носителе, либо, альтернативно, посредством связывания через стандартную бифункциональную связывающую группу, либо в виде слитого белка.

Типы носителей, используемых в иммуногенах по настоящему изобретению, хорошо известны специалисту в данной области техники. Примеры таких иммуногенных носителей представляют собой: сывороточные альбумины, такие как бычий сывороточный альбумин (БСА); глобулины; тиреоглобулины; гемоглобины; гемоцианины (в частности гемоцианин лимфы улитки [KLH]); полилизин; полиглутаминовую кислоту; сополимеры лизин-глутаминовой кислоты; сополимеры, содержащие лизин или орнитин; липосомальные носители; очищенное белковое производное туберкулина (PPD); инактивированные бактериальные токсины и анатоксины, такие как столбняк и дифтерийные токсины (ТТ и DT) или фрагмент С из ТТ, CRM197 (нетоксичный, но антигенно идентичный вариант дифтерийного токсина), другие точечные мутанты DT, такие как CRM176, CRM228, CRM 45 (Uchida et al J. Biol. Chem. 218; 3838-3844, 1973); CRM 9, CRM 45, CRM102, CRM103 и CRM107 и другие мутации, описанные Nicholls и Youle в Genetically Engineered Toxins, Ed: Frankel, Maecel Dekker Inc, 1992, делецию или мутацию Glu-148 на Asp, Gln или Ser, и/или Ala-158 на Gly, и другие мутации, описанные в US 4709017 или US 4950740; мутацию по меньшей мере одного или более остатков Lys 516, Lys 526, Phe 530 и/или Lys 534 и другие мутации, описанные в US 5917017 или US 6455673; или фрагмент, описанный в US 5843711, пневмококковый пневмолизин (Kuo et al (1995) Infect Immun 63; 2706-13), включающий ply, детоксифицированный некоторым образом, например, dPLY-GMBS (WO 04081515, PCT/EP2005/010258) или dPLY-формалин, PhtX, включая PhtA, PhtB, PhtD, PhtE (последовательности PhtA, PhtB, PhtD или PhtE раскрыты в WO 00/37105 или WO 00/39299) и слияния Pht белков, например, PhtDE слияния, PhtBE слияния, Pht A-E (WO 01/98334, WO 03/54007, WO 2009/000826), OMPC (менингококковый белок наружной мембраны - обычно экстрагируется из N. meningitidis серсгруппы В - ЕР0372501), PorB (из N. meningitidis), PD (белок D Haemophilus influenzae - см., например, ЕР 0594610 В) или его иммунологически функциональные эквиваленты, синтетические пептиды (ЕР 0378881, ЕР 0427347), белки теплового шока (WO 93/17712, WO 94/03208), коклюшные белки (WO 98/58668, ЕР 0471177), цитокины, лимфокины, ростовые факторы и гормоны (WO 91/01146), искусственные белки, содержащие множественные человеческие CD4+Т-клеточные эпитопы из различных патоген-происходящих антигенов (Falugi et al (2001) Eur J Immunol 31; 3816-3824), таких как белок N19 (Baraldoi et al (2004) Infect immun 72; 4884-7). пневмококковой поверхностный белок PspA (WO 02/091998), белки захвата железа (WO 01/72337), токсин А или В из C. difficile (WO 00/61761).

В предпочтительном воплощении иммуногенный носитель по изобретению представляет собой CRM197.

В другом воплощении иммуногенный носитель представляет собой вирусоподобную частицу (VLP). предпочтительно рекомбинантную вирусоподобную частицу.

Используемый в данной заявке термин "вирусоподобная частица" относится к структуре, напоминающей вирусную частицу, но которая, как было продемонстрировано, не является патогенной. В общем, вирусоподобные частицы лишены по меньшей мере части вирусного генома. Кроме того, вирусоподобные частицы часто могут быть получены в больших количествах посредством гетерологичной экспрессии и могут быть легко очищены. Вирусоподобная частица согласно изобретению может содержать нуклеиновую кислоту, отличную от их генома. Типичное и предпочтительное воплощение вирусоподобной частицы согласно настоящему изобретению представляет собой вирусный капсид, такой как вирусный капсид соответствующего вируса, бактериофага или РНК-фага.

Используемый в данной заявке термин "вирусоподобная частица бактериофага" относится к вирусоподобной частице, напоминающей структуру бактериофага, являющейся нерепликативной и неинфекционной и лишенной по меньшей мере гена или генов, кодирующих репликационный аппарат бактериофага и, как правило, также лишенной гена или генов, кодирующих белок или белки, отвечающие за присоединение вируса к хозяину или проникновение в него. Это определение должно, однако, также охватывать вирусоподобные частицы бактериофагов, в которых вышеупомянутые ген или гены все же присутствуют, но неактивны и поэтому также приводят к образованию нерепликативных и неинфекционных вирусоподобных частиц бактериофага.

Капсидная структура, образованная в результате самосборки 180 субьединиц оболочечного белка РНК-фага и возможно содержащая РНК хозяина, называется в данной заявке как "VLP оболочечного белка РНК-фага". Конкретными примерами являются VLP оболочечных белков Qbeta, MS2, РР7 или АР205. В конкретном случае оболочечного белка Qbeta, например, VLP может собираться либо исключительно из субъединиц СР Qbeta (образованных в результате экспрессии гена СР Qbeta, содержащего, например, стоп-кодон ТАА, препятствующий экспрессии более длинного белка А1 посредством супрессии, см. Kozlovska, Т. М., et al., Intervirology 39: 9-15 (1996)), либо дополнительно содержать субъединицы белка А1 при сборке капсида. Как правило, процентное содержание белка А1 Qbeta относительно СР Qbeta при сборке капсида будет ограничено для обеспечения образования капсида. Примеры VLP, подходящих в качестве иммуногенных носителей в контексте настоящего изобретения, включают, но не ограничиваются этим, VLP Qbeta, MS2, РР7, АР205 и других оболочечных белков бактериофагов, капсидных и коровых белков вируса гепатита В (Ulrich, et al., Virus Res. 50: 141-182 (1998)), вируса кори (Warnes, et al., Gene 160: 173-178 (1995)), вируса Синдбис, ротавируса (патенты США №№5071651 и 5374426), вируса ящура (Twomey, et al., Vaccine 13: 1603-1610, (1995)), норовируса (Jiang, X., et al., Science 250: 1580-1583 (1990); Matsui, S.М., et al., J Clin. Invest. 87: 1456-1461 (1991)), ретровирусного белка GAG (патентная заявка РСТ № WO 96/30523), белка pl ретротранспозона Ту, поверхностного белка вируса гепатита В (WO 92/11291), вируса папилломы человека (WO 98/15631), вируса полиомы человека (Sasnauskas К., et al., Biol. Chem. 380 (3): 381-386 (1999); Sasnauskas К, et al., Generation of recombinant virus-like particles of different polyomaviruses in yeast. 3rd Interational Workshop "Virus-like particles as vaccines". Berlin, September 26-29 (2001)), РНК-фагов, Ty, fr фага, GA-фага, АР 205-фага и, в частности, Qbeta-фага, вируса хлоротической пятнистости коровьего гороха, вируса мозаики коровьего гороха, вирусов папилломы человека (HPV), вирусов папилломы крупного рогатого скота, парвовируса свиньи, парвовирусов, таких как В19, парвовирусов свиньи (PPV) и собаки (CPV), калицивирусов (например норовируса. вируса геморрагической болезни кролика [RHDV]), VLP коревого антигена гепадновируса животных, нитчатых/палочковидных вирусов растений, включая, но не ограничиваясь этим, вирус табачной мозаики (TMV), вирус- Х картофеля (PVX), вирус мозаики папайи (PapMV), вирус мозаики люцерны (AIMV) и вирус мозаики травы по Джонсону (JGMV), вирусы насекомых, такие как вирус flock house (FHV) и тетравирусы, полиомавирусы, такие как полиомавирус мышей (MPyV), пневмотропный вирус мышей (MPtV), вирус ВК (BKV) и вирус JC (JCV).

Как будет очевидно специалистам в данной области, VLP, которые используются в качестве иммуногенного носителя по изобретению, не ограничивается какой-либо конкретной формой. Частицу может быть синтезирована химически или посредством биологического процесса, который может быть природным или неприродным. В качестве примера, этот тип воплощения включает вирусоподобную частицу или ее рекомбинантную форму. В более конкретном воплощении VLP может содержать или альтернативно состоять из рекомбинантных полипептидов любого вируса, которые, как известно, образуют VLP. Вирусоподобная частица может дополнительно содержать или альтернативно состоять из одного или более фрагментов таких полипептидов, а также вариантов таких полипептидов. Варианты полипептидов могут иметь, например, по меньшей мере 80%, 85%, 90%, 95%, 97% или 99%-ную идентичность на аминокислотном уровне с аналогами дикого типа. Варианты VLPs, подходящие для применения в настоящем изобретении, могут происходить из любого организма, пока они способны образовывать "вирусоподобную частицу" и могут быть использованы в качестве "иммуногенного носителя", как определено в данной заявке.

Предпочтительные VLPs согласно изобретению включают капсидный белок или поверхностный антиген HBV (HBcAg и HBsAg, соответственно) или рекомбинантные белки или их фрагменты, и оболочечные белкки РНК-фагов или рекомбинантные белки или их фрагменты, более предпочтительно оболочечный белок Qbeta или рекомбинантные белки или их фрагменты.

В одном из воплощений иммуногенный носитель, используюемый в комбинации с антигенным пептидом PCSK9 по изобретению, представляет собой белок HBcAg. Примеры белков HBcAg, которые можно использовать в контексте настоящего изобретения, могут быть легко определены специалистом в данной области техники. Примеры включают, но не ограничиваются этим, коровые белки HBV, описанные в Yuan et al., (J. Virol. 73: 10122-10128 (1999)) и в WO 00/198333, WO 00/177158, WO 00/214478, WO 00/32227, WO 01/85208, WO 02/056905, WO 03/024480 и WO 03/024481. HBcAgs, подходящие для применения в настоящем изобретении, могут происходить из любого организма, пока они способны образовывать "вирусоподобную частицу" и могут быть использованы в качестве "иммуногенного носителя"; как определено в данной заявке.

Варианты HBcAg, представляющие особый интерес, которые могут быть использованы в контексте настоящего изобретения, представляют собой такие варианты, в которых один или более постоянно присутствующих остатков цистеина были либо делегированы, либо заменены. В данной области техники хорошо известно, что свободные остатки цистеина могут быть вовлечены в различные химические побочные реакции, включающие дисульфидный обмен, реакцию с химическими веществами или метаболитами, которые, например, вводятся или образуются при комбинированной терапии с другими веществами, или прямое окисление и реакцию с нуклеотидами под воздействием УФ света. Таким образом, могут быть получены поксичные аддукты, особенно учитывая тот факт, что HBcAgs имеют сильную тенденцию связывать нуклеиновые кислоты. Токсичные аддукты, таким образом, будут распределяться между множеством видов, которые индивидуально могут присутствовать в низкой концентрации, но достигают токсичного уровня, когда рассматриваются вместе. В связи с вышеизложенным одно из преимуществ применения HBcAgs в вакцинных композициях, которые были модифицированы для удаления постоянно присутствующих остатков цистеина, заключается в том, что количество сайтов, с которыми могут связываться токсичные виды, когда присоединяются антигены или антигенные детерминанты, будут уменьшено или эти сайты будут вообще ликвидированы.

Кроме того, процессированная форма HBcAg, лишенную N-концевой лидерной последовательности белка-предшественника коревого антигена вируса гепатита В, также может быть использована в контексте данного изобретения, особенно когда HBcAg продуцируется в условиях, где процессинг не происходит (например, при экспрессии в бактериальных системах).

Другие HBcAg варианты согласно изобретению включают: 1) полипептидную последовательность, по меньшей мере на 80%, 85%, 90%, 95%, 97% или 99% идентичную одной из аминокислотных последовательностей HBcAg дикого типа или его субфрагмента при использовании известных компьютерных программ, 2) мутанты с С-концевым укорочением, включающие мутанты, у которых 1, 5, 10, 15, 20, 25, 30, 34 или 35 аминокислот были удалены с С-конца, 2) мутанты с N-концевым укорочением, включающие мутанты, у которых 1, 2, 5, 7, 9, 10, 12, 14, 15 или 17 аминокислот были удалены с N-конца, 3) мутанты, укороченные как по N-концу, так и по С-концу, включают HBcAgs, у которых 1, 2, 5, 7, 9, 10, 12, 14, 15 или 17 аминокислот были удалены с N-конца и 1, 5, 10, 15, 20, 25, 30, 34 или 35 аминокислот были удалены с С-конца.

Другие варианты белков HBcAg в пределах объема изобретения представляют собой варианты, модифицированные с целью увеличения иммуногенной презентации чужеродного эпитопа, где один или более из четырех аргининовых повторов были делегированы, но в которых сохранен С-концевой цистеин (см., например, WO 01/98333), и химерный, укороченный по С-концу HBcAg, такое как описано в WO 02/14478, WO 03/102165 и WO 04/053091.

В другом воплощении иммуногенный носитель, используемый в комбинации с антигенным пептидом PCSK9 по изобретению, представляет собой белок HBsAg. Белки HBsAg, которые могут быть использованы в контексте настоящего изобретения, могут быть легко определены специалистом в данной области техники. Примеры включают, но не ограничиваются этим, поверхностные белки HBV, описанные в US 5792463, WO 02/10416 и WO 08/020331. HBsAgs, подходящие для применения в настоящем изобретении, могут происходить из любого организма, пока они способны образовывать "вирусоподобную частицу" и могут быть использованы в качестве "иммуногенного носителя", как определено в данной заявке.

В еще одном воплощении иммуногенный носитель, используемый в комбинации с антигенным пептидом или полипептидом PCSK9 по изобретению, представляет собой оболочечный белок Qbeta.

Обнаружили, что оболочечный белок Qbeta самоорганизуется в капсиды при экспрессии в E. coli (Kozlovska TM. et al., GENE 137: 133-137 (1993)). Полученные капсиды или вирусоподобные частицы продемонстрировали икосаэдрическую фагоподобную капсидную структуру с диаметром 25 нм и Т=3 квази-симметрию. Кроме того, была получена кристаллическая структура фага Qss. Капсид содержит 180 копий оболочечного белка, которые связаны в ковалентные пентамеры и гексамеры посредством дисульфидных мостиков (Golmohammadi, R. et al., Structure 4: 5435554 (1996)), приводящих к замечательной стабильности капсида из оболочечного белка Qbeta. Капсидный белок Qbeta также демонстрирует необычную устойчивость к органическим растворителям и денатурирующим агентам. Высокая стабильность капсида из оболочечного белка Qbeta является выгодным признаком, в частности, для его применения в иммунизации или вакцинации млекопитающих и людей согласно настоящему изобретению.

Примеры оболочечных белков Qbeta, которые могут быть использованы в контексте настоящего изобретения, могут быть легко определены специалистом в данной области техники. Примеры были подробно описаны в WO 02/056905, WO 03/024480, WO 03/024481 (включены посредством ссылки во всей своей полноте) и включают, но не ограничиваются этим, аминокислотные последовательности, раскрытые в базе данных PIR (Protein Information Resource), № доступа VCBPQbeta относится к СР Qbeta; № доступа ААА16663 относится к белку А1 Qbeta; и их варианты, включающие варианты белков, в которых N-концевой метионин отщеплен; формы А1 Qbeta, укороченные по С-концу, у которых отсутствуют 100, 150 или 180 аминокислот; варианты белков, которые были модифицированы посредством удаления остатка лизина в результате делеции или замены, или посредством добавления остатка лизина в результате замены или вставки (см., например, Qbeta-240, Qbeta-243, Qbeta-250, Qbeta-251 и Qbeta-259, описанные в WO 03/024481, включенные посредством ссылки во всей своей полноте), и варианты, демонстрирующие по меньшей мере 80%, 85%, 90%, 95%, 97% или 99%-ную идентичность с любым из коревых белков Qbeta, описанных выше. Варианты оболочечных белков Qbeta, подходящие для применения в настоящем изобретении, могут происходить из любого организма, пока они способны образовывать "вирусоподобную частицу" и могут быть использованы в качестве "иммуногенных носителей", как определено в данной заявке.

Антигенные пептиды PCSK9 по изобретению могут быть связаны с иммуногенными носителями посредством химического конъюгирования или посредством экспрессии генетически созданных партнеров слияния. Связывание не обязательно должно быть прямым, но может осуществляться посредством линкерных последовательностей. В целом, в случае, когда антигенные пептиды либо слиты, конъюгированы, либо иным образом присоединены к иммуногенному носителю, спейсерные или линкерные последовательности обычно добавляют к одному или обоим концам антигенных пептидов. Такие линкерные последовательности, как правило, содержат последовательности, распознаваемые протеасомой, протеазами из эндосом или другого везикулярного компартмента клетки.

В одном из воплощений пептиды по настоящему изобретению экспрессируются в виде слитых белков с иммуногенным носителем. Слияние пептида может быть осуществлено путем вставки в первичную последовательность иммуногенного носителя или путем слияния с N- или С-концом иммуногенного носителя. В дальнейшем, когда речь идет о слитых белках пептида с иммуногенным носителем, рассматриваются либо слияние с любым из концов последовательности субъединицы, либо внутреннее вставки пептида в пределах последовательности носителя. Слияние, о чем говорится далее, может быть осуществлено путем вставки антигенного пептида в последовательность носителя, путем замещения части последовательности носителя антигенным пептидом, или посредством комбинации делеции, замены или вставок.

Когда иммуногенный носитель представляет собой VLP, субъединица химерный антигенный пептид-VLP обычно будет способна к самосборке в VLP. VLP, экспонирующие эпитопы, слитые с их субъединицами, также называются в данной заявке химерными VLPs. Например, в ЕР 0421635 В описано применение химерных гепаднавирусных коровых антигенных частиц для презентации чужеродных пептидных последовательностей в вирусоподобной частице.

Фланкирующие аминокислотные остатки могут быть добавлены к любому концу последовательности антигенного пептида, подлежащего слиянию с любым концом последовательности субъединицы VLP, или для внутренней вставки такой пептидной последовательности в последовательность субъединицы VLP. Остатки глицина и серина являются особенно предпочтительными аминокислотами, используемыми во фланкирующих последовательностях, добавляемых к пептиду, подлежащему слиянию. Остатки глицина придают дополнительную гибкость, которая может снижать потенциально дестабилизирующий эффект слияния чужеродной последовательности с последовательностью субъединицы VLP.

В конкретном воплощении изобретения иммуногенный носитель представляет собой VLP HBcAg. Слитые белки антигенного пептида либо с N-концом HBcAg (Neyrinck, S. et al., Nature Med. 5: 11571163 (1999)), либо со вставками в так называемый основной иммунодоминантный участок (MIR) были описаны (Pumpens, P. and Grens, E., Intervirology 44: 98114 (2001)), WO 01/98333) и представляют конкретные воплощения изобретения. Встречающиеся в природе варианты HBcAg с делениями в MIR также были описаны (Pumpens, P. and Grens, E., Intervirology 44: 98-114 (2001)), и слияния с N- или С-концом, а также вставки в положение MIR, соответствующее сайту делеции по сравнению с wt HbcAg, представляют дополнительные воплощения изобретения. Слияния с С-концом также были описаны (Pumpens, P. and Grens, E., Intervirology 44: 98-114 (2001)). Специалист в данной области техники легко найдет рекомендации, как сконструировать слитые белки с использованием классических методов молекулярной биологии. Векторы и плазмиды, кодирующие слитые белки HBcAg и HBcAg и полезные для экспрессии слитых белков HBcAg и HbcAg, были описаны (Pumpens, P. and Grens, E. Intervirology 44: 98-114 (2001), Neyrinck, S. et al., Nature Med. 5: 1157-1163 (1999)) и могут быть использованы при практическом осуществлении изобретения. Важным фактором для оптимизации эффективности самосборки и экспозиции эпитопа, подлежащего вставке в MIR HbcAg, является выбор сайта вставки, а также числа аминокислот, подлежащих делеции из последовательности HBcAg в пределах MIR (Pumpens, P. and Grens, E., Intervirology 44: 98-114 (2001); EP 0421635; патент США №6231864) после вставке, или, другими словами, какие аминокислоты из HBcAg должны быть замены новым эпитопом. Например, была описана замена аминокислот 76-80, 79-81, 79-80, 75-85 или 80-81 HBcAg чужеродными эпитопами (Pumpens, P. and Grens, E., Intervirology 44: 98-114 (2001); EP 0421635; США №6231864, WO 00/26385). HBcAg содержит длинный аргининовый хвост (Pumpens, P. and Grens, E., Intervirology 44: 98-114 (2001)), который является необязательным для сборки капсида и способен связывать нуклеиновые кислоты (Pumpens, P. and Grens, E., intervirology 44: 98-114 (2001)). HbcAg, либо содержащий, либо не содержащий такого аргининового хвоста, оба представляют собой воплощения изобретения.

В другом конкретном воплощении изобретения иммуногенный носитель представляет собой VLP РНК-фага, предпочтительно Qbeta. Основные оболочечные белки РНК-фагов спонтанно собираются в VLPs после экспрессии в бактериях и, в частности, в E. coli. Конструкции слитого белка, где антигенные пептиды были слиты с С-концом укороченной формы белка А1 Qbeta или встроены в пределах белка А1, были описаны (Kozlovska, Т. М., et al., Intervirology, 39: 9-15 (1996)). Белок А1 образуется путем подавления стоп-кодона UGA и имеет длину 329 а.к. или 328 а.к., если принять во внимание отщепление N-концевого метионина. Отщепление N-концевого метионина перед аланином (вторая аминокислота, кодируемая геном СР Qbeta) обычно наблюдается в E. coli, и это происходит в случае N-концов оболочечных белков Qbeta. Часть гена А1, с 3' амбер-кодона UGA кодирует удлинение СР, которое имеет длину 195 аминокислот. Вставка антигенного пептида между положением 72 и 73 удлинения СР приводит к дополнительным воплощениям изобретения (Kozlovska, Т. М., et al., Intervirology 39: 9-15 (1996)). Слияние антигенного пептида по С-концу укороченного с С-конца белка А1 Qbeta приводит к дополнительным предпочтительным воплощениям изобретения. Например, Kozlovska и др. (Intervirology, 39: 9-15 (1996)) описывают слияния белка А1 Qbeta, где эпитоп слит по С-концу удлинения СР Qbeta, укороченного в положении 19.

Как описано у Kozlovska и др. (Intervirology, 39: 9-15 (1996)), сборка частиц, экспонирующих слитые эпитопы, обычно требует присутствия как слияния A1 белка-антигена, так и wt СР для образования мозаичной частицы. Однако воплощения, содержащие вирусоподобные частицы и при этом, в частности, VLPs оболочечного белка РНК-фага Qbeta, которые состоят исключительно из VLP субъединиц, имеющих антигенный пептид, слитый с ними, также находятся в пределах объема настоящего изобретения.

Получение мозаичных частиц может осуществляться различными путями. В Kozlovska et al., Interviroiogy, 39: 9-15 (1996) описаны три способа, которые могут быть использованы при практическом осуществлении изобретения. В первом подходе эффективное экспонирование слитого эпитопа на VLPs опосредуется путем экспрессии плазмиды, кодирующей слитый белок Qbeta АН, имеющий стоп-кодон UGA между СР и удлинением СР в штамме Е. coli, содержащем плазмиду, кодирующую клонируемую супрессорную тРНК UGA, которая приводит к трансляции кодона UGA в Trp (плазмида р18М3001 (Smiley В.K., et al., Gene 134: 33-40 (1993))). В другом подходе стоп-кодон гена СР модифицируют в UAA, и вторую плазмиду, экспрессирующую слияние белок А1-антиген, подвергают котрансформации. Вторая плазмида кодирует устойчивость к другому антибиотику, и точка начала репликации совместима с первой плазмидой. В третьем подходе СР и слияние белок А1-антиген кодируют бицистронным методом, функциональным образом связывая с промотором, таким как Trp промотор, как описано на Фиг.1 в Kozlovska et al., Interviroiogy, 39: 9-15 (1996).

Другие VLPs, подходящие для слияния антигенов или антигенных детерминант, описаны в WO 03/024481 и включают бактериофаг fr, РНК-фаг MS-2, капсидный белок папилломавируса, ретротранспозон Тy, дрожжевые, а также ретровирус-подобные частицы, H1V2 Gag, мозаичный вирус коровьего гороха, VLP VP2 парвовируса, HBsAg (US 4722840, ЕР 0020416 В1). Примеры химерных VLPs, подходящих для практического осуществления изобретения, также описаны в Interviroiogy 39: 1 (1996). Другие примеры VLPs, предусмотренные для применения в изобретении, представляют собой: HPV-1, HPV-6, HPV-11, HPV-16, HPV-18, HPV-33, HPV-45, CRPV, COPY, HIV GAG, мозаичный вирус табака. Вирусоподобные частицы SV-40, полиомавируса, аденовируса, вируса простого герпеса, ротавируса и норовируса.

Для любого рекомбинантно экспрессирующегося антигенного пептида PCSK9 согласно изобретению, связанного или не связанного с иммуногенным носителем, нуклеиновая кислота, которая кодирует указанный пептид или белок также образует аспект настоящего изобретения, как и экспрессирующий вектор, содержащий нуклеиновую кислоту, и клетка-хозяин, содержащая экспрессирующий вектор (автономный или встроенный в хромосому). Способ рекомбинантного получения пептида или белка посредством экспрессии в вышеописанной клетке-хозяине и выделения из нее иммуногена представляет собой дополнительный аспект изобретения. Настоящее изобретение не включает полноразмерную нативную молекулу PCSK9 или полноразмерную нативную последовательность ДНК, кодирующую ее.

В другом воплощении пептид по изобретению химически связан с иммуногенным носителем с использованием методов, хорошо известных в данной области техники. Конъюгирование может происходить с целью обеспечения свободного движения пептидов через одну точку конъюгирозания (например, N-концевую или С-концевую точку) или в виде конформационно ограниченной (locked down) структуры, где оба конца пептидов конъюгированы либо с иммуногенным белком-носителем, либо с каркасной структурой, такой как VLP. Конъюгирование осуществляется посредством реакций конъюгации, известных специалистам в данной области техники, например, через остатки цистеина, остатки лизина или другие карбоксильные группировки, широко известные в качестве точек конъюгации, такие как глутаминовая кислота или аспарагиновая кислота. Таким образом, например, для прямого ковалентного связывания мжно использовать карбодиимид, глутаральдегид или (N-[y-малеимидобутирилокси]сукцинимидный сложный эфир, используя обычные имеющиеся в продаже гетеробифункциональные линкеры, такие как CDAP и SPDP (с использованием инструкций производителя). Примеры конъюгирования пептидов, особенно циклизованных пептидов, с белком-носителем через ацилгидразиновые пептидные производные описаны в WO 03/092714. После реакции сочетания иммуноген может быть легко выделен и очищен с помощью метода диализа, метода гель-фильтрации, метода фракционирования и т.д. Пептиды, оканчивающиеся остатком цистеина (предпочтительно, с линкером за пределами циклизованного участка), могут быть соответственно конъюгированы с белком-носителем посредством малеимидной химии.

Когда иммуногенный носитель представляет собой VLP, отдельный антигенный пептид, либо имеющий идентичную аминокислотную последовательность, либо другую аминокислотную последовательность, может быть подвергнут сочетанию с одной молекулой VLP, что приводит предпочтительно к повторяющейся и упорядоченной структуре, представляющей несколько антигенных детерминант ориентированным образом, как описано в WO 00/32227, WO 03/024481, WO 02/056905 и WO 04/007538.

В предпочтительном воплощении антигенный пептид PCSK9 связан с VLP посредством химического сшивания, обычно и предпочтительно с использованием гетеробифункционального кросс-линкера. В данной области техники известно несколько гетеробифункциональных кросс-линкеров. В некоторых воплощениях гетеробифункциональный кросс-линкер содержит функциональную группу, которая может реагировать с первыми сайтами присоединения, т.е. с аминогруппой боковой цепи остатков лизина VLP или субъединицы VLP, и другой функциональной группой, которая может реагировать с предпочтительным вторым сайтом присоединения, т.е. остатком цистеина, слитым с антигенным пептидом и возможно также предоставленным для реакции путем восстановления. Первая стадия процедуры, обычно называемая дериватизацией, представляет собой реакцию VLP с кросс-линкером. Продукт этой реакции представляет собой активированную VLP, также называемую активированным носителем. На второй стадии непрореагировавший кросс-линкер удаляют, используя обычные способы, такие как гель-фильтрация или диализ. На третьей стадии антигенный пептид подвергают взаимодействию с активированной VLP, и эту стадию обычно называют стадией сочетания. Непрореагировавший антигенный пептид может быть возможно удален на четвертой стадии, например, посредством диализа. В данной области техники известно несколько гетеробифункциональных кросс-линкеров. Они включают предпочтительные кросс-линкеры SMPH (Pierce), Sulfo-MBS, Sulfo-EMCS, Sulfo-GMBS, Sulfo-SlAB, Suifo-SMPB, Sulfo-SMCC, SVSB, SIA и другие кросс-линкеры, доступные, например, от Pierce Chemical Company (Rockford, IL, USA) и имеющие одну функциональную группу, реактивную в отношении аминогрупп, и одну функциональную группу, реактивную в отношении остатков цистеина. Все вышеупомянутые кросс-линкеры приводят к образованию тиоэфирной связи.

Другой класс кросс-линкеров, подходящих для практического осуществления изобретения, характеризуются введением дисульфидной связи между антигенным пептидом и VLP при сочетании. Предпочтительные кросс-линкеры, относящиеся к этому классу, включают, например, SPDP и Sulfo-LC-SPDP (Pierce). На степень дериватизации VLP с кросс-линкером могут влиять различные экспериментальные условия, такие как концентрация каждого из партнеров реакции, избыток одного реагента над другим, рН, температура и ионная сила. Степень сочетания, т.е. количество антигенного пептида на субъединицы VLP, можно регулировать путем варьирования экспериментальных условий, описанных выше, для соответствия требования вакцины.

Другой способ связывания антигенных пептидов с VLP представляет собой связывание остатка лизина на поверхности VLP с остатком цистеина на антигенном пептиде В некоторых воплощениях может потребоваться слияние аминокислотного линкера, содержащего остаток цистеина, в качестве второго сайта присоединения или в виде его части для связывания антигенного пептида с VLP. В целом, гибкие аминокислотные линкеры являются предпочтительными. Примеры аминокислотного линкера выбраны из группы, состоящей из: (a) CGG; (б) N-концевого гамма 1-линкера; (в) N-концевого гамма 3-линкера; (г) шарнирных областей Ig; (д) N-концевых глициновых линкеров; (е) (G) kC (G) n, где n=0-12 и k=0-5; (ж) N-концевых глицин-сериновых линкеров; (з) (G) kC (G) m (S) i (GGGGS) n, где n=0-3, k=0-5, m=0-10, i=0-2; (и) GGC; (к) GGC-NH2; (л) С-концевого гамма 1-линкера; (м) С-концевого гамма 3-линкера; (н) С-концевых глициновых линкеров; (о) (G)nC(G)k, где n=0-12 и k=0-5; (п) С-концевых глицин-сериновых линкеров; (р) (G)m(S)t (GGGGS)n(G)oC (G) k, где n=0-3, k=0-5, m=0-10, t=0-2 и о=0-8. Другие примеры аминокислотных линкеров представляют собой шарнирную область иммуноглобулинов, глицин-сериновые линкеры (GGGGS)n и глициновые линкеры (G)n, которые все дополнительно содержат остаток цистеина в качестве второго сайта присоединения и возможно дополнительные остатки глицина. Как правило, предпочтительные примеры указанных аминокислотных линкеров представляют собой N-концевой гамма 1: CGUKTHTSPP; С-концевой гамма 1: DKTHTSPPCG; N-концевой гамма 3: CGGPKPSTPPGSSGGAP; С-концевой гамма 3: PKPSTPPGSSGGAPGGCG; N-концевой глициновый линкер: GCGGGG и С-концевой глициновый линкер: GGGGCG.

Другие аминокислотные линкеры, особенно подходящие для практического осуществления изобретения, когда гидрофобный антигенный пептид связан с VLP, представляют собой CGKKGG или CGDEGG для N-концевых линкеров, или GGKKGC и GGEDGC для С-концевых линкеров. Для С-концевых линкеров концевой цистеин возможно амидирован по С-концу.

В некоторых воплощениях настоящего изобретения GGCG, GGC или GGC-NH2 ("NH2" означает амидирование) линкеры на С-конце пептида или CGG на его N-конце являются предпочтительными в качестве аминокислотных линкеров. В общем, остатки глицина будут встраиваться между крупными аминокислотами и цистеином, используемым в качестве второго сайта присоединения, во избежание возможного стерического препятствия со стороны более крупной аминокислоты в реакции сочетания. В другом воплощении изобретения аминокислотный линкер GGC-NH2 слит с С-концом антигенного пептида.

Остаток цистеина, присутствующий на антигенном пептиде, должен находиться в своем восстановленном состоянии для взаимодействия с гетеробифункциональным кросс-линкером на активированной VLP, т.е. свободный цистеин или остаток цистеина со свободной сульфгидрильной группой должен быть доступен. В случае, когда остаток цистеина для функционирования в качесгве сайта связывания находится в окисленной форме, например, если это представляет собой образование дисульфидного мостика, то требуется восстановление этого дисульфидного мостика, например, с помощью DTT, ТСЕР или β-меркаптоэтанола. Низкие концентрации восстановителя совместимы с сочетанием, как описано в WO 02/05690, более высокие концентрации ингибируют реакцию сочетания, как известно специалисту, в этом случае восстановитель должен быть удален или его концентрация уменьшена перед сочетанием, например, посредством диализа, гель-фильтрации или ВЭЖХ с обращенными фазами.

Связывание антигенного пептида с VLP с использованием гетеробифункционального кросс-линкера в соответствии со способами, описанными выше, делает возможным сочетание антигенного пептида с VLP ориентированным образом. Другие способы связывания антигенного пептида с VLP включают способы, где антигенный пептид сшивают с VLP с использованием карбодиимида EDC и NHS.

При использовании других методов антигенный пептид присоединяют к VLP с использованием гомобифункционального кросс-линкера, такого как глутаральдегид, DSGBM [PEO] 4, BS3 (Pierce Chemical Company, Rockford, IL, USA) или других известных гомобифункциональных кросс-линкеров с функциональными группами, реактивными в отношении аминогрупп или карбоксильных групп VLP.

Другие способы связывания VLP с антигенным пептидом включают способы, где VLP биотинилирован, и антигенный пептид экспрессируется в виде стрептавидин-слитого бепка, или способы, где и антигенный пептид, и VLP биотинилированы, например, как описано в WO 00/23955. В этом случае антигенный пептид может быть сначала связан со стрептавидином или авидином путем корректировки соотношения антигенного пептида к стрептавидину гаким образом, чтобы свободные связывающие сайты были доступны для связывания VLP, которую добавляют на следующей стадии. Альтернативно, все компоненты можно смешивать в одностадийной реакции. Другие лиганд-рецепторные пары, где растворимые формы рецептора и лиганда доступны и способны к поперечному сшиванию с VLP или антигенным пептидом, могут быть использованы в качестве связывающих агентов для связывания антигенного пептида с VLP. Альтернативно, либо лиганд, либо рецептор может быть слит с антигенным пептидом и таким образом опосредовать связывание с VLP, химически связанным или слитым либо с рецептором, либо с лигандом, соответственно. Слияние также может осуществляться с помощью вставки или замещения.

Одну или несколько молекул антигена можно присоединять к одной субъединице капсида или VLP оболочечных белков РНК-фагов, предпочтительно через экспонированные остатки лизина VLP РНК-фагов, если это стерически возможно. Особый признак VLP оболочечного белка РНК-фагов и, в частности, VLP оболочечного белка QP представляет собой, таким образом, возможность связывать несколько антигенов на субъединицу. Это позволяет создать плотную антигенную матрицу.

VLPs или капсиды оболочечного белка Q экспонируют определенное число остатков лизина на своей поверхности, с определенной топологией: с тремя остатками лизина, направленными внутрь капсида и взаимодействующими с РНК, и четырьмя другими остатками лизина, обращенными наружу от капсида. Эти определенные свойства способствуют присоединению антигенов к наружной поверхности частицы, а не к внутренней поверхности частицы, где остатки лизина взаимодействуют с РНК. VLPs оболочечных белков другого РНК-фага также имеют определенное число остатков лизина на своей поверхности и определенную топологию этих остатков лизина.

В другом воплощении настоящего изобретения первый сайт присоединения представляет собой остаток лизина и/или второй сайт присоединения содержит сульфгидрильную группу или остаток цистеина. В еще одном воплощении настоящего изобретения первый сайт присоединения представляет собой остаток лизина и второй сайт присоединения представляет собой остаток цистеина. В других воплощениях изобретения антиген или антигенная детерминанта связаны посредством остатка цистеина с остатками лизина VLP оболочечного белка РНК-фага и, в частности, с VLP оболочечного белка Qbeta.

Другим преимуществом VLPs, происходящих из РНК-фагов, является их высокий выход экспрессии в бактериях, что делает возможной продукцию больших количеств материала по доступной цене. Кроме того, применение VLPs в качестве носителей делает возможным образование устойчивых антигенных матриц и конъюгатов, соответственно, с различной плотностью антигена. В частности, применение VLPs РНК-фагов и тем самым, в частности, применение VLP оболочечного белка РНК-фага Qbeta позволяет получить очень высокую плотность эпитопа.

Согласно воплощению настоящего изобретения антигенный пептид PCSK9, описанный в данной заявке, связан, предпочтительно химически сшит, с CRM197, либо непосредственно, либо через один из пептидных линкеров, описанных в данной заявке, с получением иммуногена. В одном из воплощений антигенный пептид PCSK9, описанный в данной заявке, связан с CRM197 путем химического сшивания, как описано в данной заявке, и предпочтительно с использыванием гетеробифункционального кросс-линкера, как описано выше.

Предпочтительные гетеробифункциональные кросс-линкеры для применения с CRM197 представляют собой BAANS (N-гидроксисукцинимидный сложный эфир бромуксусной кислоты), SMPH (сукцинимидил-6-[β-малеимидопропионамидо]гексаноат), Sulfo-MBS, Sulfo-EMCS, Sulfo-GMBS, Sulfo-SlAB, Sulfo-SMPB, Sulfo-SMCC, SVSB, SIA и другие кросс-линкеры, доступные, например, от Pierce Chemical Company (Rockford, IL, USA). В предпочтительном воплощении настоящего изобретения гетеробифункциональный кросс-линкер представляет собой BAANS или SMPH.

Альтернативно, подходящие кросс-линкеры, делающие возможным введение дисульфидной связи между антигенным пептидом и CRM197, также могут быть использованы в контексте данного изобретения. Предпочтительные кросс-линкеры, относящиеся к этому классу, включают, например, SPDP и Sulfo-LC-SPDP (Pierce).

В конкретном воплощении, когда последовательность антигенного пептида PCSK9, описанная в данной заявке, содержит цистеин, тогда указанный антигенный пептид PCSK9 может быть ковалентно связан с CRM197 непосредственно через указанный цистеин.

В некоторых воплощениях изобретения иммуногенные композиции по изобретению могут содержать смеси иммуногенных конъюгатов, т.е. иммуногенных носителей, связанных с одним или несколькими антигенными пептидами PCSK9 по изобретению. Таким образом, эти иммуногенные композиции могут состоять из иммуногенных носителей, которые различаются аминокислотной последовательностью. Например, могут быть получены вакцинные композиции, содержащие VLP "дикого типа" и модифицированный белок VLP, в котором один или более аминокислотных остатков были изменены (например, делегированы, вставлены или заменены). Альтернативно, может быть использован такой же иммуногенный носитель, но связанный с антигенными пептидами PCSK9 с различными аминокислотными последовательностями.

Поэтому изобретение также относится к способу получения иммуногена согласно изобретению, включающему: 1) обеспечение антигенного пептида PCSK9 согласно изобретению, 2) обеспечение иммуногенного носителя согласно изобретению, предпочтительно VLP, и 3) объединение указанного антигенного пептида PCSK9 и указанного иммуногенного носителя. В одном из воплощений указанная стадия объединения осуществляется посредством химического сшивания, предпочтительно через гетеробифункциональный кросс-линкер.

В одном из воплощений настоящего изобретения антигенный пептид PCSK9, описанный в данной заявке, связан с молекулой иммуногенного носителя. В одном из воплощений указанный иммуногенный носитель выбран из группы, состоящей из любого иммуногенного носителя, описанного в данной заявке. В другом воплощении указанный иммуногенный носитель выбран из группы, состоящей из: сывороточных альбуминов, таких как бычий сывороточный альбумин (БСА); глобулинов; тиреоглобулинов; гемоглобинов; гемоцианинов (в частности, гемоцианина лимфы улитки [KLH]) и вирусоподобных частиц (VLPs). В предпочтительном воплощении указанный иммуногенный носитель представляет собой дифтерийный анатоксин, CRM197 мутант дифтерийного токсина, столбнячный анатоксин, гемоцианин лимфы улитки или вирусоподобную частицу (VLPs). В еще одном предпочтительном воплощении указанный иммуногенный носитель представляет собой DT, CRM197 или VLP, выбранную из группы, состоящей из VLP HBcAg, VLP HBsAg, VLP Qbeta, VLP PP7, VLP PPV, VLP норовируса или любого варианта, описанного в данной заявке. В еще одном предпочтительном воплощении указанный иммуногенный носитель представляет собой VLP бактериофага, такую как VLP Qbeta, выбранную из группы, состоящей из СР Qbeta; A1 Qbeta, Qbeta-240, Qbeta-243, Qbeta-250, Qbeta-251 и Qbeta-259 (раскрыто в WO 03/024481) или PP7.

В другом предпочтительном воплощении указанный иммуногенный носитель представляет собой CRM197.

В одном из воплощений указанный иммуногенный носитель ковалентно связан с антигенным пептидом PCSK9, описанным в данной заявке, либо непосредственно, либо через линкер. В одном из воплощений указанный иммуногенный носитель связан с антигенным пептидом PCSK9, описанным в данной заявке, посредством экспрессии слитого белка, как описано в данной заявке. В другом воплощении антигенный пептид PCSK9, описанный в данной заявке, связан с иммуногенным носителем, предпочтительно VLP, путем химического сшивания, как описано в данной заявке, и предпочтительно с использованием гетеробифункционального кросс-линкера. Некоторые гетеробифункциональные кросс-линкеры известны в данной области техники. В некоторых воплощениях гетеробифункциональный кросс-линкер содержит функциональную группу, которая взаимодействует с первыми сайтами присоединения, т.е. с аминогруппой боковой цепи остатков лизина VLP или субъединицы VLP, и дополнительную функциональную группу, которая может взаимодействовать с предпочтительным вторым сайтом присоединения, т.е. остатком цистеина, слитым с антигенным пептидом, сделанным доступным для реакции посредством восстановления.

Антигенный пептид PCSK9 по изобретению, содержащий линкер

В одном из воплощений настоящего изобретения антигенный пептид PCSK9, описанный в данной заявке, дополнительно содержит либо на своем N-конце, либо на своем С-конце, либо на обоих N-конце и С-конце линкер, который способен взаимодействовать с сайтом присоединения иммуногенного носителя в реакции химического сшивания. В одном из воплощений антигенный пептид PCSK9, описанный в данной заявке, дополнительно содержит на своем С-конце линкер, имеющий формулу (G)nC, (G)nSC или (G)nK, предпочтительно (G)nC, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10, предпочтительно из группы, состоящей из 0, 1, 2, 3, 4 и 5, более предпочтительно из группы, состоящей из 0, 1, 2 и 3, наиболее предпочтительно n равно 0 или 1 (если n равно 0, то указанная формула представляет цистеин). Предпочтительно, антигенный пептид PCSK9, описанный в данной заявке, дополнительно содержит на своем С-конце линкер, имеющий формулу GGGC, GGC, GC или С.

В другом воплощении настоящего изобретения антигенный пептид PCSK9, описанный в данной заявке, дополнительно содержит на своем N-конце линкер, имеющий формулу C(G)n, CS(G)n или K(G)n, предпочтительно C(G)n, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10, предпочтительно из группы, состоящей из 0, 1, 2, 3, 4 и 5, более предпочтительно из группы, состоящей из 0, 1, 2 и 3, наиболее предпочтительно n равно 0 или 1 (если n равно 0, то формула представляет собой цистеин). Предпочтительно, антигенный пептид PCSK9, описанный в данной заявке, дополнительно содержит на своем N-конце линкер, имеющий формулу CGGG, CGG, CG или С.

В другом воплощении антигенный пептид PCSK9, описанный в данной заявке, дополнительно содержит на своем С-конце линкер, имеющий формулу (G)nC, (G)nSC или (G)nK, предпочтительно (G)nC, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10, предпочтительно из группы, состоящей из 0, 1, 2, 3, 4 и 5, более предпочтительно из групп, состоящих из 0, 1, 2 и 3, наиболее предпочтительно n равно 0 или 1 (если n равно 0, то указанная формула представляет цистеин), а на своем N-конце линкер, имеющий формулу C(G)n, CS(G)n или K(G)n, предпочтительно C(G)n, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10, предпочтительно из группы, состоящей из 0, 1, 2, 3, 4 и 5, более предпочтительно из групп, состоящих из 0, 1, 2 и 3, наиболее предпочтительно n равно 0 или 1 (если n равно 0, то формула представляет цистеин). Предпочтительно, антигенный пептид PCSK9, описанный в данной заявке, дополнительно содержит на своем N-конце линкер, имеющий формулу CGGG, CGG, CG или С, а на своем С-конце линкер, имеющий формулу GGGC, GGC, GC или С. Предпочтительно, антигенный пептид PCSK9, описанный в данной заявке, дополнительно содержит на своем N-конце цистеин, а на своем С-конце цистеин.

Типичные представители указанных антигенных пептидов PCSK9, дополнительно содержащих такой линкер, раскрыты в SEQ ID NO:313, 314, 315, 316, 317, 322, 323, 324, 325, 326, 327, 328, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418 и 419.

Типичные представители указанных антигенных пептидов PCSK9, дополнительно содержащих такой линкер, раскрыты в SEQ ID NO:313, 314, 315, 316, 317, 322, 323, 324, 325, 326, 327 и 328.

Предпочтительные антигенные пептиды PCSK9, содержащие линкер, раскрыты в SEQ ID NO:317, 322, 323, 324, 401, 402, 403, 413, 414, 415 и 416.

Предпочтительные антигенные пептиды PCSK9, содержащие линкер, раскрыты в SEQ ID NO:317, 322, 323 и 324.

Наиболее предпочтительные антигенные пептиды PCSK9, содержащие линкер, раскрыты в SEQ ID NO:317, 322, 402 и 413.

В одном из воплощений антигенный пептид PCSK9 является циклизованным. В одном из воплощений циклизованный антигенный пептид PCSK9 присоединен к иммуногенному носителю. В одном из воплощений указанный циклизованный антигенный пептид PCSK9 присоединен к иммуногенному носителю посредством ковалентного связывания. В одном из воплощений указанный циклизованный антигенный пептид PCSK9 присоединен к иммуногенному носителю посредством ковалентного связывания одной из боковых цепей его аминокислот с носителем. В одном из воплощений цистеин, GC- или СС-фрагмент, содержащий различное число остатков глицина и один остаток цистеина, добавляют к циклизованным пептидам PCSK9 для обеспечения ковалентного связывания с иммуногенным носителем через добавленный цистеин.

В одном из воплощений антигенный пептид PCSK9 является циклизованным и содержит цистеин, (G)nC- или С(G)n-фрагмент, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10, предпочтительно из группы, состоящей из 0, 1, 2, 3, 4 и 5, более предпочтительно из группы, состоящей из 0, 1, 2 и 3, наиболее предпочтительно n равно 0 или 1 (если n равно 0, то формула представляет цистеин).

Неограничивающие примеры таких конформационно ограниченных антигенных пептидов PCSK9 представляют собой пептиды с SEQ ID NO:318, 319, 320 и 321. Предпочтительный циклизованный пептид представляет собой пептид с SEQ ID NO:318.

Примеры конъюгирований антигенных пептидов PCSK9 с носителем или каркасами, описанными выше, все находятся в пределах объема настоящего изобретения и составляют различные воплощения с использованием различных линкеров, которые приведены ниже:

Пептид - GGGGGC - каркас, пептид - GGGGC - каркас, пептид - GGGC - каркас, пептид - GGC - каркас, пептид - GC - каркас, пептид - С - каркас, пептид - GGGGGK - каркас, пептид - GGGGK - каркас, Пептид - GGGK - каркас, Пептид - GGK - каркас, Пептид - GK - каркас, Пептид - K - каркас, Пептид - GGGGSC - каркас, Пептид - GGGSC - каркас, Пептид - GGSC - каркас, Пептид - GSC - каркас, Пептид - SC - каркас, Каркас - CSGGGG - Пептид, Каркас - CSGGG - Пептид, Каркас - CSGG - Пептид, Каркас - CSG - Пептид, Каркас - CS - Пептид, Каркас - KGGGG - Пептид, Каркас - KGGG - Пептид, Каркас - KGG - Пептид, Каркас - KG - Пептид, Каркас - К - Пептид.

В одном из воплощений пептид состоит из любого из антигенных пептидов PCSK9, описанных в данной заявке, и каркас состоит из любого из иммуногенных носителей, описанных в данной заявке, предпочтительно VLP.

Типичные комбинации конъюгирований с использованием различных линкеров и вдвойне ограниченных пептидов представлены ниже, где носитель может представлять собой идентичный мономер носителя или разный мономер носителя. (В примере ниже GC-линкер может быть замещен любым GK-линкером или GSC-линкером, представленным выше или любым другим, известным специалистам в данной области техники):

Носитель - CGGGGG - Пептид - GGGGGC - носитель, Носитель -CGGGG - Пептид - GGGGC - носитель, Носитель - CGGGG - Пептид -GGGGC - носитель, Носитель - CGGG - Пептид - GGGC - носитель, Носитель - CG - Пептид - GC - носитель, Носитель - CG - Пептид - С - носитель, Носитель - С - Пептид - С - носитель.

В одном из воплощений пептид состоит из любого антигенного пептида PCSK9, описанного в данной заявке, и носитель состоит из любого иммуногенного носителя, описанного в данной заявке, предпочтительно VLP.

В одном из воплощений изобретение относится к иммуногену, содержащему антигенный пептид PCSK9, состоящий из или состоящий по существу из аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO:1-312, 330-398 и 420-588, где указанный антигенный пептид PCSK9 дополнительно содержит на своем С-конце или на своем N-конце цистеин, который химически перекрестно сшит с иммуногенным носителем посредством тиоэфирной связи. В предпочтительном воплощении указанный иммуногенный носитель выбран из группы, состоящей из DT (дифтерийный токсин), ТТ (столбнячный анатоксин) или фрагмента С из ТТ, PD (белок D Haemophilus influenzae), CRM197, других точечных мутантов DT, таких как CRM176, CRM228, CRM45, CRM9, CRM102, CRM103 и CRM107. Предпочтительно, указанный иммуногенный носитель представляет собой CRM197.

В одном из воплощений изобретение относится к иммуногену, содержащему антигенный пептид PCSK9, состоящий из или состоящий по существу из аминокислотной последовательности, выбранной из группы, состоящей из 1-312, 330-398 и 420-588, где указанный антигенный пептид PCSK9 дополнительно содержит на своем С-конце или на своем N-конце цистеин, который химически сшит с иммуногенным носителем посредством тиоэфирной связи с использованием SMPH (сукцинимидил-6-[β-малеимидопропионамидо]гексаноат) или BAANS (N-гидроксисукцинимидный сложный эфир бромуксусной кислоты) в качестве кросс-линкера. В предпочтительном воплощении указанный иммуногенный носитель выбран из группы, состоящей из DT (дифтерийный токсин), ТТ (столбнячный анатоксин) или фрагмента С из ТТ, PD (белок D Haemophilus influenzae), CRM197, других точечных мутантов DT, таких как CRM176, CRM228, CRM 45, CRM 9, CRM102, CRM103 и CRM107. Предпочтительно, указанный иммуногенный носитель представляет собой CRM 197.

В одном из воплощений изобретение относится к иммуногену, содержащему антигенный пептид PCSK9, состоящий из или состоящий по существу из аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO:1-312, 330-398 и 420-588, где указанный антигенный пептид PCSK9 дополнительно содержит на своем С-конце цистеин, который химически сшит с иммуногенным носителем посредством тиоэфирной связи с использованием SMPH (сукцинимидил-6-[β-малеимидопропионамидо]гексаноат) или BAANS (N-гидроксисукцинимидный сложный эфир бромуксусной кислоты) в качестве кросс-линкера, где указанная связь находится между остатком лизина CRM 197 и остатком цистеина указанного антигенного пептида.

Композиции, содержащие антигенный пептид PCSK9 по изобретению

Настоящее изобретение также относится к композициям, в частности к иммуногенным композициям, также называемым "рассматриваемыми иммуногенными композициями", содержащим антигенный пептид PCSK9 по изобретению, предпочтительно связанный с иммуногенным носителем, и возможно по меньшей мере один адъювант. Такие иммуногенные композиции в частности, когда приготовлены в виде фармацевтических композиций, считаются полезными для предупреждения, лечения или облегчения PCSK9-связанных расстройств.

В некоторых воплощениях рассматриваемая иммуногенная композиция согласно изобретению содержит антигенный пептид PCSK9, возможно содержащий линкер, содержащий аминокислотную последовательность, выбранную из SEQ ID NO:1-328, 330-398 и 401-588 и их функционально активных вариантов. В некоторых воплощениях указанный антигенный пептид PCSK9 связан с иммуногенным носителем, предпочтительно с DT, CRM 197 или VLP, более предпочтительно с VLP HBcAg, HBsAg, Qbeta, PP7, PPV или норовируса.

В предпочтительном воплощении рассматриваемая иммуногенная композиция согласно изобретению содержит антигенный пептид PCSK9, возможно содержащий линкер, содержащий аминокислотную последовательность, выбранную из SEQ ID NO:1-328, 330-398 и 401-588 и их функционально активных вариантов, связанных с VLP, предпочтительно с VLP Qbeta.

В предпочтительном воплощении рассматриваемая иммуногенная композиция согласно изобретению содержит антигенный пептид PCSK9, возможно содержащий линкер, содержащий аминокислотную последовательность, выбранную из SEQ ID NO:1-328, 330-398 и 401-588 и их функционально активных вариантов, связанных с CRM197.

Рассматриваемая иммуногенная композиция, содержащая антигенный пептид PCSK9 согласно изобретению, может быть приготовлена в виде препарата различными способами, как описано более подробно ниже.

В некоторых воплощениях рассматриваемая иммуногенная композиция содержит один вид антигенного пептида PCSK9, например, иммуногенная композиция содержит популяцию антигенных пептидов PCSK9, по существу все из которых имеют одну ту же аминокислотную последовательность. В других воплощениях рассматриваемая иммуногенная композиция содержит два или более различных антигенных пептидоз PCSK9, например, иммуногенная композиция содержит популяцию антигенных пептидов PCSK9, где члены этой популяции могут различаться по аминокислотной последовательности. Рассматриваемая иммуногенная композиция может содержать от двух до примерно 20 различных антигенных пептидов PCSK9, например, рассматриваемая иммуногенная композиция может содержать 2, 3, 4, 5, 6, 7, 8, 9, 10, 11-15 или 15-20 различных антигенных пептидов PCSK9, каждый из которых имеет аминокислотную последовательность, которая отличается от аминокислотных последовательностей других антигенных пептидов PCSK9.

В других воплощениях рассматриваемая иммуногенная композиция содержит мультимеризованный антигенный полипептид PCSK9, как описано выше. Используемые в данной заявке термины "иммуногенная композиция, содержащая антигенный пептид PCSK9" или "иммуногенная композиция по изобретению" или "рассматриваемая иммуногенная композиция" относятся к иммуногенной композиции, содержащей либо один вид (мультимеризованный или нет), либо несколько видов антигенного(ых) пептида(ов) PCSK9, связанных или не связанных с иммуногенным носителем. Если два или более пептидов используют связанными с носителем, то пептид может быть связан с одной и той же молекулой-носителем или индивидуально связан с молекулами-носителями и затем объединен с получением иммуногенной композиции.

Другой аспект изобретения относится к способам получения иммуногена согласно изобретению включающему сочетание антигенного пептида PCSK9 с иммуногенным носителем. В одном из воплощений указанное сочетание является химическим.

Адъюванты

В некоторых воплощениях рассматриваемая иммуногенная композиция содержит по меньшей мере один адъювант. Подходящие адъюванты включают адъюванты, подходящие для применения у млекопитающих, предпочтительно у людей. Примеры известных подходящих адъювантов, которые могут быть использованы у людей, включают, но не обязательно ограничиваются этим, квасцы, фосфат алюминия, гидрат окиси алюминия, MF59 (4,3% масс./об. сквалена, 0,5% масс./об. полисорбата 80 (Tween 80), 0,5% масс./об. сорбитантриолеата (Span 85)), CpG-содержащую нуклеиновую кислоту (где цитозин неметилирован), QS21 (сапониновый адъювант), MPL (монофосфориллипид A), 3DMPL (3-0-деацилированный MPL), экстракты из Aquilla, ISCOMS (см., например, Sjölander et al. (1998) J. Leukocyte Biol. 64:713; WO 90/03184, WO 96/11711, WO 00/48630, WO 98/36772, WO 00/41720, WO 06/134423 и WO 07/026190), мутанты LT/CT, поли(D,L-лактид-со-гликолидные) (PLG) микрочастицы, Quil A, TiterMax classic, TiterMax Gold, интерлейкины и т.п. Для применений в ветеринарии, включающих, но не ограничивающихся экспериментами на животных, можно использовать адъювант Фрейнда, N-ацетил-мурамил-L-треонил-D-изоглутамин (thr-MDP), N-ацетил-нормурамил-L-аланил-D-изоглутамин (CGP 11637, известный как нор-MDP), N-ацетилмурамил-L-аланил-D-изоглутаминил-L-аланин-2-(1'-2'-дипальмитоил-sn-глицеро-3-гидроксифосфорилокси)-этиламин (CGP 19835А, известный как МТР-РЕ) и RIBI, который содержит три компонента, экстрагированных из бактерий, монофосфориллипид А, трегалозы димиколат и каркас клеточных стенок (MPL+TDM+CWS) в эмульсии 2% сквален/Tween 80.

Другие типичные адъюванты для увеличения эффективности композиции включают, но не ограничиваются; (1) препараты эмульсии масло в воде (вместе или без других специфических иммуностимулирующих агентов, таких как мурамилпептиды (см. ниже) или компоненты бактериальной клеточной стенки), такие как, например, (a) MF59™ (WO 90/14837; Глава 10 в Vaccine design: the subunit and adjuvant approach, eds. Powell & Newman, Plenum Press 1995), содержащий 5% сквалена, 0,5% Tween 80 (полиоксиэтиленсорбитан моноолеат) и 0,5% Span 85 (сорбитан триолеат) (возможно содержащий мурамилтрипептид, ковалентно связанный с дипальмитоил-фосфатидилэтаноламином (МТР-РЕ)), приготовленным в виде субмикронных частиц с использованием микрофлюидизатора, (б) SAF, содержащий 10% сквалена, 0,4% Tween 80, 5% плуроник-блокированного полимера 1.121 и thr-MDP, либо обработанный микрофлюидизатором в субмикронную эмульсию, либо обработанный на вортексе с получением эмульсии с частицами большего размера и (в) адъювантная система RIBS™ (RAS), (Ribi Immunochem, Hamilton, MT) содержащая 2% сквалена, 0,2% Tween 80 и один или более компонентов бактериальной клеточной стенки, таких как монофосфориллипид A (MPL), трегалозы димиколат (TDM) и каркас клеточной стенки (CWS), предпочтительно MPL+CWS (DETOX™); (2) могут быть использованы сапониновые адъюванты, такие как QS21, STIMULON™ (Cambridge Bioscience, Worcester, MA), Abisco® (Isconova, Sweden) или Iscornatrix® (Commonwealth Serum Laboratories, Australia) или частицы, образованные из них, такие как ISCOMs (иммуностимулирующие комплексы), где ISCOMS может быть лишен дополнительного детергента, например, WO 00/07621; (3) полный адъювант Фрейнда (CFA) и неполной адъювант Фрейнда (IFA); (4) цитокины, такие как интерлейкины (например, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 (WO 99/44636) и т.д.), интерфероны (например, гамма-интерферон), макрофагальный колониестимулирующий фактор (M-CSF), фактор некроза опухолей (TNF) и т.д.; (5) монофосфориллипид А (MPL) или 3-D-деацилированный MPL (3dMPL), например, GB-2220221, ЕР-А-0689454, возможно при фактическом отсутствии квасцов при использовании с пневмококковыми сахаридами, например, WO 00/56358; (6) комбинации 3dMPL, например, с QS21 и/или эмульсиями масло в воде, например, ЕР-А-0835318, ЕР-А-0735898, ЕР-А-0761231; (7) олигонуклеотиды, содержащие CpG-мотивы [Krieg Vaccine 2000, 19, 618-622; Krieg Curropin Mol Ther2001 3:15-24; Roman et al., Nat. Med., 1997, 3, 849-854; Weiner et al., PNAS USA, 1997, 94, 10833-10837; Davis et al., J. Immunol, 1998, 160, 870-876, Chu et al., J. Exp. Med, 1997, 186, 1623-1631; Lipford et al., Ear. J. Immunol., 1997, 27, 2340-2344; Moldoveami et al., Vaccine, 1988, 16, 1216-1224, Krieg et al., Nature, 1995, 374, 546-549; Klinman et al., PNAS USA, 1996, 93, 2879-2883; Ballas et al., J. Immunol, 1996, 157, 1840-1845; Cowdery et al., J. Immunol, 1996, 156, 4570-4575; Halpern et al. Cell Immunol, 1996. 167, 72-78; Yamamoto et al., Jpn. J. Cancer Res., 1988, 79, 866-873; Stacey et al., J. Immunol, 1996, 157,2116-2122; Messina et al., J. Immunol, 1991. 147, 1759-1764; Yi et al., J. Immunol, 1996, 157,4918-4925; Yi et al., J. Immunol, 1996, 157, 5394-5402; Yi et al., J. Immunol, 1998, 160, 4755-4761; и Yi et al., J. Immunol, 1998, 160, 5898-5906; Международные патентные заявки WO 96/02555, WO 98/16247, WO 98/18810, WO 98/40100, WO 98/55495, WO 98/37919 и WO 98/52581], т.е. содержащие по меньшей мере один динуклеотид CG, где цитозин неметилирован: (8) простой полиоксиэтиленовый эфир или сложный полиоксиэтиленовый эфир, например, WO 99/52549; (9) полиоксиэтиленсорбитановое сложноэфирное поверхностно-активное вещество) в комбинации с октоксинолом (WO 01/21207) или полиоксиэтиленалкил-эфирное или сложнофирное поверхностно-активное вещество в комбинации по меньшей мере с одним дополнительным неионным поверхностно-активным веществом, таким как октоксинол (WO 01/21152); (10) сапонин и иммуностимулирующий олигонуклеотид (например, CpG-олигонуклеотид) (WO 00/62800); (11) иммуностимулятор и частица соли металла, например, WO 00/23105; (12) сапонин и эмульсия масло в воде, например, WO 99/11241; (13) сапонин (например, QS21)+3dMPL+IM2 (возможно +стерол), например, WO 98/57659; (14) другие вещества, которые действуют в качестве иммуностимулирующих агентов для увеличения эффективности композиции, такие как мурамилпептиды, включающие N-ацетил-мурамил-L-треонил-D-изоглутамин (thr-MDP), N-ацетил-нормурамил-L-аланил-D-изоглутамин (нор-MDP), N-ацетилмурамил-L-аланил-D-изоглутаминил-L-аланин-2-(1'-2'-дипальмитоил-sn-глицеро-3-гидроксифосфорилокси)-этиламин МТР-РЕ), (15) лиганды для toll-подобных рецепторов (TLR), природные или синтезированные (например, как описано в Kanzler et al 2007, Nature Medicine 13, p.1552-9), включая TLR3 лиганды, такие как поли-I:С и сходные соединения, такие как Hiltonol и Ampligen.

В конкретном воплощении указанный адъювант представляет собой иммуностимулирующий олигонуклеотид и более предпочтительно CpG-олигонуклеотид. CpG-олигонуклеотид, как использовано в данной заявке, относится к иммуностимулирующему CpG-олигодезоксинуклеотиду (CpG ODN), и соответственно эти термины используются взаимозаменяемо, если не указано иное. Иммуностимулирующие CpG-олигодезоксинуклеотиды содержат один или более иммуностимулирующих CpG-мотивов, которые представляют собой неметилированные цитозин-гуаниновые динуклеотиды, возможно в определенных предпочтительных контекстах оснований. Статус метилирования иммуностимулирующего CpG-мотива, как правило, относится к остатку цитозина в динуклеотиде. Иммуностимулирующий олигонуклеотид, содержащий по меньшей мере один неметилированный CpG-динуклеотид, представляет собой олигонуклеотид, который содержит 5'-неметилированный цитозин, связанный фосфатной связью с 3'-гуанином, и который активирует иммунную систему посредством связывания с Toll-подобным рецептором 9 (TLR-9). В другом воплощении Иммуностимулирующий олигонуклеотид может содержать один или более метилированных CpG-динуклеотидов, которые активируют иммунную систему через TLR9, но не так сильно, как если бы CpG-мотив(ы) был(и) неметилированным(и), Иммуностимулирующие CpG-олигонуклеотиды могут содержать один или более палиндромов, которые, в свою очередь, могут охватывать CpG-динуклеотид. CpG-олигонуклеотиды были описаны во многих выданных патентах, опубликованных патентных заявках и других публикациях, включая патенты США №№6194388; 6207646; 6214806; 6218371; 6239116; и 6339068.

Были идентифицированы различные классы иммуностимулирующих CpG-олигонуклеотидов. Они упоминаются как А, В, С и Р класс и описаны более подробно ниже. Способы по изобретению охватывают применение этих различных классов иммуностимулирующих CpG-олигонуклеотидов.

Любой из классов может быть подвергнут Е модификации, которая увеличивает его эффективность. Е модификация может представлять собой замещение 5'-концевого нуклеотида галогеном; примеры таких замещений включают, но не ограничиваются этим, замещения бром-уридином или йод-уридином. Е модификация также может включать замещение этил-уридином для 5'-концевого нуклеотида.

Иммуностимулирующие CpG-олигонуклеотиды "А класса" функционально характеризуются способностью индуцировать высокие уровни интерферона-альфа (IFN-α) плазмоцитоидными дендритными клетками (pDC) и индукцией активации MK-клеток, в то же время оказывая минимальные эффекты на активацию В-клеток. Структурно этот класс обычно имеет стабилизированные поли-G последовательности на 5'- и 3'-концах. Он также имеет палиндромную фосфодиэфирную CpG-динуклеотид-содержащую последовательность из по меньшей мере 6 нуклеотидов, например, но не обязательно, он содержит один из следующих гексамерных палиндромов: GACGTC, AGCGCT или AACGTT, описанных Yamamoto с соавт.Yamamoto S et al. J. Immunol 148:4072-6 (1992). Иммуностимулирующие CpG-олигонуклеотиды А класса и типичные последовательности этого класса были описаны в патентной заявке США, серийный №09/672126 и опубликованной заявке РСТ PCT/US00/26527 (WO 01/22990), которые обе поданы 27 сентября 2000 г.

В одном из воплощений CpG-олигонуклеотид "А класса" по изобретению имеет следующую последовательность нуклеиновой кислоты' 5' GGGGACGACGTCGTGGGGGGG 3'

Некоторые неограничивающие примеры олигонуклеотидов А-класса включают:

5' G*G*G_G_A_C_G_A_C_G_T_C_G_T_G_G*G*G*G*G*G 3';

где * относится к фосфоротиоатной связи, и _ относится к фосфодиэфирной связи.

Последовательности CpG-олигонуклеотида В класса по изобретению подробно описаны выше, а также раскрыты в опубликованных патентных заявках РСТ PCT/US 95/01570 и PCT/US97/19791 и в патентах US 6,194,388, 6,207,646, 6,214,806, 6,218,371, 6,239,116 и 6,339,068. Типичные последовательности включают, но не ограничиваются этим, последовательности, описанные в этих последних заявках и патентах.

В одном из воплощений CpG-олигонуклеотид "В класса" по изобретению имеет следующую последовательность нуклеиновой кислоты:

5' TCGTCGTTTTTCGGTGCTTTT 3' (SEQ ID NO:589), или

5' TCGTCGTTTTTCGGTCGTTTT 3' (SEQ ID NO:590), или

5' TCGTCGTTTTGTCGTTTTGTCGTT 3' (SEQ ID NO:591), или

5' TCGTCGTTTCGTCGTTTTGTCGTT 3' (SEQ ID NO:592), или

5' TCGTCGTTTTGTCGTTTTTTTCGA 3' (SEQ ID NO:593).

В любой из этих последовательностей все связи могут представлять собой фосфоротиоатные связи. В другом воплощении в любой из этих последовательностей одна или более связей могут быть фосфодиэфирными, предпочтительно между "С" и "G" CpG-мотива с получением полугибкого CpG-олигонуклеотида. В любой из этих последовательностей, 5' Т может быть замещен этил-уридином или галогеном; примеры замещений галогеном включают, но не ограничиваются этим, замещения бром-уридином или йод-уридином.

Некоторые неограничивающие примеры олигонуклеотидов В-класса

включают;

5' T*C*G*T*C*G*T*T*T*T*T*C*G*G*T*G*C*T*T*T*T 3', или

5' T*C*G*T*C*G*T*T*T*T*T*C*G*G*T*C*G*T*T*T*T 3', или

5' T*C*G*T*C*G*T*T*T*T*G*T*C*G*T*T*T*T*G*T*C*G*T*T 3', или

5' T*C*G*T*C*G*T*T*T*C*G*T*C*G*T*T*T*T*G*T*C*G*T*T 3', или

5' T*C*G*T*C*G*T*T*T*T*G*T*C*G*T*T*T*T*T*T*T*C*G*A 3',

где * относится к фосфоротиоатной связи.

Иммуностимулирующие CpG-олигонуклеотиды "С класса" функционально характеризуются способностью активировать В-клетки и NK-клетки и индуцировать IFN-α. Структурно этот класс обычно включает участок с одним или более иммуностимулирующими CpG-мотивами В класса, и GC-богатый палиндром или околопалиндромный участок, который позволяет молекулам образовывать вторичную (например, стебель-петля) или третичную (например, димерную) структуры. Некоторые из этих олигонуклеотидов имеют как традиционную "стимулирующую" CpG последовательность, так и "GC-богатый" или "нейтрализующий В-клетки" мотив. Олигонуклеотиды с этими комбинированными мотивами оказывают Иммуностимулирующие эффекты, которые находятся где-то между эффектами, ассоциированными с традиционными CpG-олигонуклеотидами В класса (т.е. сильная индукция активации В-клеток и активации дендритных клеток (DC)), и эффектами, ассоциированными с CpG ODN А класса (т.е. сильная индукция активации IFN-α и NK-клеток, но относительно слабая индукция активации В-клеток и DC). Krieg AM et а1. (1995) Nature 374:546-9; Ballas ZK et al. (1996) J Immunol 157:1840-5; Yamamoto S et al. (1992) J Immunol 148:4072-6.

Иммуностимулирующие Олигонуклеотиды С класса с комбинированным мотивом могут иметь либо полностью стабилизированные (например, все фосфоротиоатные), химерные (фосфодиэфирная центральная область), либо полугибкие (например, фосфодиэфирная связь внутри CpG-мотива) скелеты. Этот класс был описан в патентной заявке US 10/224,523, поданной 19 августа 2002 года.

Один стимулирующий домен или мотив CpG-олигонуклеотида С класса определен формулой: 5' X1DCGHX2 3'. D представляет собой нуклеотид, отличный от С.С представляет собой иитозин. G представляет собой гуанин. Н представляет собой нуклеотид, отличный от G. X1 и Х2 представляют собой любую последовательность нуклеиновой кислоты длиной от 0 до 10 нуклеотидов. X1 может включать CG, в этом случае предпочтительно Т непосредственно предшествует этому CG. В некоторых воплощениях DCG представляет собой TCG. X1 имеет длину предпочтительно от 0 до 6 нуклеотидов. В некоторых воплощениях Х2 не содержит никаких поли-G или поли-А мотивов. В других воплощениях иммуностимулирующий олигонуклеотид имеет поли-Т последовательность на 5'-конце или на 3'-конце. Как использовано в данной заявке, "поли-А" или "поли-Т" относится к отрезку из четырех или более последовательных А или Т, соответственно, например, 5' АААА 3' или 5' ТТТТ 3'. Как использовано в данной заявке, "поли-G конец" относится к отрезку из четырех или более последовательных G, например, 5' GGGG 3', находящихся на 5'-конце или 3'-конце нуклеиновой кислоты. Как использовано в данной заявке, "поли-G олигонуклеотид" относится к олигонуклеотиду, имеющему формулу 5' X1X2GGGX3X4 3', где X1, Х2, Х3 и Х4 представляют собой нуклеотиды, и предпочтительно по меньшей мере один из Х3 и Х4 представляет собой G. Некоторые предпочтительные конструкции для домена, стимулирующего В-клетки, согласно этой формуле содержат TTTTTCG, TCG, TTCG, TTTCG, TTTTCG, TCGT, TTCGT, TTTCGT, TCGTCGT.

Второй мотив CpG-олигонуклеотида С класса называется либо как Р, либо как N и располагается непосредственно с 5' относительно X1 или непосредственно с 3' относительно Х2.

N представляет собой последовательность, нейтрализующую В-клетки, которая начинается с тринуклеотида CGG и имеет длину по меньшей мере 10 нуклеотидов. Мотив, нейтрализующий В-клетки, включает по меньшей мере одну CpG последовательность, в которой CG предваряется С или за которым следует G (Krieg AM et al. (1998) Proc Natl Acad Sd USA 95:12631-12636) или представляет собой CG-содержащую последовательность ДНК, в которой С из CG метилирован. Нейтрализующие мотивы или последовательности обладают некоторой степенью иммуностимулирующей способности, когда присутствуют в другом нестимулирующем мотиве, но когда присутствуют в контексте других иммуностимулирующих мотивов, то служат для уменьшения иммуностимулирующего потенциала этих других мотивов.

Р представляет собой GC-богатый палиндром, содержащий последовательность длиной по меньшей мере 10 нуклеотидов.

Как использовано в данной заявке, "палиндром" и эквивалентно "палиндромная последовательность" относятся к инвертированному повтору, т.е. последовательности, такой как ABCDEE'D'C'B'A', в которой А и А', В и В' и т.д., представляют собой основания, способные образовывать обычные пары оснований Уотсона и Крика.

Как использовано в данной заявке, "GC-богатый палиндром" относится к палиндрому, имеющему состав оснований из по меньшей мере двух третей G и С. В некоторых воплощениях GC-богатый домен находится предпочтительно с 3' относительно "домена, стимулирующего В-клетки". Таким образом, в случае GC-богатого палиндрома длиной 10 оснований указанный палиндром содержит по меньшей мере 8 G и С. В случае GC-богатого палиндрома длиной 12 оснований палиндром также содержит по меньшей мере 8 G и С. В случае 14-мерного GC-богатого палиндрома по меньшей мере десять оснований палиндрома представляют собой G и С. В некоторых воплощениях GC-богатый палиндром состоит исключительно из G и С.

В некоторых воплощениях GC-богатый палиндром имеет композицию оснований по меньшей мере из 81% G и С.Таким образом, в случае такого GC-богатого палиндрома длиной 10 оснований указанный палиндром состоит исключительно из G и С. В случае такого GC-богатого палиндрома длиной 12 оснований предпочтительно, чтобы по меньшей мере десять оснований (83%) палиндрома представляли собой G и С. В некоторых предпочтительных воплощениях GC-богатый палиндром длиной 12 оснований состоит исключительно из G и С. В случае 14-мерного GC-богатого палиндрома по меньшей мере двенадцать оснований (86%) палиндрома представляют собой G и С. В некоторых предпочтительных воплощениях GC-богатый палиндром длиной 14 оснований состоит исключительно из G и С.С из GC-богатого палиндрома могут быть неметилированными или могут быть метилированными.

В общем, этот домен имеет по меньшей мере 3 С и G, более предпочтительно 4 каждого и наиболее предпочтительно 5 или более каждого. Число С и G в этом домене не обязательно должно быть идентичным. Предпочтительно, чтобы С и G были расположены таким образом, чтобы они моглм образовывать самокомплементарный дуплекс, или палиндром, такой как CCGCGCGG. Он может прерываться А или Т, но предпочтительно, чтобы самокомплементарность была по меньшей мере частично сохранена, как, например, в мотивах CGACGTTCGTCG или CGGCGCCGTGCCG. Когда комплементарность не сохраняется, предпочтительно, чтобы некомплементарные пары оснований представляли собой TG. В предпочтительном воплощении имеется не более 3 последовательных оснований, которые не являются частью палиндрома, предпочтительно не более 2 и наиболее предпочтительно только 1. В некоторых воплощениях GC-богатый палиндром включает по меньшей мере один тример CGG, по меньшей мере один тример CCG или по меньшей мере один тетрамер CGCG. В других воплощениях GC-богатый палиндром не является CCCCCCGGGGGG или GGGGGGCCCCCC, CCCCCGGGGG или GGGGGCCCCC.

По меньшей мере один из G в GC-богатом участке может быть замещен инозином (I). В некоторых воплощениях Р включает более чем один I.

В некоторых воплощениях иммуностимулирующий олигонуклеотид имеет одну из следующих формул: 5' NX1DCGHX2 3', 5' XiDCGHX2N 3', 5' PX1DCGHX2 3', 5' X1DCGHX2P 3', 5' X1DCGHX2PX3 3', 5' X1DCGHPX3 3', 5' DCGHX2PX3 3', 5' TCGHX2PX3 3', 5' DCGHPX3 3' или 5'DCGHP 3'.

В изобретении предложены другие иммуностимулирующие олигонуклеотиды, определенные формулой 5' N1PyGN2P 3'. N1 представляет собой любую последовательность длиной от 1 до 6 нуклеотидов. Ру представляет собой пиримидин. G представляет собой гуанин. N2 представляет собой любую последовательность длиной от 0 до 30 нуклеотидов. Р представляет собой GC-богатый палиндром, содержащий последовательность длиной по меньшей мере в 10 нуклеотидов.

N1 и N2 может содержать более 50% пиримидинов и более предпочтительно более 50% Т. N1 может включать CG, в этом случае предпочтительно Т непосредственно предшествует данному CG В некоторых воплощениях N1PyG представляет собой TCG и наиболее предпочтительно TCGN2, где N2 не является G.

N1PyGN2P может включать один или более нуклеотидов инозина (I). С или G в Ni может быть замещен инозином, но Cpl является предпочтительным по сравнению с IpG. Для замещений инозином, таких как IpG, оптимальной активности можно достичь с использованием "полугибкого" или химерного скелета, где связь между IG или CI является фосфодиэфирной. N1 может включать по меньшей мере один CI-, TCI-, IG- или TIG-мотив.

В некоторых воплощениях N1PyGN2 представляет собой последовательность, выбранную из группы, состоящей из TTTTTCG, TCG, TTCG, TTTCG, TTTTCG, TCGT, TTCGT, TTTCGT и TCGTCGT.

В одном из воплощений CpG-олигонуклеотид "С класса" по изобретению имеет следующие последовательности нуклеиновой кислоты:

5' TCGCGTCGTTCGGCGCGCGCCG 3' (SEQ ID NO:594), или

5' TCGTCGACGTTCGGCGCGCGCCG 3' (SEQ ID NO:595), или

5' TCGGACGTTCGGCGCGCGCCG 3' (SEQ ID NO:596), или

5' TCGGACGTTCGGCGCGCCG 3' (SEQ ID NO:597), или

5' TCGCGTCGTTCGGCGCGCCG 3' (SEQ ID NO:598), или

5' TCGACGTTCGGCGCGCGCCG 3' (SEQ ID NO:599), или

5' TCGACGTTCGGCGCGCCG 3' (SEQ ID NO:600), или

5' TCGCGTCGTTCGGCGCCG 3' (SEQ ID NO:601), или

5' TCGCGACGTTCGGCGCGCGCCG 3' (SEQ ID NO:602), или

5' TCGTCGTTTTCGGCGCGCGCCG 3' (SEQ ID NO:603), или

5' TCGTCGTTTTCGGCGGCCGCCG 3' (SEQ ID NO:604), или

5' TCGTCGTTTTACGGCGCCGTGCCG 3' (SEQ ID NO:605), или

5' TCGTCGTTTTCGGCGCGCGCCGT 3' (SEQ ID NO:606).

В любой из этих последовательностей все связи могут представлять собой фосфоротиоатные связи. В другом воплощении в любой из этих последовательностей одна или более связей могут быть фосфодиэфирными, предпочтительно между "С" и "G" CpG-мотива с получением полугибкого CpG-олигонуклеотида.

Некоторые неограничивающие примеры олигонуклеотидов С-класса включают:

5' T*C_G*C_G*T*C_G*T*T*C_G*G*C*G*C_G*C*G*C*C*G 3', или

5' T*C_G*T*C_G*A*C_G*T*T*C_G*G*C*G*C_G*C*G*C*C*G 3', или

5' T*C_G*G*A*C_G*T*T*C_G*G*C*G*C_G*C*G*C*C*G 3', или

5' T*C_G*G*A*C_G*T*T*C_G*G*C*G*C*G*C*C*G 3', или

5' T*C_G*C_G*T*C_G*T*T*C_G*G*C*G*C*G*C*C*G 3', или

5' T*C_G*A*C_G*T*T*C_G*G*C*G*C_G*C*G*C*C*G 3', или

5' T*C_G*A*C_G*T*T*C_G*G*C*G*C*G*C*C*G 3', или

5' Т*С_С*С_С*Т*С_С*Т*Т*С_С*С*С*С*С*С*С 3', или

5' T*C_G*C_G*A*C_G*T*T*C_G*G*C*G*C_G*C*G*C*C*G 3', или

5' T*C*G*T*C*G*T*T*T*T*C*G*G*C*G*C*G*C*G*C*C*G 3', или

5' T*C*G*T*C*G*T*T*PT*C*G*G*C*G*G*C*C*G*C*C*G 3', или

5' T*C*G*T*C_G*T*T*T*T*A*C_G*G*C*G*C*C_G*T*G*C*C*G 3', или

5' T*C_G*T*C*G*T*T*T*T*C*G*G*C*G*C*G*C*G*C*C*G*T 3',

где * относится к фосфоротиоатной связи, и _ относится к фосфодиэфирной связи.

В любой из этих последовательностей, 5' Т можно заменить этил-уридином или галогеном, примеры замещений галогеном включают, но не ограничиваются этим-замещения бром-уридином или йод-уридином.

Иммуностимулирующие CpG-олигонуклеотиды "Р класса" были описаны в WO 2007/095316 и характеризуется тем, что содержат дуплекс-образующие участки, такие как, например, совершенные или несовершенные палиндромы на 5'- и 3'-концах или вблизи них, давая им возможность образовывать более упорядоченные структуры, такие как конкатамеры. Эти олигонуклеотиды, называемые олигонуклеотидами Р-класса, способны в некоторых случаях индуцировать очень высокие уровни секреции IFN-α по сравнению с С-классом. Опигонуклеотиды Р-класса способны самопроизвольно самоорганизовываться в конкатамеры in vitro и/или in vivo. He будучи связанными какой-либо конкретной теорией для способа действия этих молекул, одной из возможных гипотез является то, что это свойство придает олигонуклеотидам Р-класса способность к гораздо более эффективному сшиванию TLR9 внутри некоторых иммунных клеток, индуцируя картину иммунной активации, отличную от ранее описанных классов CpG-олигонуклеотидов.

В одном из воплощений CpG-олигонуклеотид для применения в настоящем изобретении представляет собой CpG-олигонуклеотид Р класса, содержащий 5' домен активации TLR и по меньшей мере два палиндромных участка, где один палиндромный участок представляет собой 5'-палиндромный участок длиной по меньшей мере 6 нуклеотидов и связан с 3'-палиндромным участком длиной по меньшей мере 8 нуклеотидов непосредственно или через спейсер, где олигонуклеотид включает по меньшей мере один YpR-динуклеотид. В одном из воплощений указанный олигонуклеотид не является T*C_G*T*C_G*A*C_G*T*T*C_G*G*C*G*C_G*C*G*C*C*G. В одном из воплощений CpG-олигонуклеотид Р класса включает по меньшей мере один неметилированный CpG-динуклеотид. В другом воплощении домен активации TLR представляет собой TCG, TTCG, TTTCG, TYpR, TTYpR, TTTYpR, UCG, UUCG, UUUCG, TTT или ТТТТ. В еще одном воплощении домен активации TLR находится в пределах 5'-палиндромного участка. В другом воплощении домен активации TLR находится непосредственно с 5' относительно 5'-палиндромного участка. В еще одном воплощении 5'-палиндромный участок имеет длину по меньшей мере 8 нуклеотидов. В другом воплощении 3'-палиндромный участок имеет длину по меньшей мере 10 нуклеотидов. В другом воплощении 5'-палиндромный участок имеет длину по меньшей мере 10 нуклеотидов. В еще одном воплощении 3'-палиндромный участок включает неметилированный CpG-динуклеотид. В другом воплощении 3'-палиндромный участок включает два неметилированных динуклеотида CpG. В другом воплощении 5'-палиндромный участок включает неметилированный CpG-динуклеотид. В еще одном воплощении 5'-палиндромный участок включает два неметилированных динуклеотида CpG. В другом воплощении 5'- и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 25. В другом воплощении 5'-и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 30. В другом воплощении 5'- и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 35. В другом воплощении 5'- и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 40. В другом воплощении 5'- и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 45. В другом воплощении 5'- и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 50. В другом воплощении 5'- и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 55. В другом воплощении 5'- и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 60. В другом воплощении 5'- и 3'-палиндромные участки имеют значение стабильности дуплекса по меньшей мере 65.

В одном из воплощений два палиндромных участка связаны непосредственно. В другом воплощении два палиндромных участка связаны посредством 3'-3' связи. В другом воплощении два палиндромных участка перекрываются по одному нуклеотиду. В еще одном воплощении два палиндромных участка перекрываются по двум нуклеотидам. В другом воплощении два палиндромных участка не перекрываются. В другом воплощении два палиндромных участка связаны спейсером. В одном из воплощений спейсер представляет собой нуклеиновую кислоту, имеющую длину от 1 до 50 нуклеотидов. В другом воплощении спейсер представляет собой нуклеиновую кислоту, имеющую длину в 1 нуклеотид. В другом воплощении спейсер представляет собой ненуклеотидный спейсер, В одном из воплощений ненуклеотидный спейсер представляет собой D-спейсер. В другом воплощении ненуклеотидный спейсер представляет собой линкер. В одном из воплощений олигонуклеотид имеет формулу 5' XP1SP2T 3', где X представляет собой домен активации TLR, P1 представляет собой палиндром, S представляет собой спейсер, Р2 представляет собой палиндром, и Т представляет собой 3'-хвост длиной 0-100 нуклеотидов. В одном из воплощений Х представляет собой TCG, TTCG или TTTCG. В другом воплощении Т имеет длину 5-50 нуклеотидов. В еще одном воплощении Т имеет длину 5-10 нуклеотидов. В одном из воплощений S представляет собой нуклеиновую кислоту, имеющую длину от 1 до 50 нуклеотидов. В другом воплощении S представляет собой нуклеиновую кислоту, имеющую длину в 1 нуклеотид. В другом воплощении S представляет собой ненуклеотидный спейсер. В одном из воплощений ненуклеотидный спейсер представляет собой D-спейсер. В другом воплощении ненуклеотидный спейсер представляет собой линкер. В другом воплощении олигонуклеотид не является антисмысловым олигонуклеотидом или рибозимом. В одном из воплощений P1 является А- и Т-богатым, В другом воплощении P1 включает по меньшей мере 4 Т. В другом воплощении P2 представляет собой совершенный палиндром. В другом воплощении Р2 является G-C-богатым. В еще одном воплощении P2 представляет собой CGGCGCX1GCGCCG, где X1 представляет собой Т или ничего.

В одном из воплощений олигонуклеотид включает по меньшей мере одну фосфоротиоатную связь. В другом воплощении все внутринуклеотидные связи олигонуклеотида являются фосфоротиоатными связями. В другом воплощении олигонуклеотид включает по меньшей мере одну связь, подобную фосфодиэфирной связи. В другом воплощении связь, подобная фосфодиэфирной, представляет собой фосфодиэфирную связь. В другом воплощении липофильная группа конъюгирована с олигонуклеотидом. В одном из воплощений липофильная группа представляет собой холестерин.

В одном из воплощений агонист TLR-9 для применения в настоящем изобретении представляет собой CpG-олигонуклеотид Р класса с 5'-доменом активации TLR и по меньшей мере двумя комплементарность-содержащими участками: 5'- и 3'-комплементарность-содержащими участками, где каждый комплементарность-содержащий участок имеет длину по меньшей мере 8 нуклеотидов и соединен друг с другом напрямую или посредством спейсера, где олигонуклеотид включает по меньшей мере один пиримидин-пуриновый (YpR) динуклеотид и где по меньшей мере один из комплементарность-содержащих участков не является совершенным палиндромом. В одном из воплощений олигонуклеотид включает по меньшей мере один неметилированный CpG-динуклеотид. В другом воплощении домен активации TLR представляет собой TCG, TTCG, TTTCG, TYpR, TTYpR, TTTYpR, UCG, UUCG, UUUCG, TTT или ТТТТ. В другом воплощении домен активации TLR находится в пределах 5'-комплементарность-содержащего участка. В другом воплощении домен активации TLR находится непосредственно с 5' относительно 5'-комплементарность-содержащего участка. В другом воплощении 3'-комплементарность-содержащий участок имеет длину по меньшей мере 10 нуклеотидов В еще одном воплощении 5'-комплементарность-содержащий участок имеет длину по меньшей мере 10 нуклеотидов. В одном из воплощений 3'-комплементарность-содержащий участок включает неметилированный CpG-динуклеотид. В другом воплощении 3'-комплементарность-содержащий участок включает два неметилированных динуклеотида CpG. В еще одном воплощении 5'-комплементарность-содержащий участок включает неметилированный CpG-динуклеотид. В другом воплощении 5'-комплементарность-содержащий участок включает два неметилированных динуклеотида CpG. В другом воплощении комплементарность-содержащие участки включают по меньшей мере один нуклеотидный аналог. В другом воплощении комплементарность-содержащие участки образуют межмолекулярный дуплекс. В одном из воплощений внутримолекулярный дуплекс включает по меньшей мере одну пару оснований не Уотсон-Криковского типа. В другом воплощении пара оснований не Уотсона-Криковского типа представляет собой G-T, G-A, G-G или С-А. В одном из воплощений комплементарность-содержащие участки образуют межмолекулярные дуплексы. В другом воплощении по меньшей мере один из межмолекулярных дуплексов включает по меньшей мере одну пару оснований не Уотсона-Криковского типа. В другом воплощении пара оснований не Уотсона-Криковского типа представляет собой G-T, G- А, G-G или С-А. В еще одном воплощении комплементарность-содержащие участки содержат ошибочное спаривание. В еще одном воплощении комплементарность-содержащие участки содержат два ошибочных спаривания. В другом воплощении комплементарность-содержащие участки содержат промежуточный нуклеотид. В другом воплощении комплементарность-содержащие участки содержат два промежуточных нуклеотида.

В одном из воплощений 5'- и 3'-комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 25. В другом воплощении 5'- и 3'-комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 30. В другом воплощении 5'- и 3'-комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 35. В другом воплощении комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 40. В другом воплощении комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 45. В другом воплощении комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 50. В другом воплощении комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 55. В другом воплощении комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 60. В другом воплощении комплементарность-содержащие участки имеют значение стабильности дуплекса по меньшей мере 65.

В другом воплощении два комплементарность-содержащих участка соединены непосредственно. В другом воплощении два палиндромных участка соединены посредством 3'-3'-связи. В еще одном воплощении два комплементарность-содержащих участка перекрываются по одному нуклеотиду. В другом воплощении два комплементарность-содержащих участка перекрываются по двум нуклеотидам. В другом воплощении два комплементарность-содержащих участка не перекрываются. В другом воплощении два комплементарность-содержащих участка соединены посредством спейсера. В другом воплощении спейсер представляет собой нуклеиновую кислоту, имеющую длину 1-50 нуклеотидов. В другом воплощении спейсер представляет собой нуклеиновую кислоту, имеющую длину в 1 нуклеотид. В одном из воплощений спейсер представляет собой ненуклеотидный спейсер. В другом воплощении ненуклеотидный спейсер представляет собой D-спейсер. В еще одном воплощении ненуклеотидный спейсер представляет собой линкер.

В одном из воплощений олигонуклеотид Р-класса имеет формулу 5' XNSPT 3', где Х представляет собой домен активации TLR, N представляет собой несовершенный палиндром, Р представляет собой палиндром, S представляет собой спейсер, и Т представляет собой 3'-хвост длиной 0-100 нуклеотидов. В другом воплощении Х представляет собой TCG, TTCG, или TTTCG. В другом воплощении Т имеет длину 5-50 нуклеотидов. В другом воплощении Т имеет длину 5-10 нуклеотидов. В другом воплощении S представляет собой нуклеиновую кислоту, имеющую длину 1-50 нуклеотидов. В другом воплощении S представляет собой нуклеиновую кислоту, имеющую длину в 1 нуклеотид. В другом воплощении S представляет собой ненуклеотидный спейсер. В другом воплощении ненуклеотидный спейсер представляет собой D-спейсер. В другом воплощении ненуклеотидный спейсер представляет собой линкер. В другом воплощении олигонуклеотид не является антисмысловым олигонуклеотидом или рибозимом. В другом воплощении N является А- и Т-богатым. В другом воплощении N включает по меньшей мере 4 Т. В другом воплощении Р представляет собой совершенный палиндром. В другом воплощении Р является G-C-богатым. В другом воплощении Р представляет собой CGGCGCX1GCGCCG, где X1 представляет собой Т или ничего. В другом воплощении олигонуклеотид включает по меньшей мере одну фосфоротиоатную связь. В другом воплощении все межнуклеотидные связи олигонуклеотида представляют собой фосфоротиоатные связи. В другом воплощении олигонуклеотид включает по меньшей мере одну связь, подобную фосфодиэфирной связи. В другом воплощении связь, подобная фосфодиэфирной, представляет собой фосфодиэфирную связь. В другом воплощении липофильная группа конъюгирована с олигонуклеотидом. В одном из воплощений липофильная группа представляет собой холестерин.

В одном из воплощений CpG-олигонуклеотиды "Р класса" по изобретению имеют следующую последовательность нуклеиновой кислоты; 5' TCGTCGACGATCGGCGCGCGCCG 3' (SEQ ID NO:607).

В указанных последовательностях все связи могут представлять собой фосфоротиоатные связи. В другом воплощении одна или более связей могут быть фосфодиэфирными, предпочтительно между "С" и "G" CpG-мотива, давая полугибкий CpG-олигонуклеотид. В любой из этих последовательностей этил-уридин или галоген может замещать 5' Т; примеры замещений галогеном включают, но не ограничиваются этим, замещения бром-уридином или йод-уридином.

Неограничивающий пример олигонуклеотидов Р-класса включает:

5' T*C_G*T*C_G*A*C_G*A*T*C_G*G*C*G*C_G*C*G*C*C*G 3'

где * относится к фосфоротиоатной связи, и _ относится к фосфодиэфирной связи.

В одном из воплощений все межнуклеотидные связи CpG-олигонуклеотидов, описанный в данной заявке, являются фосфодиэфирными связями ("гибкие" олигонуклеотиды, как описано в заявке РСТ WO 2007/026190). В другом воплощении CpG-олигонуклеотиды по изобретению делают устойчивыми к деградации (например, стабилизируют). "Стабилизированный олигонуклеотид" относится к олигонуклеотиду, который относительно устойчив к деградации in vivo (например, посредством экзо- или эндонуклеаз). Стабилизация нуклеиновой кислоты может быть достигнута с помощью модификаций скелета. Олигонуклеотиды, имеющие фосфоротиоатные связи, обеспечивают максимальную активность и защищают олигонуклеотид от деградации внутриклеточными экзо- и эндонуклеазами.

Иммуностимулирующие олигонуклеотиды могут иметь химерный скелет, который представляет комбинацию фосфодиэфирных и фосфоротиоатных связей. Для целей настоящего изобретения химерный скелет относится к частично стабилизированному скелету, где по меньшей мере одна межнуклеотидная связь является фосфодиэфирной или подобной фосфодиэфирной и где по меньшей мере одна другая межнуклеотидная связь представляет собой стабилизированную межнуклеотидную связь, где по меньшей мере одна фосфодиэфирная или подобная фосфодиэфирной связь и по меньшей мере одна стабилизированная связь отличаются. Когда фосфодиэфирная связь преимущественно находится в пределах CpG-мотива, такие молекулы называются "полугибкими", как описано в заявке РСТ WO 2007/026190.

Другие модифицированные олигонуклеотиды включают комбинации фосфодиэфирных, фосфоротиоатных, метилфосфонатных, метилфосфоротиоатных, фосфородитиоатные и/или пара-этокси-связи.

Поскольку боранофосфонатные связи, как сообщалось, являются стабилизированными по сравнению с фосфодиэфирными связями, в рамках химерной природы скелета, боранофосфонатные связи можно классифицировать либо как подобные фосфодиэфирным, либо как стабилизированные, в зависимости от контекста. Например, химерный скелет согласно настоящему изобретению в некоторых воплощениях может включать по меньшей мере одну фосфодиэфирную (фосфодиэфирную или подобную фосфодиэфирной) связь и по меньшей мере одну боранофосфонатную (стабилизированную) связь. В других воплощениях химерный скелет согласно настоящему изобретению может включать боранофосфонатные (фосфодиэфирные или подобные фосфодиэфирным) и фосфоротиоатные (стабилизированные) связи. "Стабилизированная межнуклеотидная связь" означает межнуклеотидную связь, которая относительно устойчива к деградации in vivo (например, посредством экзо- или эндонуклеаз) по сравнению с фосфодиэфирной межнуклеотидной связью. Предпочтительные стабилизированные межнуклеотидные связи включают, без ограничения, фосфоротиоатные, фосфородитиоатные, метилфосфонатные и метилфосфоротиоатные. Другие стабилизированные межнуклеотидные связи включают, без ограничения, пептидные, алкильные, дефосфо- и другие связи, как описано выше.

Модифицированные скелеты, такие как фосфоротиоаты, могут быть синтезированы с использованием автоматизированных методов с использованием либо фосфорамидатной, либо Н-фосфонатной химии. Арил- и алкилфосфонаты могут быть получены, например, как описано в патенте США №4469863; и алкилфосфотриэфиры (в которых заряженная кислородная группировка алкилирована, как описано в патенте США №5023243 и Европейском патенте №092574) могут быть получены с помощью автоматизированного твердофазного синтеза с использованием имеющихся в продаже реагентов. Способы получения других модификаций и замещений ДНК-скелета были описаны. Uhlmann E et al. (1990) Chem Rev 90:544; Goodchild J (1990) Bioconjugate Chem 1:165. Способы получения химерных олигонуклеотидов также известны. Например, в патентах, выданных на Uhlmann и др., описаны такие способы.

Смешанный скелет-модифицированный ODN может быть синтезирован, как описано в заявке PCT WO 2007/026190.

Олигонуклеотиды по изобретению также могут включать другие модификации. К ним относятся неионные аналоги ДНК, такие как алкил- и арил-фосфаты (в которых заряженный фосфонатный кислород замещен алкильной или арильной группой), фосфодиэфиры и алкилфосфотриэфиры. в которых заряженная кислородная группировка алкилирована. Нуклеиновые кислоты, которые содержат диол, такие как тетраэтиленгликоль или гексаэтиленгликоль, либо на одном, либо на обоих концах, как также было показано, в значительной степени устойчивы к нуклеазной деградации.

Размер CpG-олигонуклеотида (т.е. число нуклеотидных остатков вдоль длины олигонуклеотида) также может способствовать стимулирующей активности олигонуклеотида. Для облегчения поступления в клетки, CpG-олигонуклеотид по изобретению предпочтительно имеет минимальную длину 6 нуклеотидных остатков. Олигонуклеотиды любого размера больше 6 нуклеотидов (даже много т.п.н. в длину) способны индуцировать иммунный ответ, если присутствуют достаточные иммуностимулирующие мотивы, поскольку более крупные олигонуклеотиды деградируют внутри клеток. В некоторых воплощениях CpG-олигонуклеотиды имеют длину от 6 до 100 нуклеотидов, предпочтительно длину от 8 до 30 нуклеотидов. В важном воплощении нуклеиновые кислоты и олигонуклеотиды по изобретению не являются плазмидами или экспрессирующими векторами.

В одном из воплощений CpG-олигонуклеотид, описанный в данной заявке, содержит замены или модификации, такие как в основаниях и/или сахарах, как описано в параграфах 134-147 в WO 2007/026190.

В одном из воплощений CpG-олигонуклеотид по настоящему изобретению химически модифицирован. Примеры химических модификаций известны специалисту и описаны, например, в UhSmanri E. et al. (1990), Chem. Rev. 90:543, S. Agrawal, Ed., Humana Press, Totowa, USA 199.3; Crooke, S.T. et al. (1996) Annu. Rev. Pharmacol. Toxicol. 36:107-129; и Hunziker J. et al., (1995), Mod. Synth. Methods 7:331-417. Олигонуклеотид согласно изобретению может иметь одну или более модификаций, где каждая модификация локализована в конкретном фосфодиэфирном межнуклеозидном мостике и/или в конкретном β-D-рибозном звене и/или в конкретном природном положении нуклеозидного основания по сравнению с олигонуклеотидом с такой же последовательностью, которая состоит из природной ДНК или РНК.

В некоторых воплощениях изобретения CpG-содержащие нуклеиновые кислоты могут быть просто смешаны с иммуногенными носителями согласно способам, известным специалистам в данной области техники (см., например, WO 03/024480).

В конкретном воплощении настоящего изобретения любая вакцина, описанная в данной заявке, содержит от 20 мкг до 20 мг CpG-олигонуклеотида, предпочтительно от 0,1 мг до 10 мг CpG-олигонуклеотида, предпочтительно от 0,2 мг до 5 мг CpG-олигонуклеотида, предпочтительно от 0,3 мг до 3 мг CpG-олигонуклеотида, более предпочтительно от 0,4 до 2 мг CpG-олигонуклеотида, более предпочтительно от 0,5 до 1,5 мг CpG-олигонуклеотида. В предпочтительном воплощении любая вакцина, описанная в данной заявке, содержит приблизительно от 0,5 до 1 мг CpG-олигонуклеотида.

Предпочтительные адъюванты для применения в настоящем изобретении представляют собой квасцы, QS21, CpG ODN, квасцы в комбинации с CpG ODN, Iscomatrix и Iscomatrix в комбинации с CpG ODN.

Фармацевтические композиции по изобретению

В изобретении также предложены фармацевтические композиции, содержащие антигенный пептид PCSK9 по изобретению или его иммуногенную композицию, в препарате совместно с одним или более фармацевтически приемлемым(и) эксципиентом(ами) и возможно объединенные с одним или более адъювантами (как адъювант, описанный выше). Термин "эксципиент" используют в данной заявке для описания любых ингредиентов, отличных от активного ингредиента, т.е. антигенного пептида PCSK9 по изобретению, в конечном счете связанного с иммуногенным носителем и возможно объединенного с одним или более адъювантами. Выбор эксципиента(ов) будет по существу зависеть от факторов, таких как конкретный способ введения, влияние эксципиента на растворимость и стабильность, и характер лекарственной формы. Как использовано в данной заявке, "фармацевтически приемлемый эксципиент" включает любые и все растворители, дисперсионную среду, покрытия, антибактериальные и противогрибковые агенты, изотонические и замедляющие поглощение агенты и т.п., которые являются физиологически совместимыми. Некоторые примеры фармацевтически приемлемых эксципиентов представляют собой воду, физиологический раствор, фосфатный буфер, декстрозу, глицерин, этанол и т.п., а также их комбинации. Во многих случаях предпочтительно включать изотонические агенты, например, сахара, полиспирты, такие как маннит, сорбит, или хлорид натрия в композицию. Дополнительные примеры фармацевтически приемлемых веществ представляют собой увлажняющие агенты или небольшие количества вспомогательных веществ, такие как увлажняющие или эмульгирующие агенты, консерванты и буферы, которые увеличивают срок хранения и эффективность активного ингредиента.

Фармацевтические композиции по настоящему изобретению и способы их получения будут очевидны специалистам в данной области техники. Такие композиции и способы их получения можно найти, например, в Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company, 1995). Фармацевтические композиции предпочтительно готовят согласно условиям GMP (Good Manufacturing Practice, надлежащая практика организации производства).

Фармацевтическую композицию по изобретению можно получать, упаковывать или продавать нефасованной, в виде однократной дозы или множества однократных доз. Используемая в данной заявке "однократная доза" представляет собой определенное количество фармацевтической композиции, содержащей заданное количество активного ингредиента. Количество активного ингредиента обычно равно дозе активного ингредиента, который вводят субъекту, или удобной фракции такой дозировки, такой как, например, половина или треть такой дозировки.

Любой способ введения пептидов или белков, принятый в данной области, может соответствующим образом использоваться для пептидов или белков по изобретению.

Фармацевтические композиции по изобретению обычно подходят для парентерального введения. Используемое в данной заявке "парентеральное введение" фармацевтической композиции включает любой путь введения, характеризующийся физической брешью в ткани субъекта, и введение фармацевтической композиции через брешь в ткань, таким образом обычно приводящее к непосредственному введению в кровоток, в мышцу или во внутренний орган. Парентеральное введение, таким образом, включает, но не ограничивается этим, введение фармацевтической композиции посредством инъекции композиции, путем применения композиции через хирургический разрез, путем применения композиции через тканепроникающую нехирургическую рану и тому подобное. В частности, предполагается, что парентеральное введение включает, но не ограничивается этим, подкожную, внутрибрюшинную, внутримышечную, интрастернальную, внутривенную, внутриартериальную, интратекальную, внутрижелудочковую, внутриуретральную, внутричерепную, внутрисуставную инъекцию или инфузии; и способы диализа и инфузии почек. Предпочтительные воплощения включают внутривенные, подкожные, внутрикожные и внутримышечные пути, еще более предпочтительные воплощения представляют собой внутримышечные или подкожные пути.

Препараты фармацевтической композиции, подходящие для парентерального введения, обычно содержат активный ингредиент, объединенный с фармацевтически приемлемым носителем, таким как стерильная вода или стерильный изотонический физиологический раствор. Такие препараты можно готовить, упаковывать или продавать в форме, подходящей для болюсного введения или для непрерывного введения. Инъецируемые препараты можно готовить, упаковывать или продавать в стандартной лекарственной форме, такой как ампулы или многодозовые контейнеры, содержащие консервант. Препараты для парентерального введения включают, но не ограничиваются этим, суспензии, растворы, эмульсии в масляных или водных носителях, пасты и т.п. Такие препараты могут дополнительно содержать один или более дополнительных ингредиентов, включая, но не ограничиваясь этим, суспендирующие, стабилизирующие или диспергирующие агенты. В одном из воплощений препарата для парентерального введения активный ингредиент предложен в сухой (т.е. порошковой или гранулярной) форме для восстановления подходящим наполнителем (например, стерильной апирогенной водой) перед парентеральным введением восстановленной композиции. Парентеральные препараты также включают водные растворы, которые могут содержать эксципиенты, такие как соли, углеводы и буферные агенты (предпочтительно с рН от 3 до 9), но для некоторых применений они могут быть более предпочтительно приготовлены в виде стерильного неводного раствора или в виде высушенной формы, используемой в сочетании с подходящим наполнителем, таким как стерильная апирогенная вода. Типичные формы для парентерального введения включают растворы или суспензии в стерильных водных растворах, например, водном пропиленгликоле или растворах декстрозы. Такие лекарственные формы могут быть соответствующим образом забуферены, при желании. Другие парентерально вводимые препараты, которые являются полезными, включают препараты, которые содержат активный ингредиент в микрокристаллической форме, в форме микрочастиц или в липосомальном препарате. Препараты для парентерального введения могут быть приготовлены для немедленного и/или модифицированного высвобождения. Композиции с модифицированным высвобождением включают отсроченное, замедленное, импульсное, контролируемое, направленное и запрограммированное высвобождение.

Например, в одном аспекте стерильные инъецируемые растворы можно приготовить посредством включения анти-PCSKQ пептида, предпочтительно связанного с иммуногенным носителем, возможно в комбинации с одним или более адъювантами, в необходимом количестве в соответствующем растворителе с одним или комбинацией ингредиентов, перечисленных выше. при необходимости, с последующей стерилизацией фильтрованием. Обычно дисперсии готовят путем включения активного соединения в стерильный наполнитель, который содержит основную дисперсионную среду и другие необходимые ингредиенты из перечисленных выше. В случае стерильных порошков для приготовления стерильных инъецируемых растворов, предпочтительными способами приготовления является вакуумная сушка и сублимационная сушка, которые дают порошок активного ингредиента плюс любой дополнительный желаемый ингредиент из его раствора, предварительно простерилизованного фильтрованием. Надлежащая текучесть раствора может быть обеспечена, например, за счет использования покрытия, такого как лецитин, путем поддержания требуемого размера частиц в случае дисперсии и использования поверхностно-активных веществ. Продолжительное поглощение инъецируемых композиций может быть осуществлено, например, путем включения в композицию агента, который замедляет поглощение, например, моностеаратных солей и желатина.

Типичная, неограничивающая фармацевтическая композиция по изобретению представляет собой препарат в виде стерильного водного раствора, имеющего рН, который варьируется от примерно 5,0 до примерно 6,5, и содержащий от примерно 0,1 мг/мл до примерно 20 мг/мл пептида по изобретению, от примерно 1 миллимолярного до примерно 100 миллимолярного гистидинового буфера, от примерно 0,01 мг/мл до примерно 10 мг/мл полисорбата 80, от примерно 100 миллимолярной до примерно 400 миллимолярной трегалозы и от примерно 0,01 миллимолярного до примерно 1,0 миллимолярного дигидрата динатриевой если ЭДТА.

Антигенные пептиды PCSK9 по изобретению также можно вводить интраназально или посредством ингаляции, обычно в форме сухого порошка (либо отдельно, в виде смеси, либо в виде фракции смешанных компонентов, например, смешанной с подходящим фармацевтически приемлемым эксципиентом) из ингалятора сухого порошка, такого как аэрозольный спрей из контейнера под давлением, насоса, спрея, атомайзера (предпочтительно атомайзера с использованием электрогидродинамики для создания тонкой пыли) или небулайзера с применением или без применения подходящего пропеллента, или в виде капель в нос.

Контейнер под давлением, насос, спрей, атомайзер или небулайзер, обычно содержит раствор или суспензию антитела по изобретению, содержащие, например подходящий агент для диспергирования, солюбилизации или пролонгированного высвобождения активного агента, пропеллента(ов) в качестве растворителя.

Перед применением в сухом порошковом препарате или суспензии, лекарственный препарат обычно измельчают до размера, подходящего для доставки посредством ингаляции (обычно менее 5 микрон). Этого можно достичь с помощью любого подходящего способа измельчения такого как размол в спиральной струйной мельнице, размол в струйной мельнице с кипящим слоем, обработка сверхкритической жидкостью с образованием наночастиц, гомогенизация при высоком давлении или сушка распылением.

Капсулы, блистерная упаковка и картриджи для применения в ингаляторе или инсуффляторе могут быть приготовлены для содержания порошковой смеси соединения по изобретению, подходящей порошковой основы и модификатора эффективности.

Препарат подходящего раствора для применения в атомайзере с использованием электрогидродинамики для получения тонкого порошка может содержать подходящую дозу антигенного пептида PCSK9 по изобретению на активацию, и объем активации может варьироваться, например, от 1 мкл до 100 мкл.

Подходящие ароматизаторы, такие как ментол и левоментол, или подсластители, такие как сахарин и сахарин натрия, могут быть добавлены к этим препаратам по изобретению, предназначенным для ингаляционного/интраназального введения.

Препараты для ингаляционного/интраназального введения могут быть приготовлены для немедленного и/или модифицированного высвобождения. Препараты для модифицированного высвобождения включают отложенное, замедленное, импульсное, контролируемое, направленное и запрограммированное высвобождение.

В случае ингаляторов сухого порошка и аэрозолей, единицу дозирования определяют с помощью клапана, который обеспечивает доставку отмеренного количества. Единицы согласно изобретению обычно организованы для введения отмеренной дозы или "пшика" антитела по изобретению. Общую суточную дозу обычно можно вводить в виде однократной дозы или чаще всего в виде разделенных доз в течение суток.

Фармацевтическая композиция, содержащая антигенный пептид PCSK9, может также быть приготовлена для перорального введения. Пероральное введение может включать проглатывание, так что соединение поступает в желудочно-кишечный тракт, и/или трансбуккальное, лингвальное или сублингвальное введение, с помощью которого соединение поступает в кровоток непосредственно из ротовой полости.

Препараты, подходящие для перорального введения, включают твердые, полутвердые и жидкие системы, такие как таблетки; мягкие или твердые капсулы, содержащие мульти- или наночастицы, жидкости или порошки; пастилки (включая заполненные жидкостью); жвачки; гели; быстро диспергируемые лекарственные формы; пленки, овули; спреи; и трансбуккальные/мукоадгезивные пластыри.

Жидкие препараты включают суспензии, растворы, сиропы и эликсиры. Такие препараты могут быть использованы в качестве наполнителей в мягких или твердых капсулах (сделанных, например, их желатина или гидроксипропилметилцеллюлозы) и обычно содержат носитель, например, воду, этанол, полиэтиленгликоль, пропиленгликоль, метилцеллюлозу или подходящее масло и один или более эмульгирующих агентов и/или суспендирующих агентов. Жидкие препараты могут также быть получены посредством восстановления твердой формы, например из сашета.

Композиции по изобретению могут быть использованы для лечения, облегчения или предупреждения PCSK9-опосредованного расстройства или симптомов у субъекта, подверженного риску развития или страдающего от такого расстройства или симптомов, посредством стимуляции иммунного ответа у указанного субъекта с помощью иммунотерапии. Иммунотерапия может включать первичную иммунизацию с последующими дополнительными, например, одной, двумя, тремя или более повторными иммунизациями.

"Иммунологически эффективное количество" антигенного пептида PCSK9 по изобретению или его композиция представляет собой количество, которое доставляют субъекту-млекопитающему либо в виде однократной дозы, либо в виде части серии, которая является эффективной для индукции иммунного ответа против PCSK9 у указанного субъекта. Это количество варьируется в зависимости от здоровья и физического состояния индивидуума, которого лечат, таксономической группы индивидуума, которого лечат, способности иммунной системы индивидуума синтезировать антитела, препарата вакцины и других соответствующих факторов. Предполагают, что количество находится в относительно широком диапазоне, который можно определить с помощью рутинных испытаний.

"Фармацевтически эффективная доза" или "терапевтически эффективная доза" представляет собой такую дозу, которая требуется для лечения, предупреждения или облегчения одного или более PCSK9-связанных расстройств или симптомов у субъекта. Фармацевтически эффективная доза зависит, в частности, от конкретного соединения, которое вводят, тяжести симптомов, чувствительности субъекта к побочным эффектам, типа заболевания, используемой композиции, пути введения, типа млекопитающего, которого лечат, физических характеристик конкретного рассматриваемого млекопитающего, таких как здоровье и физическое состояние, сопутствующее лечение, способности иммунной системы индивидуума синтезировать антитела, степени желаемой защиты и других факторов, которые известны специалистам в области медицины. Для профилактических целей количество пептида в каждой дозе выбирают в виде количества, которое индуцирует иммунозащитную реакцию без значительных неблагоприятных побочных эффектов при типичной вакцинации. После первичной вакцинации субъекты могут получать одну или несколько повторных иммунизации с адекватными интервалами.

Следует понимать, что конкретный дозовый уровень для любого конкретного пациента зависит от различных факторов, включающих активность конкретного используемого соединения, возраст, массу тела, общее состояние здоровья, пол, диету, время введения, путь введения и скорость выведения, комбинацию лекарственных средств и тяжесть конкретного заболевания, которое лечат.

Например, антигенные пептиды PCSK9 или фармацевтическую композицию по изобретению можно вводить субъекту в дозе от примерно 0,1 мкг до примерно 5 мг, например, от примерно 0,1 мкг до примерно 5 мкг, от примерно 5 мкг до примерно 10 мкг, от примерно 10 мкг до примерно 25 мкг, от примерно 25 мкг до примерно 50 мкг, от примерно 50 мкг до примерно 100 мкг, от примерно 100 мкг до примерно 500 мкг, от примерно 500 мкг до примерно 1 мг, от примерно 1 мг до примерно 2 мг, с оптимальными повторными иммунизациями, которые давают, например, через 1 неделю, 2 недели, 3 недели, 4 недели, два месяца, три месяца, 6 месяцев и/или год.

В некоторых воплощениях вводят однократную дозу антигенного пептида PCSK9 или фармацевтической композиции согласно изобретению. В других воплощениях вводят многократные дозы антигенного пептида PCSK9 или фармацевтической композиции согласно изобретению. Частота введения может варьироваться в зависимости от любого из множества факторов, например, тяжести симптомов, степени желаемой иммунозащиты, от того, используется ли композиция для профилактических или лечебных целей и т.д. Например, в некоторых воплощениях антигенный пептид PCSK9 или фармацевтическую композицию согласно изобретению вводят один раз в месяц, два раза в месяц, три раза в месяц, раз в две недели (qow), один раз в неделю (qw), два раза в неделю (biw), три раза в неделю (tiw), четыре раза в неделю, пять раз в неделю, шесть раз в неделю, через сутки (qod), ежесуточно (qd), два раза в сутки (qid) или три раза в сутки (tid). При использовании композиций по изобретению для профилактических целей, их обычно вводят как для первичной, так и повторных доз. Предполагают, что повторные дозы будут достаточно разделены адекватными промежутками времени, или предпочтительно даваться ежегодно или в такое время, когда уровни циркулирующего антитела падают ниже желаемого уровня. Повторные дозы могут состоять из антигенного пептида PCSK9 в отсутствие первоначальной иммуногенной молекулы-носителя. Такие бустерные конструкции могут содержать альтернативный иммуногенный носитель или могут не содержать никакого носителя. Такие бустерные композиции могут быть приготовлены либо вместе с адъювантом, либо без него.

Продолжительность введения антигенного пептида PCSK9 согласно изобретению, например, период времени, в течение которого вводят антигенный пептид PCSK9, может варьироваться в зависимости от любого из множества факторов, например, реакции пациента и т.д. Например, антигенный пептид PCSK9 можно вводить в течение периода времени, начиная от примерно одних суток до примерно одной недели, от примерно двух недель до примерно четырех недель, от примерно одного месяца до примерно двух месяцев, от примерно двух месяцев до примерно четырех месяцев, от примерно четырех месяцев до примерно шести месяцев, от примерно шести месяцев до примерно восьми месяцев, от примерно восьми месяцев до примерно 1 года, от примерно 1 года до примерно 2 лет или от примерно 2 лет до примерно 4 лет или больше.

В настоящем описании предусмотрены также различные способы лечения, которые включают введение антигенного пептида PCSK9 согласно изобретению. Рассматриваемые способы лечения включают способы индукции иммунного ответа у индивидуума против собственного PCSK9 и способы предупреждения, облегчения или лечения PCSK9-связанного расстройства или симптома у индивидуума.

В одном аспекте в настоящем изобретении предложен способ лечения, предупреждения или облегчения PCSK9-связанного расстройства или симптома у субъекта, включающий введение терапевтически эффективного количества антигенного пептида PCSK9 по изобретению или его иммуногенной или фармацевтической композиции указанному субъекту.

В другом аспекте в настоящем изобретении предложен способ индукции иммунного ответа против собственного PCSK9 у субъекта, включающий введение терапевтически или иммуногенно эффективного количества антигенного пептида PCSK9 по изобретению или его иммуногенной или фармацевтической композиции указанному субъекту.

PCSK9-связанное заболевание или PCSK9-опосредованное заболевание представляет собой, например, заболевание, при котором ингибирование активности PCSK9 или ингибирование взаимодействия PCSK9 с рецептором LDL может быть полезным.

"Лечить", "подвергать лечению" и "лечение" относятся к способу облегчения или отмены биологического расстройства и/или по меньшей мере одного из сопутствующих симптомов. Как использовано в данной заявке, "облегчать" заболевание, расстройство или состояние означает уменьшение тяжести и/или частоты появления симптомов заболевания, расстройства или состояния. Кроме того, ссылки в данной заявке на "лечение" включают ссылки на куративное, паллиативное и профилактическое лечение. Указанный субъект представляет собой предпочтительно человека и может быть мужчиной или женщиной любого возраста.

Другие аспекты изобретения относятся к антигенному пептиду PCSK9 согласно изобретению или его иммуногенной композиции или фармацевтической композиции для применения в качестве лекарственного средства, предпочтительно для лечения, облегчения или профилактики PCSK9-связанного расстройства.

В еще одном аспекте в настоящем изобретении предложено применение антигенного пептида PCSK9 по изобретению или его иммуногенной композиции или фармацевтической композиции в изготовлении лекарственного средства, предпочтительно для лечения PCSK9-связвнного расстройства.

В частности, изобретение относится к антигенному пептиду PCSK9 по изобретению или его иммуногенной или фармацевтической композиции для применения в качестве лекарственного средства, предпочтительно для лечения, облегчения или профилактики заболеваний, ассоциированных с повышенным уровнем холестерина.

В еще одном аспекте в настоящем изобретении предложено применение антигенного пептида PCSK9 по изобретению или его иммуногенной композиции или фармацевтической композиции в изготовлении лекарственного средства, предпочтительно для снижения уровня LDL-холестерина в крови у субъекта, нуждающегося в этом.

В некоторых аспектах применений или способов по изобретению указанное PCSK9-связанное расстройство выбрано из группы, состоящей из повышенного холестерина, состояния, ассоциированного с повышенным LDL-холестерином, например, липидного расстройства (например, гиперлипидемии, гиперлипидемии типа 1, типа 2, типа 3, типа 4 или типа 5, вторичной гипертриглицеридемии, гиперхолестеринемии, семейной гиперхолестеринемии, ксантоматоза, дефицита холестеринацетилтрансферазы), атеросклеротических состояний (например, атеросклероза), заболевания коронарной артерии и сердечно-сосудистых заболеваний.

В еще одном аспекте в настоящем изобретении предложено применение антигенного пептида PCSK9 по изобретению или его иммуногенной композиции или фармацевтической композиции в изготовлении лекарственного средства для лечения или облегчения заболеваний, при которых активация рецептора LDL или ингибирование взаимодействия между PCSK9 и рецептором LDL являются полезными.

В еще одном аспекте в настоящем изобретении предложено применение антигенного пептида PCSK9 по изобретению или его иммуногенной композиции или фармацевтической композиции в изготовлении лекарственного средства для лечения болезни Альцгеймера.

В других аспектах применений или способов по изобретению указанный субъект представляет собой млекопитающее, предпочтительно человека.

В других аспектах применений или способов по изобретению указанный субъект страдает от указанного PSCK9-связанного расстройства. Альтернативно, если указанный субъект имеет риск возникновения указанного PCSK9-связанного расстройства, например, вследствие наличия одного или более факторов риска (например, гипертензии, курении, сахарного диабета, ожирения или гипергомоцистеинемии).

Антигенный пептид PCSK9 по изобретению или его иммуногенная композиция или фармацевтическая композиция полезны для субъектов, которые не переносят терапию с другим агентом, снижающим уровень холестерина, или для субъектов, у которых терапия с другим агентом, снижающим уровень холестерина, приводит к неадекватным результатам (например, субъектов, которые испытывают недостаточное снижение LDL-c при статиновой терапии). Антигенный пептид PCSK9 по изобретению, описанный в данной заявке, можно вводить субъекту с повышенным LDL-холестерином.

Предпочтительно, субъект с повышенным холестерином представляет собой человека с общими уровнями холестерина в плазме 200 мг/дл или выше. Предпочтительно, субъект с повышенным холестерином представляет собой субъекта-человека с уровнями LDL-холестерина 160 мг/дл или выше.

Общие уровни холестерина в плазме и уровни LDL-холестерина измеряют с использованием стандартных способов в образцах крови, полученных после соответствующего голодания. Протоколы измерения уровней общего холестерина в плазме и уровней LDL-холестерина хорошо известны специалисту в данной области техники.

В одном из воплощений антигенный пептид PCSK9 или его иммуногенную композицию или фармацевтическую композицию вводят вместе с другим агентом, два агента можно вводить последовательно в любом порядке или одновременно. В некоторых воплощениях антигенный пептид PCSK9 или иммуногенную композицию или его фармацевтическую композицию вводят субъекту, который также получает лечение вторым агентом (например, вторым агентом, снижающим уровень холестерина). Агенты, снижающие уровень холестерина, включают статины, вещества, усиливающие секрецию желчных кислот, ниацин, производные фиброевой кислоты и длинноцепочечные альфа, омега-дикарбоновые кислоты. Статины ингибируют синтез холестерина посредством блокирования ГМГ-КоА (3-гидрокси-3-метилглутарил-кофермент А), ключевого фермента в биосинтезе холестерина. Примерами статинов являются ловастатин, правастатин, аторвастатин, церивастатин, флувастатин и симвастатин. Вещества, усиливающие секрецию желчных кислот, прерывают рециркуляцию желчных кислот из кишечника в печень. Примерами этих агентов являются холестирамин и колестипола гидрохлорид. Примерами производных фиброевой кислоты являются клофибрат и гемфиброзил. Длинноцепочечные альфа, омега-дикарбоновые кислоты описаны, например, в Bisgaier et al., 1998, J. Lipid Res. 39:17-30; WO 98/30530; патенте США №4689344; WO 99/00116; патенте США №5756344; патенте США №3773946; патенте США №4689344; патенте США №4689344; патенте США №4689344; и патенте США №3930024); простые эфиры (см., например, патент США №4711896; патент США №5756544; патент США №6506799). Фосфаты долихола (патент США №4613593) и производные азолидиндиона (оксазолидиндиона) (патент США №4287200) также могут быть использованы для снижения уровней холестерина. Режим комбинированной терапии может быть аддитивным или он может привести к синергическим результатам (например, к большему снижению холестерина, чем ожидалось для комбинированного использования двух агентов). В некоторых воплощениях комбинированная терапия с антигенным пептидом PCSK9 или его иммуногенной композицией или фармацевтической композицией и статином приводят к синергическим результатам (например, синергическому снижению холестерина). У некоторых субъектов это может позволить снизить дозировку статина для достижения желаемого уровня холестерина.

ПРИМЕРЫ

Следующие примеры представлены таким образом, чтобы обеспечить специалистов в данной области полным описанием изобретения и описанием того, как сделать и использовать настоящее изобретение, и не предназначены для ограничения объема того, что авторы изобретения считают своим изобретением, и представленные ниже эксперименты не рассматриваются единственными. Были сделаны попытки обеспечить точность в отношении используемых чисел (например, количеств, температуры и т.д.), но следует учитывать некоторые экспериментальные ошибки и отклонения. Если не указано иное, части представляют собой части по массе, молекулярная масса представляет собой среднюю молекулярную массу, температура представлена в градусах Цельсия, и давление соответствует атмосферному или приближено к нему. Могут быть использованы стандартные сокращения, например, п.о., пара(ы) оснований; т.п.о., тысяча(и) пар оснований; пл, пиколитр(ы); с или сек, секунда(ы); мин, минута(ы); ч, час(ы); а.к., аминокислота(ы); н., нуклеотид(ы); в/м, внутримышечный(но); в/б, внутрибрюшинный(но); п/к, подкожный(но); и тому подобное.

Пример 1 - Выбор антигенных пептидов PCSK9 в домене PCSK9-EGF-A поверхности взаимодействия рецептора LDL

Структура человеческого PCSK9, связывающегося с доменом EGF-A рецептора LDL была определена и опубликована (Kwon et al., PNAS 105, 1820-1825, 2008). Эту структурную информацию (PDB: 3BPS) использовали вместе с информацией о структуре свободного PCSK9, PDB: 2P4E (Cunningham et al., Nature Structural & Molecular Biology, 14; 413-419, 2007) для конструирования следующих пептидов, которые будут соответствовать областям, имеющим значение для взаимодействия PCSK9-рецептор LDL (см. Фиг 1).

Пептид 1. ASSDCSTCFV (SEQ ID NO:19)

Пептид 2. GTRFHRQASK (SEQ ID NO:63)

Пептид 3. IQSDHREIEGRV (SEQ ID NO:109)

Пептид 4. SGRDAGVAKGA (SEQ ID NO:153)

Пептид 5. SIPWNLERITP (SEQ ID NO:184)

Поскольку пептиды 1-4 представляют петли в структуре PCSK9, то соответствующие последовательности (SEQ ID NO:19, 63, 109 и 153) сделали с добавленными Cys, Cys-Gly или Lys линкерами, обеспечивающими связывание через оба конца с VLP носителем, чтобы обеспечить конформационный миметик природной петлевой структуры (от VR_9.1 до VR_9.4 в Таблице 1). В дополнение к этому также сделали циклизованные варианты пептидов 2-4 (от VR_9.6 до VR_9.9 в Таблице 1), которые обеспечивали остаток Cys для связывания с VLPs. Пептид 1 сделали с Lys-Gly-Gly N-концевым линкером для связывания таким образом, чтобы два остатка Cys были свободными для дисульфидной связи, которую они образуют в нативной структуре PCSK9. Пептид 5 представляет N-конец зрелой процессированной формы человеческого PCSK9 и связывается через добавленный к С-концу остаток цистеина, чтобы N-конец был свободным для распознавания антитела (VR 9.5 в Таблице 1). В следующей таблице (Таблица 1) описаны 9 пептидов, полученных для оценки кандидатов на роль вакцины.

Таблица 1
Пептидные последовательности
Пептид Последовательность SEQ ID NO:
VR_9.1 KGGASSDCSTCFV 313
VR_9.2 CGGTRFHRQASKC 314
VR_9.3 CGIQSDHREIEGRVC 315
VR_9.4 CSGRDAGVAKGAC 316
VR_9.5 SIPWNLERITPC 317
VR_9.6 ASK-Cys(H)-GDGTRFHRQ 318
VR_9.7 AG-Cys-(H)-GTRFHRQ 319
VR_9.8 GRV-Cys(H)-IQSDHREIE 320
VR_9.9 AGVAKGAG-Cys(H)-SGRD 321
Подчеркивание указывает на остатки цистеина, используемые для конъюгирования, а двойное подчеркивание указывает на GC или KGG-линкер.

Пример 2 - Получение Пептид-VLP конъюгатов для оценки кандидатов на роль вакцины

Пептиды синтезировали с использованием стандартного Fmoc протокола на амидной смоле CLEAR. Реакции сочетания аминокислот проводили с использованием 5-кратного избытка Fmoc-защищенной аминокислоты, активированной 1 экв. HBTU (2-(1Н-бензотриазол-1-ил)-1,1,3,3-тетраметилурония гексафторфосфат) в присутствии HOBt (гидроксибензотриазол) и NMM (N-метилморфолин). Снятие Fmoc-защитной группы достигалось с помощью смеси 20% пиперидин/DMF. Пептид, связанный со смолой, затем отщепляли и группы, защищающие боковые цепи, удаляли одновременно с реагентом D (TFA/H20/DODT: 89/3/8). Пептид получали со свободным N-концом и амидированным С-концом. Неочищенный пептид очищали до гомогенности с помощью ВЭЖХ с использованием колонки ВЕН 130 С18 и градиента вода/ацетонитрил в присутствии 0,1% TFA (трифторуксусная кислота). Очищенный пептид подвергали вакуумной сушке с использованием лиофилизатора. Пептид анализировали с помощью масс-спектрометрии (LC-MS) и получили удовлетворительные данные.

Qβ VLP, используемую в этом исследовании, получали с помощью бактериальной ферментации в штамме E. coli BL21 (DE3), включающем плазмиду рЕТ28, кодирующую мономерный белок 14 кДа: MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQP SRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY (Genbank ID: M99039). Ферментацию индуцируют при OD600 0,8 с помощью IPTG (изопропилтиогалактозид) и оставляют на ночь в terrific бульоне (ТВ) с канамицином. VLP, которая самоорганизуется в клетке-хозяине, затем очищали от клеточного осадка от ферментации с использованием способа, описанного в патентной заявке ЕР 1736538 со следующими отличиями: после разрушения клеток осветленный гомогенат обрабатывали сульфатом аммония при 50%-ном насыщении и клеточный осадок выделяли центрифугированием. Затем осадок растворяли в HEPES буфере и подвергали диализу против HEPES буфера перед проведением первой колоночной стадии в опубликованном способе. После стадий ионообменной колонки и гидроксиапатитной колонки материал очищали с использованием дополнительной стадии анионообменной колонки и подвергали стерильному фильтрованию с получением конечного нефасованного материала VLP, который анализировали с помощью гель-хроматографии, ПААГ-ДСН (электрофорез в полиакриламидном геле с додецилсульфатом натрия) и электронной микроскопии с приемлемыми результатами.

Конъюгирование пептидов через остатки цистеина:

Qβ VLP активировали с использованием либо N-гамма-малеимидо-бутирилоксисукцинимидного сложного эфира (GMBS), либо более длинного сукцинимидил-6-[β-малеимидопропионамидо]гексаноат-связывающего реагента. Процедура применения этих двух реагентов была похожей: твердый реагент растворяли в диметилсульфоксиде (ДМСО) и добавляли к раствору VLP при не менее чем 10-кратном молярном избытке. Реакцию активации оставляли не менее чем на 90 минут и раствор затем обессоливали с использованием обессоливающей колонки NAP-25 в фосфатно-солевом буфере Дульбекко (DPBS) с 5 мМ EDTA или фосфатно-солевом буфере Дульбекко (DPBS), который был модифицирован путем добавления твердой NaCl (14,6 г/л). При желании, раствор белка слегка концентрировали с использованием 10 кДа микроконцентраторов-центрифуг перед следующей реакцией конъюгирования.

Перед реакцией конъюгирования пептиды растворяли в аликвоте рН 7,4 DPBS с 5 мМ EDTA в качестве добавки. Концентрация пептида в растворе составляла 10 мг/мл. Растворенный пептид добавляли к аликвоте ТСЕР-иммобилизованного восстанавливающего агента (Pierce Chemical), который промывали в DPBS, содержащем 5 мМ EDTA. Аликвоту пептидов инкубировали при перемешивании в присутствии ТСЕР геля в течение приблизительно 1 часа, после чего аликвоту центрифугировали в микроцентрифуге и твердый осадок отбрасывали. Супернатант, содержащий восстановленный пептид, добавляли непосредственно к активированной VLP, которую готовили ранее, Одной из альтернатив этой процедуры, однако, является добавление твердого пептида непосредственно к образцу активированной Q(3 VLP. Оба способа одинаково хорошо работают на получение пептид-VLP конъюгатов.

Реакцию между VLPs и восстановленными пептидами оставляли протекать в течение по меньшей мере тридцати минут с очень осторожным перемешиванием. В конце реакционного периода каждый образец обессоливали в PBS Дульбекко (DPBS) с использованием обессоливающих колонок NAP-10 или NAP-25 (GE Healthcare). Обессоленные конъюгированные пептиды анализировали на содержание белка с использованием анализа по Брэдфорду (Кумасси бриллиантовый голубой, Pierce Chemical Co) или анализа белка с ВСА (бицинхониновая кислота) (Pierce Chemical Co), а также с помощью ПААГ-ДСН и гель-хроматографии. Конъюгированные продукты подвергали стерилизации фильтрованием с использованием 0,22 мкм фильтра и хранили при 2-8°С перед применением. Особое внимание обращали на эти образцы при хранении для предупреждения замерзания или воздействия экстремальных температур.

Конъюгирование пептида PCSK9 с CRM197 выполняли с использованием BAANS (N-гидроксисукцинимидный сложный эфир бромуксусной кислоты, Sigma B8271). Сначала CRM197 активировали путем взаимодействия с BAANS в 0,1 М карбонате натрия рН 8,3 с молярным соотношением 100 в холодной комнате в течение 90 минут. Реакционную смесь пропускали через обессоливающую колонку Zeba и собирали элюат. Пептид PCSK9 при 10 мг/мл инкубировали с равным объемом иммобилизованного ТСЕР восстанавливающего геля (Thermo Scientific) при комнатной температуре в течение 1 часа и собирали после центрифугирования через 0,2 мкм фильтр. Активированный CRM197 затем смешивали с обработанным пептидом в холодной комнате в течение ночи, с последующим активным диализом в PBS буфере. Конъюгат восстанавливали, концентрировали и стерилизовали, пропуская через 0,22 мкм фильтр. Концентрацию белка определяли с использованием анализа с Кумасси голубым (Thermo Scientific).

Конъюгирование пептидов через амины

Для конъюгирования пептидов с Qβ через аминные остатки, в частности пептида VR_9.1, выполняли следующую процедуру. Qβ сначала дериватизировали путем добавления твердого янтарного ангидрида при не менее чем 10-кратном молярном избытке относительно мономера VLP. Янтарный ангидрид оставляли растворяться и реакцию дериватизации оставляли протекать в течение по меньшей мере 30 минут. После этого образец обессоливали с использованием обессоливающей колонки NAP-25 в фосфатно-солевом буфере Дульбекко (DPBS) с 5 мМ EDTA. Затем следующие реагенты добавляли в указанном порядке при не менее чем 10-кратном молярном избытке относительно мономера VLP: Твердый пептид, N-гидроксисульфосукцинимид и, наконец, 1-этил-3-(3-диметиламинопропил)карбодиимид. После добавления реагентов в указанном выше порядке образец инкубировали при комнатной температуре и реакцию оставляли протекать в течение по меньшей мере 30 минут, после чего VLP-пептидный конъюгат подвергали обессоливанию с использованием обессоливающих колонок NAP-25 в фосфатно-солевом буфере Дульбекко (DPBS).

Степень конъюгирования для VLP-пептидных образцов измеряли с помощью ПААГ-ДСН, и увеличение молекулярной массы наблюдали во всех образцах, что согласуется с добавлением пептида к VLP-белковому мономеру. В дополнение к этому, образцы тестировали в ВЭЖХ гель-хроматографическом анализе (с использованием колонки Tosoh PWXL5000 HPLC) и обнаружили, что они содержат собранные VLP при сравнении с неконъюгированными образцами VLP. Признаки VLP-пептидного конъюгирования суммированы в Таблице 2.

Таблица 2
VLP-Пептидные конъюгаты
Пептид Добавление активированной VLP Количество добавл. пептида Процентный выход ввода VLP Приблизительное замещение (мкг пептида на MrVLP мономера)
VR_9.1 4 мг 5 мг 40-60% 25 мкг
VR_9.2 3 мг 5 мг 40-60% 125 мкг
VR_9.3 3 мг 5 мг 40-60% 125 мкг
VR_9.4 3 мг 5 мг 40-60% 125 мкг
VR_9.5 3 мг 5 мг 40-60% 50 мкг
VR_9.6 3 мг 5 мг 40-60% 125 мкг
VR_9.7 3 мг 5 мг 40-60% 125 мкг
VR_9.8 3 мг 5 мг 40-60% 125 мкг
VR_9.9 3 мг 5 мг 40-60% 125 мкг
VR_9.10 3 мг 5 мг 40-60% 125 мкг
VR_9.11 3 мг 2 мг 40-60% 125 мкг
VR_9.12 3 мг 2 мг 40-60% 125 мкг
VR_9.13 3 мг 2 мг 40-60% 125 мкг
VR_9.14 3 мг 2 мг 40-60% 125 мкг
VR_9.15 3 мг 2 мг 40-60% 125 мкг
VR_9.16 3 мг 2 мг 40-60% 125 мкг
VR_9.17 10 мг 9,5 мг 95% 82 мкг
VR_9.18 10 мг 8,7 мг 90% 74 мкг
VR_9.19 10 мг 7,6 мг 80% 58 мкг
VR_9.20 10 мг 8,7 мг 95% 86 мкг
VR_9.21 10 мг 8.8 мг 95% 92 мкг
VR_9.22 10 мг 6.6 мг 85% 62 мкг
VR_9.23 10 мг 10,0 мг 90% 85 мкг
VR_9.24 10 мг 10,5 мг 75% 64 мкг
VR_9.25 10 мг 5,1 мг 40% 1 мкг
VR_9.26 10 мг 10,0 мг 60% 123 мкг
VR_9.27 10 мг 9,6 мг 60% 136 мкг
VR_9.28 10 мг 9,4 мг 65% 153 мкг
VR_9.29 10 мг 4,2 мг 75% 19 мкг
VR_9.30 10 мг 4,4 мг 63% 15 мкг
VR_9.31 10 мг 4,4 мг 70% 13 мкг
VR_9.32 10 мг 4,4 мг 63% 15 мкг
VR_9.33 10 мг 7,4 мг 40% 18 мкг
VR_9.34 10 мг 7,3 мг 50% 23 мкг
VR_9.35 7,5 мг 4,3 мг 61% 16 мкг
* Как определено с помощью ПААГ-ДСН и денситометрическими расчетами

Пример 3: Иммуногенность пептида PCSK9

Это исследование нацелено на оценку того, насколько эффективны пептиды, конъюгированные с VLP Qbeta (как подробно указано выше в Примере 2) в индукции антительного ответа, которые могут связываться с человеческим и мышиным PCSK9. Самкам Balb/c (6-8 недель) вводили внутримышечным путем (объем 50 мкл в каждую мышцу Tibialis anterior) в сутки 0, 21 и 42 VLP-пептидные конъюгаты, приготовленные с квасцами с CpG формулы 5' TCGTCGTTnTCGGTGCTTTT 3'. Одну группу контрольных мышей иммунизировали VLP, связанной с контрольным (не-PCSK9) пептидом, следуя такому же протоколу, а вторую контрольную группу оставляли неиммунизированной. Аутопсия проводили на 49-е сутки. При аутопсии 400-600 мкл крови отбирали из подвергнутых эвтаназии мышей с помощью пункции сердца с использованием антикоагулянта. Кровь центрифугировали для отделения плазмы, которую хранили в замороженном состоянии до тестирования.

IgG антительные ответы на полноразмерный человеческий рекомбинантный белок PCSK9 измеряли с использованием колориметрического ELISA-метода. Серийные разведения получали из образцов сыворотки и испытаны в анализе.

Метод 1 ELISA человеческого PCSK9: на 384-луночные планшеты для анализа связывания (Coming International, кат. №3700) наносили 25 мкл/лунку концентрата человеческого белка PCSK9, разведенного до 1 мкг/мл с помощью 0,01 М PBS рН 7,4 и инкубировали на качалке при к.т. в течение 3 часов. После промывания × 2 PBS рН 7,4, планшеты блокировали с использованием 80 мкл/лунку 0,01 М PBS/1% БСА, инкубировали при к.т. в течение 1 часа перед окончательным промыванием × 3 0,01 М PBS рН 7,4/0,05% Tween 20. На следующие сутки готовили 8 точек ½ log серийных разведении каждого образца, начиная с разведения 1:25 (разбавитель PBS/1%BCA), 25 мкл/лунку серийного разведения переносили в двух повторностях в планшет, покрытый человеческим PCSK9, затем инкубировали при встряхивании при к.т. в течение 1,5 часов. После промывания × 3 0,01 М PBS рН 7,4/0,05% Tween 20, 25 мкл/лунку общего детектирующего IgG антитела (кроличье анти-mu IgG-Fc, кат. №А90-130А Bethyl Laboratories) при разведении 1:6000 добавляли 0,01 М PBS рН 7,4/1% БСА, затем инкубировали при встряхивании при к.т. в течение 1 часа. После промывания × 5 0,01 М PBS рН 7,4/0,05% Tween 20, добавляли 25 мкл/лунку набора козлиного анти-кроличьего конъюгата с пероксидазой хрена Bio-Rad (Bio-Rad, кат. №172-1019) 1:3000 0,01 М PBS рН 7,4/0,05% Tween 20 рН 7,4, затем инкубировали при встряхивании при к.т. в течение 1 часа. После промывания × 4 0,01 М PBS рН 7,4/0,05% Tween 20 и затем только × 1 0,01 М PBS рН 7,4 добавляли 25 мкл/лунку мышиного субстрата Typer HRP (Bio-Rad, кат. №172-1064) и планшеты инкубировали при к.т. в течение 30 минут. Добавляли 25 мкл/лунку 2% щавелевой кислоты и затем считывали поглощение при 405 нм.

Метод 1 ELISA мышиного PCSK9: на 96-луночные планшеты для ELISA Thermo Immunolon 4HBX наносили 100 мкл 1 мкг/мл рекомбинантного мышиного PCSK9 в PBS в течение ночи при 4°С. После промывания планшеты блокировали 300 мл PBS/0,5% БСА (Sigma A7030) в течение 1 часа, промывали 4 × 300 мкл PBS/0,01% Tween-20 и добавляли по 100 мкл серийных разведении образцов плазмы (в PBS/0,5% БСА). После инкубации при осторожном качании в течение 1 часа при комнатной температуре планшеты промывали 4х 300 мкл PBS/0,01% Tween-20 и в каждую лунку добавляли 100 мкл разведения 1:5000 козлиного антимышиного IgG-HRP (пероксидаза хрена; Pierce 31430). Планшеты инкубировали при комнатной температуре при осторожном качании в течение 45 минут и затем промывали × 7 300 мкл PBS/0,01% Tween-20. Затем добавляли 100 мкл ТМВ субстрата (Sigma T-4444), колориметрическую реакцию останавливали через 4 минуты путем добавления 2 н. серной кислоты и считывали поглощение при 450 нм.

Анализ данных: Кривые титрования строили для каждого тестируемого образца (разбавление образца против поглощения). Титр образца (впоследствии превращенный в реципрокный титр) затем использовали как разведение сыворотки, достигающее отсекающих значений оптической плотности (O.D.) 1,0 или 0,5.

Измерение уровня холестерина в плазме/сыворотке

Уровень холестерина в образцах плазмы и сыворотки измеряли с использованием набора для анализа WAKO Cholesterol E (кат. №439-17501) согласно инструкциям производителя. Разведения холестеринового стандарта или тестируемых образцов плазмы/сыворотки (объем 4 мкл) добавляли в лунки 96-луночного планшета и добавляли 196 мкл полученного холестеринового реагента. Планшет инкубировали в течение 5 минут при 37°С и поглощение развившейся окраски в течение 30 минут считывали при 600 нм.

Измерение взаимодействия между PCSK9 и внеклеточным доменом рецептора LDL

Прерывание связывания LDLR и PCSK9 с помощью мышиной плазмы

определяли с помощью TR-FRET анализа (анализ разрешения во времени резонансного переноса энергии флуоресценции) с использованием флуорофор-меченного внеклеточного домена LDLR (LDLR-ECD) и полноразмерного белка PCSK9 дикого типа. LDLR-ECD (R&D system, кат №2148-LD/CF)) метили европием (GE heaithcare, кат. №РА99148) согласно инструкции производителя (при молярном соотношении Eu:LDL.R 6:1). PCSK9 биотинилировали с помощью Биотин-XX-SSE (Pierce, кат. №21237) при молярном соотношении bnoTHH:PCSK9 8. Анализ TR-FRET выполняли с 5 нМ LDLR-Eu+3, 30 нМ PCSK9-биотин и 50 нМ Alexa FSuor 647, конъюгированным со стрептавидином (SA647, Invitrogen, кат. №S21374) в 20 мкл буфера для анализа (20 мМ Hepes, рН 7,0, 150 мМ NaCl2, 0,1 мМ CaCl2 и 0,05% (масс./об.) БСА) в 384-луночных черных планшетах (Corning, кат. №3676). Серийное разведение мышиной плазмы предварительно инкубировали с PCSK9-биотином при к.т. в течение 30 минут в увлажненной камере, с последующим смешиванием с LDLR и стрептавидин^А647. После дополнительной 60-минутной инкубации при к.т.во влажной атмосфере в темноте планшеты считывали на планшет-ридере Perkin Elmer Victor2, используя время задержки 50 мкс и окно 400 мкс. Данные представлены в виде отношения сигналов (665 нм/615 нМ)×1000.

Результаты: как показано на Фиг.2, все пептиды, используемые в качестве иммуногенов, были способны индуцировать антительные ответы на интактный полноразмерный человеческий белок PCSK9, некоторые индуцировали более высокие ответы, чем другие. Во всех случаях эти ответы перекрестие реагировали с мышиным PCSK9, как показано на Фиг 3. На Фиг.4 показано, что иммунизация пептидом VR_9.5 также приводила к снижению уровней холестерина в плазме, и на Фиг.5 и 6 показано, что VR_9.5 и VR_9.6 индуцировали сывороточные антительные ответы, которые могли ингибировать взаимодействие между PCSK9 и рецепторами LDL с использованием анализа резонансного переноса энергии флуоресценции (FRET).

Пример 4 - Конструирование пептидов, соответствующих участкам, отличным от рецепторного домена EGF-A. присутствующего в PDB: 3BPS:

Рецептор LDL представляет собой мультидоменный белок, внеклеточные домены которого состоят из N-концевого лиганд-связывающего домена, трех EGF-подобных повторов (из которых EGF-A представляет один) β-пропеллерного домена и "O-связанного сахарного домена" (Kwon et al., PNAS 105, 1820-1825, 2008). PDB файл 3GCX подробно описывает структуру PCSK9 в комплексе с растворимой формой только домена EGF-A рецептора LDL, поэтому авторы изобретения предположили, что могут существовать дополнительные неявные взаимодействия между PCSK9 и рецептором LDL, которые не могут быть выведены из прямого анализа молекул, представленных в PDB: 3GCX. Примеры этих участков подробно описаны на Фиг.7, и были идентифицированы конкретно две последовательности в PCSK9, которые могли действовать в качестве дополнительных предполагаемых рецепторных поверхностей взаимодействия (NAQDQPVTLGTL и INEAWFPEDQRVL - см. Фиг.8).

SIPWNLERIIP (SEQ ID NO:332) (мышь)

NAQDQPVTLGTL (SEQ ID NO:227)

INEAWFPEDQRVL (SEQ ID NO:263)

INMAWFPEDQQVL (SEQ ID NO:360) (мышь)

При использовании мышиных последовательностей PCSK9, обнаруженных в общедоступных базах данных, были идентифицированы мышиные гомологи (как показано в Таблице 3). Авторы изобретения также предположили, что часть аминокислотной последовательности, содержащаяся в пептиде VR_9.5 (описанная в Примере 1), также может взаимодействовать с частями рецептора LDL, не видимыми в PDB: 3BPS (Фиг.8). Эта концепция была исследована посредством уточнения последовательности VR_9.5 путем изменения аминокислотного линкера и ориентации конъюгирования. Авторы изобретения также идентифицировали пептид, соответствующий мышиному гомологу VR_9.5 (пептид VR_9.10) Полученный ряд пептидных последовательностей из описанного выше подхода был модифицирован путем добавления аминокислот для обеспечения химического конъюгирования и был оценены в качестве кандидатов на роль вакцины (пептиды подробно описаны в Таблице 3).

Таблица 3
Пептидные последовательности
Пептид Последовательность Вид SEQ ID NO:
VR_9.10 SIPWNLERIIPC Мышь 322
VR_9.11 CGGSIPWNLERIIP Мышь 323
VR_9.12 SIPWNLERIIPGGC Мышь 324
VR_9.13 CGGNAQDQPVTLGTL Мышь и человек 325
VR_9.14 NAQDQPVTLGTLGGC Мышь и человек 326
VR_9.15 CGGINMAWFPEDQQVL Мышь 327
VR_9.16 INMAWFPEDQQVLGGC Мышь 328
Подчеркнутые остатки указывают на аминокислоты, добавленные для целей конъюгирования.

Пример 5

Пептиды VR_9.10-VR_9.16 (а также VR_9.5 для сравнения) конъюгировали с Qβ VLP, как описано в примере 2, и использовали для иммунизации мышей и оценки антительных ответов на PCSK9, как описано в примере 3, с неконъюгированной VLP, используемой в качестве контрольного иммуногена. Как показано на Фиг.9 и 10, все пептиды индуцировали антитела, которые могут распознавать интактный полноразмерный мышиный PCSK9 в ELISA-анализе.

Пример 6

На основании наблюдений за снижением холестерина, индуцированным иммунизацией пептидом VR_9.5, представляющим N-конец зрелой процессированной формы человеческого PCSK9 (SEQ ID NO:184), авторы изобретения предположили, что, поскольку расщепленный продомен незрелого PCSK9, как известно, остается ассоциированным со зрелым белком PCSK9, участки этого продомена (SEQ ID NO:329) также являются возможными мишенями антител для снижения уровней холестерина.

MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ (SEQ ID NO:329)

Специфические, неограничивающие примеры пептидов, представляющих интерес, обнаружены в пределах С-концевой последовательности продоменного участка и экспонированных на поверхности последовательностей и петель, включая участки, содержащие известные у людей генетические мутации потери функции и приобретения функции:

VDYIEEDSSVFAQ (SEQ ID NO:308)

RCAKDPWRLPGT (SEQ ID NO:309)

AQAARRGYLTKIL (SEQ ID NO:310)

GDYEELVLALRSEEDG (SEQ ID NO:311)

FLVKMSGDLLELALKLP (SEQ ID NO:312)

Приведенные выше пептиды и их укорочения синтезируют с добавленными по N- или С-концу линкерами (например, CGG или GGC) или в виде циклизованных или иным образом конформационно ограниченных молекул и связывают с Qβ VLPs, как описано в примере 2, и используют для иммунизации мышей и оценки антительных ответов на PCSK9, как описано в примере 3.

Пример 7

Пептиды VR_9.5 и 9 10 конъюгировали с Qβ VLP или с CRM197, как описано в примере 2, и использовали для иммунизации мышей (BALB/c или C57BL/6) с использованием TiterMax Gold, квасцов или квасцов-CpG в качестве адъюванта, Пептид, происходящий из вируса гепатита В (аминокислоты 28-39 (IPQSLDSWWTSL)) конъюгировали с Qβ VLP или с CRM197 и использовали в качестве контрольного иммуногена.

Используемый метод ELISA немного отличался от метода, описанного в примере 3: Метод ELISA выполняли следующим образом для ELISA человеческого и мышиного PCSK9 (метод 2): на 384-луночные планшеты с высоким связыванием (Greiner bio-one 781061) наносили 25 мкл/лунку концентрата человеческого или мышиного белка PCSK9, разведенного до 1 мкг/мл 1×PBS рН 7,4, и инкубировали при 4°С в течение ночи. На следующие сутки планшеты блокировали, используя 25 мкл/лунку 1×PBS/0,05% Tween-20/1% БСА, инкубировали на качалке при к.т. в течение 1 часа. 10 точечное ½ log серийное разведение каждого образца готовили, начиная с разведения 1:50 или 1:500 (разбавитель 1×PBS/0,05% Tween-20), 25 мкл/лунку серийного разведения переносили в двух повторностях в планшет, покрытый человеческим или мышиным PCSK9, затем инкубировали при встряхивании при к.т. в течение 1 часа. После промывания × 3 1×PBS рН 7,4/0,05% Tween-20, добавляли 25 мкл/лунку общего детектирующего антитела IgG (козлиный антимышиный IgG (у), HRP, Invitrogen M30107) при разведении 1:3000 с 1×PBS рН 7,4/0,05% Tween-20, затем инкубировали при встряхивании при к.т. в течение 1 часа. После промывания × 5 1×PBS рН 7,4/0,05% Tween 20, добавляли 25 мкл/лунку набора Bio-Rad TMB Peroxidase EIA Substrate (Bio-Rad, кат. №172-1067) и планшеты инкубировали а течение 15 минут. Добавляли 12,5 мкл/лунку 1 н. серной кислоты и затем считывали поглощение при 450 нм.

Результаты: Пептиды VR_9.5 и 9.10, конъюгированные с Qβ VLP или CRM197, были способны индуцировать антительные ответы на интактный полноразмерный человеческий и мышиный белок PCSK9 (см. Фиг.11 и 12). На Фиг.13 и 14 и в Таблице 4 показано, что пептиды VR_9.5 и 9.10, конъюгированные с различными носителями, и в присутствии различных адъювантов приводят к снижению уровней холестерина в сыворотке.

Пример 8

Дополнительные пептиды (SEQ ID NO:312, 420, 421, 422, 423, 425, 426, 427, 428, 445, 482, 525 и 563) были выбраны из продомена и С-концевого участка каталитического домена PCSK9 для поверхностной экспозиции и ассоциации с мутациями приобретения функции или потери функции, идентифицированными у людей. Полученный ряд пептидных последовательностей из описанного выше подхода модифицировали путем добавления аминокислот для обеспечения химического конъюгирования и оценивали в качестве кандидатов на роль вакцины (Таблица 5, пептиды 9.23-9.35).

Таблица 5
Пептидные последовательности
Пептид Последовательность Вид SEQ ID NO:
VR_9.5 SIPWNLERITPC Человек 317
VR_9.10 SIPWNLERIIPC Мышь 322
VR_9.17 SIPWNLERIGGC Человек и мышь 401
VR_9.18 SIPWNLERGGC Человек и мышь 402
VR_9.19 SIPWNLEGGC Человек и мышь 403
VR_9.20 CGGSGRDAGVAKGA Человек 404
VR_9.21 CGGSGRDAGVAKGT Мышь 405
VR_9.22 RDAGVAKGGC Человек 406
VR_9.23 CSRHLAQASQELQ Человек 407
VR_9.24 CRSRPSAKASWVQ Мышь 408
VR_9.25 CGGDYEELVLALR Человек 409
VR_9.26 CGGDYEELMLALP Мышь 410
VR_9.27 LVLALRSEEDGGC Человек 411
VR_9.28 LMLALPSQEDGGC Мышь 412
VR_9.29 AKDPWRLPGGC Человек 413
VR_9.30 SKEAWRLPGGC Мышь 414
VR_9.31 CGGAARRGYLTK Человек 415
VR_9.32 CGGAARRGYVIK Мышь 416
VR_9.33 FLVKMSGDU-ELALKLPGGC Человек 417
VR_9.34 FLVKMSSDLLGLALKLPGGC Мышь 418
VR_9.35 CGGEEDSSVFAQ Человек 419
Подчеркнутые остатки указывают на аминокислоты, добавленные для целей конъюгирования.

Пример 9

Пептиды VR_9.17-VR_9.35 (а также VR_9.5) конъюгировали с Qβ VLP, как описано в примере 2, и использовали для иммунизации мышей и оценки антительных ответов на PCSK9, как описано в примере 3. Пептид, происходящий из вируса гепатита В (аминокислоты 28-39 (IPQSLDSWWTSL)) конъюгировали с Qβ VLP и использовали в качестве контрольного иммуногена. Метод №: 2 использовали для ELISA.

Результат: Как показано на Фиг.15 и 16, большинство пептидов, конъюгированных с Qβ VLP, были способны индуцировать антительные ответы на интактный полноразмерный PCSK9. Антительный ответ не обнаружили для пептидов 9.31 и 9.32. В некоторых случаях (пептиды 9.23, 9.24, 9.27, 9.28, 9.29, 9.30, 9.33 и 9.34) антительные ответы были видоспецифическими. Иммунизация пептидами 9.5, 9.18 и 9.29 также приводила к снижению холестерина в сыворотке, в то время как иммунизация пептидами 9.17, 9.19, 9.30, 9.31 и 9.32 приводила к тенденции снижения холестерина (Таблица 6, Фиг.17).

VR_9.19 VLP Квасцы+CpG 8 71,7 1,7 P>0,05 P>0,05
VR_9.20 VLP Квасцы+CpG 7 85,2 4,0 F>0,05 P>0,05
VR_9.21 VLP Квасцы+CpG 8 77,1 2,0 P>0,05 P>0,05
VR_9.22 VLP Квасцы+CpG 8 84,5 2,6 P>0,05 P>0,05
VR_9.23 VLP Квасцы+CpG 8 79,0 1,8 P>0,05 P>0,05
VR_9.24 VLP Квасцы+CpG 8 76,9 2,1 P>0,05 P>0,05
VR_9.25 VLP Квасцы+CpG 8 77,3 2,5 P>0,05 P>0,05
VR_9.26 VLP Квасцы+CpG 8 79,2 2,2 P>0,05 P>0,05
VR_9.27 VLP Квасцы+CpG 8 71,8 3,4 P>0,05 P>0,05
VR_9.28 VLP Квасцы+CpG 8 76,6 2,2 P>0,05 P>0,05
VR_9.29 VLP Квасцы+CpG 8 67,0 1,6 P<0,05 P>0,05
VR_9.30 VLP Квасцы+CpG 8 70,4 2,3 P>0,05 P>0,05
VR_9.31 VLP Квасцы+CpG 8 71,0 1,7 P>0,05 P>0,05
VR_9.32 VLP Квасцы+CpG 8 72,8 1,0 P>0,05 P>0,05
VR_9.33 VLP Квасцы+CpG 8 75,5 2,2 P>0,05 P>0,05
VR_9.34 VLP Квасцы+CpG 8 76,0 2,3 P>0,05 P>0,05
VR_9.35 VLP Квасцы+CpG 8 74,5 2,2 P>0,05 P>0,05
Статистика(a): однофакторный дисперсионный анализ ANOVA для статистического сравнения с помощью с помощью критерия Бонферрони (post-hoc), демонстрирующего р значения тестируемых групп по сравнению с необработанной группой.
Статистика(b): однофакторный дисперсионный анализ ANOVA для статистического сравнения с помощью критерия Бонферрони (post-hoc), демонстрирующего р значения тестируемых групп по сравнению контрольной пептидной группой.

Перечень последовательностей:

SEQ ID NO:1 IGASSDCSTCFVS SEQ ID NO:53 DGTRFHRQASKCDS
SEQ ID NO:2 IGASSDCSTCFV SEQ ID NO:54 DGTRFHRQASKCD
SEQ ID NO:3 IGASSDCSTCF SEQ ID NO:55 DGTRFHRQASKC
SEQ ID NO:4 IGASSDCSTC SEQ ID NO:56 DGTRFHRQASK
SEQ ID NO:5 IGASSDCST SEQ ID NO:57 DGTRFHRQAS
SEQ ID NO:6 IGASSDCS SEQ ID NO:58 DGTRFHRQA
SEQ ID NO:7 IGASSDC SEQ ID NO:59 DGTRFHRQ
SEQ ID NO:8 IGASSD SEQ ID NO:60 GTRFHRQASKCDS
SEQ ID NO:9 IGASS SEQ ID NO:61 GTRFHRQASKCD
SEQ ID NO:10 GASSDCSTCFVS SEQ ID NO:62 GTRFHRQASKC
SEQ ID NO:11 GASSDCSTCFV SEQ ID NO:63 GTRFHRQASK
SEQ ID NO:12 GASSDCSTCF SEQ ID NO:64 GTRFHRQAS
SEQ ID NO:13 GASSDCSTC SEQ ID NO:65 GTRFKRQA
SEQ ID NO:14 GASSDCST SEQ ID NO:66 GTRFHRQ
SEQ ID NO:15 GASSDCS SEQ ID NO:67 TRFHRQASKCDS
SEQ ID NO:16 GAS S DC SEQ ID NO:68 TRFHRQASKCD
SEQ ID NO:17 GASSD SEQ ID NO:69 TRFHRQASKC
SEQ ID NO:18 ASSDCSTCFVS SEQ ID NO:70 TRFHRQASK
SEQ ID NO:19 ASSDCSTCFV SEQ ID NO:71 TRFHRQAS
SEQ ID NO:20 ASSUCSTCF SEQ ID NO:72 TRFHRQA
SEQ ID NO:21 ASSDCSTC SEQ ID NO:73 TRFHRQ
SEQ ID NO:22 ASSDCST SEQ ID NO:74 RFHRQASKCDS
SEQ ID NO:23 ASSDCS SEQ ID NO:75 RFHRQASKCD
SEQ ID NO:24 ASS DC SEQ ID NO:76 RFHRQASKC
SEQ ID NO:25 SSDCSTCFVS SEQ ID NO:77 RFHRQASK
SEQ ID NO:26 SSDCSTCFV SEQ ID NO:78 RFHRQAS
SEQ ID NO:27 SSDCSTCF SEQ ID NO:79 RFHRQA
SEQ ID NO:28 SSDCSTC SEQ ID NO:80 RFHRQ
SEQ ID NO:29 SSDCST SEQ ID NO:81 FHRQASKCDS
SEQ ID NO:30 SSDCS SEQ ID NO:82 FHRQASKCD
SEQ ID NO:31 SDCSTCFVS SEQ ID NO:83 FHRQASKC
SEQ ID NO:32 SDCSTCFV SEQ ID NO:84 FHRQASK
SEQ ID NO:33 SDCSTCF SEQ ID NO:85 FHRQAS
SEQ ID NO:34 SDCSTC SEQ ID NO:86 FHRQA
SEQ ID NO:35 SDCST SEQ ID NO:87 HRQASKCDS
SEQ ID NO:36 DCSTCFVS SEQ ID NO:88 HRQASKCD
SEQ ID NO:37 DCSTCFV SEQ ID NO:89 HRQASKC
SEQ ID NO:38 DCSTCF SEQ ID NO:90 HRQASK
SEQ ID NO:39 DCSTC SEQ ID NO:91 HRQAS
SEQ ID NO:40 CSTCFVS SEQ ID NO:92 RQASKCDS
SEQ ID NO:41 CSTCFV SEQ ID NO:93 RQASKCD
SEQ ID NO:42 CSTCF SEQ ID NO:94 RQASKC
SEQ ID NO:43 STCFVS SEQ ID NO:95 RQASK
SEQ ID NO:44 STCFV SEQ ID NO:96 QASKCDS
SEQ ID NO:45 TCFVS SEQ ID NO:97 QASKCD
SEQ ID NO:46 EDGTRFHRQASKCDS SEQ ID NO:98 QASKC
SEQ ID NO:47 EDGTRFHRQASKCD SEQ ID NO:99 ASKCDS
SEQ ID NO:48 EDGTRFHRQASKC SEQ ID NO:100 ASKCD
SEQ ID NO:49 EDGTRFHRQASK SEQ ID NO:101 SKCDS
SEQ ID NO:50 EDGTRFHRQAS SEQ ID NO:102 SIQSDHREIEGRVM
SEQ ID NO:51 EDGTRFHRQA SEQ ID NO:103 SIQSDHREIEGRV
SEQ ID NO:52 EDGTRFHRQ SEQ ID NO:104 STQSDHREIEGR
SEQ ID NO:105 SIOSDHREIEG SEQ ID NO:156 SGRDAGVA
SEQ ID NO:106 SIQSDHREIE SEQ ID NO:157 GRDAGVAKGAS
SEQ ID NO:107 SIQSDHREI SEQ ID NO:158 GRDAGVAKGA
SEQ ID NO:108 IQSDHREIEGRVM SEQ ID NO:159 GRDAGVAKG
SEQ ID NO:109 IQSDHREIEGRV SEQ ID NO:160 GRDAGVAK
SEQ ID NO:110 IQSDHREIEGR SEQ ID NO:161 GRDAGVA
SEQ ID NO:111 IQSDHREIEG SEQ ID NO:162 RDAGVAKGAS
SEQ ID NO:112 IQSDHREIE SEQ ID NO:163 RDAGVAKGA
SEQ ID NO:113 IQSDHREI SEQ ID NO:164 RDAGVAKG
SEQ ID NO:114 QSDHREIEGRVM SEQ ID NO:165 RDAGVAK
SEQ ID NO:115 QSDHREIEGRV SEQ ID NO:166 RDAGVA
SEQ ID NO:116 QSDHREIEGR SEQ ID NO:167 DAGVAKGAS
SEQ ID NO:117 QSDHREIEG SEQ ID NO:168 DAGVAKGA
SEQ ID NO:118 QSDHREIE SEQ ID NO:169 DAGVAKG
SEQ ID NO:119 QSDHREI SEQ ID NO:170 DAGVAK
SEQ ID NO:120 SDHREIEGRVM SEQ ID NO:171 DAGVA
SEQ ID NO:121 SDHREIEGRV SEQ ID NO:172 AGVAKGAS
SEQ ID NO:122 SDHREIEGR SEQ ID NO:173 AGVAKGA
SEQ ID NO:123 SDHREIEG SEQ ID NO:174 AGVAKG
SEQ ID NO:124 SDHREIE SEQ ID NO:175 AGVAK
SEQ ID NO:125 SDHREI SEQ ID NO:176 GVAKGAS
SEQ ID NO:126 DHREIEGRVM SEQ ID NO:177 GVAKGA
SEQ ID NO:127 DHRETEGRV SEQ ID NO:178 GVAKG
SEQ ID NO:128 DHREIEGR SEQ ID NO:179 VAKGAS
SEQ ID NO:129 DHREIEG SEQ ID NO:180 VAKGA
SEQ ID NO:130 DHREIE SEQ ID NO:181 AKGAS
SEQ ID NO:131 DHREI SEQ ID NO:182 SIPWNLERITPPR
SEQ ID NO:132 HREIEGRVM SEQ ID NO:183 SIPWNLERITPP
SEQ ID NO:133 HREIEGRV SEQ ID NO:184 SIPWNLERITP
SEQ ID NO:134 HREIEGR SEQ ID NO:185 SIPWNLERIT
SEQ ID NO:135 HREIEG SEQ ID NO:186 SIPWNLERI
SEQ ID NO:136 HREIE SEQ ID NO:187 SIPWNLER
SEQ ID NO:137 RETEGRVM SEQ ID NO:188 SIPWNLE
SEQ ID NO:138 REIEGRV SEQ ID NO:189 SIPWNL
SEQ ID NO:139 REIEGR SEQ ID NO:190 SIPWN
SEQ ID NO:140 REIEG SEQ ID NO:191 IPWNLERITPPR
SEQ ID NO:141 EIEGRVM SEQ ID NO:192 IPWNLERITPP
SEQ ID NO:142 EIEGRV SEQ ID NO:193 IPWNLERITP
SEQ ID NO:143 EIEGR SEQ ID NO:194 IPWNLERIT
SEQ ID NO:144 IEGRVM SEQ ID NO:195 IPWNLERI
SEQ ID NO:145 IEGRV SEQ ID NO:196 IPWNLER
SEQ ID NO:146 EGRVM SEQ ID NO:197 IPWNLE
SEQ ID NO:147 VSGRDAGVAKGAS SEQ ID NO:198 IPWNL
SEQ ID NO:148 VSGRDAGVAKGA SEQ ID NO:199 PWNLERITPPR
SEQ ID NO:149 VSGRDAGVAKG SEQ ID NO:200 PWNLERITPP
SEQ ID NO:150 VSGRDAGVAK SEQ ID NO:201 PWNLERITP
SEQ ID NO:151 VSGRDAGVA SEQ ID NO:202 PWNLERIT
SEQ ID NO:152 SGRDAGVAKGAS SEQ ID NO:203 PWNLERI
SEQ ID NO:153 SGRDAGVAKGA SEQ ID NO:204 PWNLER
SEQ ID NO:154 SGRDAGVAKG SEQ ID NO:205 PWNLE
SEQ ID NO:155 SGRDAGVAK SEQ ID NO:206 WNLERITPPR
SEQ ID NO:207 WNLERITPP SEQ ID NO:258 PVTLGT
SEQ ID NO:208 WNLERITP SEQ ID NO:259 PVTLG
SEQ ID NO:209 WNLERIT SEQ ID NO:260 VTLGTL
SEQ ID NO:210 WNLERI SEQ ID NO:261 VTLGT
SEQ ID NO:211 WNLER SEQ ID NO:262 TLGTL
SEQ ID NO:212 NLERITPPR SEQ ID NO:263 INEAWFPEDQRVL
SEQ ID NO:213 NLERITPP SEQ ID NO:264 INEAWFPEDQRV
SEQ ID NO:214 NLERITP SEQ ID NO:265 INEAWFPEDQR
SEQ ID NO:215 NLERIT SEQ ID NO:266 INEAWFPEDQ
SEQ ID NO:216 NLERI SEQ ID NO:267 INEAWFPED
SEQ ID NO:217 LERITPPR SEQ ID NO:268 INEAWFPE
SEQ ID NO:218 LERITPP SEQ ID NO:269 INEAWFP
SEQ ID NO:219 LERITP SEQ ID NO:270 INEAWF
SEQ ID NO:220 LERIT SEQ ID NO:271 INEAW
SEQ ID NO:221 ERITPPR SEQ ID NO:272 NEAWFPEDQRVL
SEQ ID NO:222 ERITPP SEQ ID NO:273 NEAWFPEDQRV
SEQ ID NO:223 ERITP SEQ ID NO:274 NEAWFPEDQR
SEQ ID NO:224 RITPPR SEQ ID NO:275 NEAWFPEDQ
SEQ ID NO:225 RITPP SEQ ID NO:276 NEAWFPED
SEQ ID NO:226 ITPPR SEQ ID NO:277 NEAWFPE
SEQ ID NO:227 NAQDQPVTLGTL SEQ ID NO:278 NEAWFP
SEQ ID NO:228 NAQDQPVTLGT SEQ ID NO:279 NEAWF
SEQ ID NO:229 NAQDQPVTLG SEQ ID NO:280 EAWFPEDQRVL
SEQ ID NO:230 NAQDQPVTL SEQ ID NO:281 EAWFPEDQRV
SEQ ID NO:231 NAQDQPVT SEQ ID NO:282 EAWFPEDQR
SEQ ID NO:232 NAQDQPV SEQ ID NO:283 EAWFPEDQ
SEQ ID NO:233 NAQDQP SEQ ID NO:284 EAWFPED
SEQ ID NO:234 NAQDQ SEQ ID NO:285 EAWFPE
SEQ ID NO:235 AQDQPVTLGTL SEQ ID NO:286 EAWFP
SEQ ID NO:236 AQDQPVTLGT SEQ ID NO:287 AWFPEDQRVL
SEQ ID NO:237 AQDQPVTLG SEQ ID NO:288 AWFPEDQRV
SEQ ID NO:238 AQDQPVTL SEQ ID NO:289 AWFPEDQR
SEQ ID NO:239 AQDQPVT SEQ ID NO:290 AWFPEDQ
SEQ ID NO:240 AQDQPV SEQ ID NO:291 AWFPED
SEQ ID NO:241 AQDQP SEQ ID NO:292 AWFPE
SEQ ID NO:242 QDQPVTLGTL SEQ ID NO:293 WFPEDQRVL
SEQ ID NO:243 QDQPVTLGT SEQ ID NO:294 WFPEDQRV
SEQ ID NO:244 QDQPVTLG SEQ ID NO:295 WFPEDQR
SEQ ID NO:245 QDQPVTL SEQ ID NO:296 WFPEDQ
SEQ ID NO:246 QDQPVT SEQ ID NO:297 WFPED
SEQ ID NO:247 QDQPV SEQ ID NO:298 FPEDQRVL
SEQ ID NO:248 DQPVTLGTL SEQ ID NO:299 FPEDQRV
SEQ ID NO:249 DQPVTLGT SEQ ID NO:300 FPEDQR
SEQ ID NO:250 DQPVTLG SEQ ID NO:301 FPEDQ
SEQ ID NO:251 DQPVTL SEQ ID NO:302 PEDQRVL
SEQ ID NO:252 DQPVT SEQ ID NO:303 PEDQRV
SEQ ID NO:253 QPVTLGTL SEQ ID NO:304 PEDQR
SEQ ID NO:254 QPVTLGT SEQ ID NO:305 EDQRVL
SEQ ID NO:255 QPVTLG SEQ ID NO:306 EDQRV
SEQ ID NO:256 QPVTL SEQ ID NO:307 DQRVL
SEQ ID NO:257 PVTLGTL SEQ ID NO:308 VDYIEEDSSVFAQ
SEQ ID NO:309 RCAKDPWRLPGT SEQ ID NO:319 AGCGTRFHRQ
SEQ ID NO:310 AQAARRGYLTKIL SEQ ID NO:320 GRVCIQSDHREIE
SEQ ID NO:311 GDYEELVLALRSEEDG SEQ ID NO:321 AGVAKGAGCSGRD
SEQ ID NO:312 FLVKMSGDLLELALKLP SEQ ID NO:322 SIPWNLERIIPC
SEQ ID NO:313 KGGASSDCSTCFV SEQ ID NO:323 CGGSIPWNLERIIP
SEQ ID NO:314 CGGTRFHRQASKC SEQ ID NO:324 SIPWNLERIIPGGC
SEQ ID NO:315 CGIQSDHREIEGRVC SEQ ID NO:325 CGGNAQDQPVTLGTL
SEQ ID NO:316 CSGRDAGVAKGAC SEQ ID NO:326 NAQDQPVTLGTLGGC
SEQ ID NO:317 SIPWNLERITPC SEQ ID NO:327 CGGINMAWFPEDQQVL
SEQ ID NO:318 ASKCGDGTRFHRQ SEQ ID NO:328 NMAWFPEDQQVLGGC
SEQ ID NO:329 MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
SEQ ID NO:330 SIPWNLERIIPAW SEQ ID NO:369 NMAWFPEDQQVL
SEQ ID NO:331 SIPWNLERIIPA SEQ ID NO:370 NMAWFPEDQQV
SEQ ID NO:332 SIPWNLERIIP SEQ ID NO:371 NMAWFPEDQQ
SEQ ID NO:333 SIPWNLERII SEQ ID NO:372 NMAWFPEDQ
SEQ ID NO:334 IPWNLERIIPAW SEQ ID NO:373 NMAWFPED
SEQ ID NO:335 IPWNLERIIPAW SEQ ID NO:374 NMAWFPE
SEQ ID NO:336 IPWNLERTIP SEQ ID NO:375 NMAWFP
SEQ ID NO:337 IPWNLERII SEQ ID NO:376 NMAWF
SEQ ID NO:338 PWNLERIIPAW SEQ ID NO:377 MAWFPEDQQVL
SEQ ID NO:339 PWNLERII PA SEQ ID NO:378 MAWFPEDQQV
SEQ ID NO:340 PWNLERIIP SEQ ID NO:379 MAWFPEDQQ
SEQ ID NO:341 PWNLERII SEQ ID NO:380 MAWFPEDQ
SEQ ID NO:342 WNLERIIPAW SEQ ID NO:381 MAWFPED
SEQ ID NO:343 WNLERIIPA SEQ ID NO:382 MAWFPE
SEQ ID NO:344 WNLERIIP SEQ ID NO:383 MAWFP
SEQ ID NO:345 WNLERII SEQ ID NO:384 AWFPEDQQVL
SEQ ID NO:346 NLERIIPAW SEQ ID NO:385 AWFPEDQQV
SEQ ID NO:347 NLERIIPA SEQ ID NO:386 AWFPEDQQ
SEQ ID NO:348 NLERIIP SEQ ID NO:387 WFPEDQQVL
SEQ ID NO:349 NLERII SEQ ID NO:388 WFPEDQQV
SEQ ID NO:350 LERIIPAW SEQ ID NO:389 WFPEDQQ
SEQ ID NO:351 LERTIPA SEQ ID NO:390 FPEDQQVL
SEQ ID NO:352 LERITP SEQ ID NO:391 FPEDQQV
SEQ ID NO:353 LERII SEQ ID NO:392 FPEDQQ
SEQ ID NO:354 ERIIPAW SEQ ID NO:393 PEDQQVL
SEQ ID NO:355 ERIIPA SEQ ID NO:394 PEDQQV
SEQ ID NO:356 ERIIP SEQ ID NO:395 PEDQQ
SEQ ID NO:357 RIIPAW SEQ ID NO:396 EDQQVL
SEQ ID NO:358 RIIPA SEQ ID NO:397 EDQQV
SEQ ID NO:359 IIPAW SEQ ID NO:398 DQQVL
SEQ ID NO:360 INMAWFPEDQQVL
SEQ ID NO:361 INMAWFPEDQQV
SEQ ID NO:362 INMAWFPEDQQ
SEQ ID NO:363 INMAWFPEDQ
SEQ ID NO:364 INMAWFPED
SEQ ID NO:365 INMAWFPE
SEQ ID NO:366 INMAWFP
SEQ ID NO:367 INMAWF
SEQ ID NO:368 INMAW
SEQ ID NO:399 MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYWVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSTQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGELIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAKEPEDQRVLTPKLVAALPPSTHCAGWCLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGFAMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHKEVEDLGTHKPPVLRPRGQPNQCVGHREASJHASCCHAPGLECKVKEHGIFAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTCSTSEGAVTAVAICCRSRHLAQASQELQ
SEQ ID NO:400 MGTHCSAWLRWPLLFLLPPLLLLLLLLCPTGAGAODEUGDYEELMLALPSUEDGLADEAAHVATATFRRCGKEAWPLPGTYIVVLMEETQRLQIEQTAHRLQTRAARRGYVIKVLHIFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSFVFAQSIPWNLERIIPAWHQTEEDRSPDGSSQVEVYLLDTSIQGAHREIEGRVTITPFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNAACRHLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCFMSQSGTSQAAAHVAGIVARMLSREPTLTLAELRQRLIHFSTKDVTNMAWFPEDQQVITPNLVATLPFSTHETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGPRRGDWIEAIGGQQVCKALNAFGGEGVYAVARCCLVPRANCSTHNTPAARAGLETHVHCHQKDHVLTGCSFHWEVEDLSVRRQPALRSRRQPGQCVGHQAASVYASCCHAPGLFCKIKEHGTSGPSEQVTVACEAGWTLTGCNVLPGASLTLGAYSVDNLCVARVHDTARADRTSGEATVAAAICCRSRPSAKASWVQ
SEQ ID NO:401 SIPWNLERTGGC SEQ ID NO:434 RCAKDP
SEQ ID NO:402 SIPWNLERGGC SEQ ID NO:435 RCAKD
SEQ ID NO:403 SIPWNLEGGC SEQ ID NO:436 CAKDPWRLPGT
SEQ ID NO:404 CGGSGRDAGVAKGA SEQ ID NO:437 CAKDPWRLPG
SEQ ID NO:405 CGGSGRDAGVAKGT SEQ ID NO:438 CAKDPWRLP
SEQ ID NO:406 RDAGVAKGGC SEQ ID NO:439 CAKDPWRL
SEQ ID NO:407 CSRHLAQASQELQ SEQ ID NO:440 CAKDPWR
SEQ ID NO:408 CRSRPSAKASWVQ SEQ ID NO:441 CAKDPW
SEQ ID NO:409 CGGDYEELVLALR SEQ ID NO:442 CAKDP
SEQ ID NO:410 CGGDYEELMLALP SEQ ID NO:443 AKDPWRLPGT
SEQ ID NO:411 LVLALRSEEDGGC SEQ ID NO:444 AKDPWRLPG
SEQ ID NO:412 LMLALPSQEDGGC SEQ ID NO:445 AKDPWRLP
SEQ ID NO:413 AKDPWRLPGGC SEQ ID NO:446 AKDPWRL
SEQ ID NO:414 SKEAWRLPGGC SEQ ID NO:447 AKDPWR
SEQ ID NO:415 CGGAARRGYLTK SEQ ID NO:448 AKDPW
SEQ ID NO:416 CGGAARRGYVIK SEQ ID NO:449 KDPWRLPGT
SEQ ID NO:417 FLVKMSGDLLELALKLPGGC SEQ ID NO:450 KDPWRLPG
SEQ ID NO:418 FLVKMSSDLLGLALKLPGGC SEQ ID NO:451 KDPWRLP
SEQ ID NO:419 CGGEEDSSVFAQ SEQ ID NO:452 KDPWRL
SEQ ID NO:420 SRHLAQASQELQ SEQ ID NO:453 KDPWR
SEQ ID NO:421 DYEELVLALR SEQ ID NO:454 DPWRLPGT
SEQ ID NO:422 LVLALRSEEDG SEQ ID NO:455 DPWRLFG
SEQ ID NO:423 EEDSSVFAQ SEQ ID NO:456 DPWRLP
SEQ ID NO:424 SGRDAGVAKGT SEQ ID NO:457 DPWRL
SEQ ID NO:425 RSRPSAKASWVQ SEQ ID NO:458 PWRLPGT
SEQ ID NO:426 GDYEELMLALP SEQ ID NO:459 PWRLPG
SEQ ID NO:427 LMLALPSQED SEQ ID NO:460 PKRLP
SEQ ID NO:428 FLVKMSSDLLGLALKLP SEQ ID NO:461 WRLPGT
SEQ ID NO:429 RCAKDFWRLPG SEQ ID NO:462 WRLPG
SEQ ID NO:430 RCAKDPWRLP SEQ ID NO:464 AQAARRGYLTKT
SEQ ID NO:431 RCAKDPWRL SEQ ID NO:465 AQAARRGYLTK
SEQ ID NO:432 RCAKDPWR SEQ ID NO:466 AQAARRGYLT
SEQ ID NO:433 RCAKDPW SEQ ID NO:467 AQAARRGYL
SEQ ID NO:468 AQAARRGY SEQ ID NO:519 CSKEAWRL
SEQ ID NO:469 AQAARRG SEQ ID NO:520 CSKEAWR
SEQ ID NO:470 AQAARR SEQ ID NO:521 CSKEAW
SEQ ID NO:471 AQAAR SEQ ID NO:522 CSKEA
SEQ ID NO:472 QAARRGYLTKIL SEQ ID NO:523 SKEAWRLPGT
SEQ ID NO:473 QAARRGYLTKI SEQ ID NO:524 SKEAWRLPG
SEQ ID NO:474 QAARRGYLTK SEQ ID NO:525 SKEAWRLP
SEQ ID NO:475 QAARRGYLT SEQ ID NO:526 SKEAWRL
SEQ ID NO:476 QAARRGYL SEQ ID NO:527 SKEAWR
SEQ ID NO:477 QAARRGY SEQ ID NO:528 SKEAW
SEQ ID NO:478 QAARRG SEQ ID NO:529 KEAWRLPGT
SEQ ID NO:479 QAARR SEQ ID NO:530 KEAWRLPG
SEQ ID NO:480 AARRGYLTKIL SEQ ID NO:531 KEAWRLP
SEQ ID NO:481 AARRGYLTKI SEQ ID NO:532 KEAWRL
SEQ ID NO:482 AARRGYLTK SEQ ID NO:533 KEAWR
SEQ ID NO:483 AARRGYLT SEQ ID NO:534 EAWRLPGT
SEQ ID NO:484 AARRGYL SEQ ID NO:535 EAWRLPG
SEQ ID NO:485 AARRGY SEQ ID NO:536 EAWRLP
SEQ ID NO:486 AARRG SEQ !D NO:537 EAWRL
SEQ ID NO:487 ARRGYLTKIL SEQ ID NO:538 AWRLPGT
SEQ ID NO:488 ARRGYLTKI SEQ ID NO:539 AWRLPG
SEQ ID NO:489 ARRGYLTK SEQ ID NO:540 AWRLP
SEQ ID NO:490 ARRGYLT SEQ ID NO:541 WRLPGT
SEQ ID NO:491 ARRGYL SEQ ID NO:542 WRLPG
SEQ ID NO:492 ARRGY SEQ ID NO:543 RLPGT
SEQ ID NO:493 RRGYLTKIL SEQ ID NO:544 TRAARRGYVIKVL
SEQ ID NO:494 RRGYLTKI SEQ ID NO:545 TRAARRGYVIKV
SEQ ID NO:495 RRGYLTK SEQ ID NO:546 TRAARRGYVIK
SEQ ID NO:496 RRGYLT SEQ ID NO:547 TRAARRGYVI
SEQ ID NO:497 RRGYL SEQ ID NO:548 TRAARRGYV
SEQ ID NO:498 RGYLTKTL SEQ ID NO:549 TRAARRGY
SEQ ID NO:499 RGYLTKI SEQ ID NO:550 TRAARRG
SEQ ID NO:500 RGYLTK SEQ ID NO:551 TRAARR
SEQ ID NO:501 RGYLT SEQ ID NO:552 TRAAR
SEQ ID NO:502 GYLTKIL SEQ ID NO:553 RAARRGYVIKVL
SEQ ID NO:503 GYLTKI SEQ ID NO:554 RAARRGYVIKV
SEQ ID NO:504 GYLTK SEQ ID NO:555 RAARRGYVIK
SEQ ID NO:505 YLTKIL SEQ ID NO:556 RAARRGYVI
SEQ ID NO:506 YLTKI SEQ ID NO:557 RAARRCYV
SEQ ID NO:507 LTKIL SEQ ID NO:558 PAARRGY
SEQ ID NO:508 RCSKEAWRLPGT SEQ ID NO:559 RAARRG
SEQ ID NO:509 RCSKEAWRLPG SEQ ID NO:560 RAARR
SEQ ID NO:510 RCSKEAWRLP SEQ ID NO:561 AARRGYVIKVL
SEQ ID NO:511 RCSKEAWRL SEQ ID NO:562 AARRGYVI KV
SEQ ID NO:512 RCSKEAWR SEQ ID NO:563 AAPRGYVIK
SEQ ID NO:513 RCSKEAW SEQ ID NO:564 AARRGYVI
SEQ ID NO:514 RCSKEA SEQ ID NO:565 AARRGYV
SEQ ID NO:515 RCSKE SEQ ID NO:566 AARRGY
SEQ ID NO:516 CSKEAWRLPGT SEQ ID NO:567 AARRG
SEQ ID NO:517 CSKEAWRLPG SEQ ID NO:568 ARRGYVTKVL
SEQ ID NO:518 CSKEAWRLP SEQ ID NO:569 ARRGYVIKV
SEQ ID NO 570 ARRGYVIK
SEQ ID NO:571 ARRGYVI
SEQ ID NO:572 ARRGYV
SEQ ID NO:573 ARRGY
SEQ ID NO:574 RRGYVIKVL
SEQ ID NO:575 RRGYVIKV
SEQ ID NO:576 RRGYVIK
SEQ ID NO:577 RRGYVI
SEQ ID NO:578 RRGYV
SEQ ID NO:579 RGYVIKVL
SEQ ID NO:580 RGYVIKV
SEQ ID NO:581 RGYVIK
SEQ ID NO:582 RGYVI
SEQ ID NO:583 GYVTKVL
SEQ ID NO:584 GYVIKV
SEQ ID NO:585 GYVIK
SEQ ID NO:586 YVIKVL
SEQ ID NO:587 YVIKV
SEQ ID NO:588 VIKVL
SEQ ID NO:589 TCGTCGTTTTTCGGTGCTTTT
SEQ ID NO:590 TCGTCGTTTTTCGGTCGTTTT
SEQ ID NO:591 TCGTCGTTTTGTCGTTTTGTCGTT
SEQ ID NO:592 TCGTCGTTTCGTCGTTTTGTCGTT
SEQ ID NO:593 TCGTCGTTTTGTCGTTTTTTTCGA
SEQ ID NO:594 TCGCGTCGTTCGGCGCGCGCCG
SEQ ID NO:595 TCGTCGACGTTCGGCGCGCGCCG
SEQ ID NO:596 TCGGACGTTCGGCGCGCGCCG
SEQ ID NO:597 TCGGACGTTCGGCGCGCCG
SEQ ID NO:598 TCGCGTCGTTCGGCGCGCCG
SEQ ID NO:599 TCGACGTTCGGCGCGCGCCG
SEQ ID NO:600 TCGACGTTCGGCGCGCCG
SEQ ID NO:601 TCGCGTCGTTCGGCGCCG
SEQ ID NO:602 TCGCGACGTTCGGCGCGCGCCG
SEQ ID NO:603 TCGTCGTTTTCGGCGCGCGCCG
SEQ ID NO:604 TCGTCGTTTTCGGCGGCCGCCG
SEQ ID NO:605 TCGTCGTTTTACGGCGCCGTGCCG
SEQ ID NO:606 TCGTCGTTTTCGGCGCGCGCCGT
SEQ ID NO:607 TCGTCGACGATCGGCGCGCGCCG

1. Иммуноген для индуцирования иммунного ответа против белка PCSK9, содержащий антигенный пептид PCSK9, выбранный из группы, состоящей из SEQ ID NO: 182, 183, 184, 185, 186, 187, 188, 317, 401, 402 и 403, где указанный антигенный пептид PCSK9 конъюгирован с иммуногенным носителем, выбранным из CRM197 или Qbeta вирусоподобной частицы (VLP).

2. Иммуноген для индуцирования иммунного ответа против белка PCSK9, содержащий антигенный пептид PCSK9, выбранный из группы, состоящей из SEQ ID NO: 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 314, 318 и 319, где указанный антигенный пептид PCSK9 конъюгирован с иммуногенным носителем, выбранным из CRM197 или Qbeta VLP.

3. Иммуноген по п.1, где антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO: 182-188.

4. Иммуноген по п.2, где антигенный пептид PCSK9 выбран из группы, состоящей из SEQ ID NO: 46-73.

5. Иммуноген по п.3 или 4, где указанный антигенный пептид PCSK9 дополнительно содержит любой из следующих:
на своем С-конце линкер, имеющий формулу (G)nC, (G)nSC или (G)nK, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10,
на своем N-конце линкер, имеющий формулу C(G)n, CS(G)n или K(G)n, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10, или
на своем С-конце линкер, имеющий формулу (G)nC, (G)nSC или (G)nK, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10, и на своем N-конце линкер, имеющий формулу C(G)n, CS(G)n или K(G)n, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10.

6. Иммуноген по п.3 или 4, где указанный антигенный пептид PCSK9 дополнительно содержит любой из следующих:
на своем С-конце линкер, имеющий формулу (G)nC, (G)nSC или (G)nK, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1 или 2,
на своем N-конце линкер, имеющий формулу C(G)n, CS(G)n или K(G)n, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1 или 2, или
на своем С-конце линкер, имеющий формулу (G)nC, (G)nSC или (G)nK, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1 или 2, и на своем N-конце линкер, имеющий формулу C(G)n, CS(G)n или K(G)n, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1 или 2.

7. Иммуноген по п.3 или 4, где указанный антигенный пептид PCSK9 дополнительно содержит цистеин на своем С-конце.

8. Иммуноген по п.3 или 4, где указанный антигенный пептид PCSK9 дополнительно содержит группу CG или цистеин на своем N-конце.

9. Иммуноген по п.3 или 4, где указанный антигенный пептид PCSK9 дополнительно содержит CGG на своем N-конце.

10. Иммуноген по п.3 или 4, где указанный антигенный пептид PCSK9 дополнительно содержит GGC на своем С-конце.

11. Иммуноген по п.1 или 2, где указанный антигенный пептид PCSK9 циклизован и содержит цистеин, (G)nC- или С(G)n-фрагмент, где n представляет собой целое число, выбранное из группы, состоящей из 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 и 10.

12. Иммуноген по п.1 или 2, где указанный антигенный пептид PCSK9 циклизован и содержит цистеин, GC- или CG-фрагмент.

13. Иммуноген по п.1 или 2, где указанный антигенный пептид PCSK9 дополнительно содержит KG или KGG на своем N-конце.

14. Иммуноген по п.1 или 2, где антигенный пептид PCSK9 конформационно ограничен.

15. Композиция для индуцирования иммунного ответа против белка PCSK9, содержащая по меньшей мере два иммуногена в иммунологически эффективных количествах, где первый иммуноген представляет собой иммуноген по п.1.

16. Композиция для индуцирования иммунного ответа против белка PCSK9, содержащая по меньшей мере два иммуногена в иммунологически эффективных количествах, где первый иммуноген представляет собой иммуноген по п.2.

17. Композиция для индуцирования иммунного ответа против белка PCSK9, содержащая по меньшей мере два иммуногена в иммунологически эффективных количествах, где первый иммуноген представляет собой иммуноген по п.1, и где второй иммуноген представляет собой иммуноген по п.2.

18. Композиция по п.17, где антигенный пептид PCSK9 в первом иммуногене выбран из группы, состоящей из SEQ ID NO: 182, 183, 184, 185, 186, 187 и 188, и где антигенный пептид PCSK9 во втором иммуногене выбран из группы, состоящей из SEQ ID NO: 67, 68, 69, 70, 71, 72 и 73.

19. Иммуногенная композиция для индуцирования иммунного ответа против белка PCSK9, содержащая композицию иммуногенов в иммунологически эффективных количествах по п.17, дополнительно содержащая по меньшей мере один адъювант.

20. Иммуногенная композиция по п.19, где указанный адъювант выбран из квасцов, CpG ODN (олигодезоксинуклеотид), QS21 и Iscomatrix.

21. Иммуногенная композиция по п.19, где указанный адъювант выбран из QS21, квасцов в комбинации с CpG ODN или Iscomatrix в комбинации с CpG ODN.

22. Иммуногенная композиция по п.19, где указанный адъювант выбран из квасцов в комбинации с CpG ODN.

23. Иммуногенная композиция по п.19, где CpG ODN выбран из:
5' TCGTCGI I I I ICGGTGCTTTT 3', или
5' TCGTCG I I I I ICGGTCGTTTT 3', или
5' TCGTCGTTTTGTCGTTTTGTCGTT 3'.

24. Фармацевтическая композиция, предназначенная для предупреждения, лечения или облегчения PCSK9-связанных расстройств, содержащая:
в терапевтически эффективном количестве иммуноген по п.1 или 2, композицию по п.17 или иммуногенную композицию по п.19; и
фармацевтически приемлемый эксципиент.



 

Похожие патенты:

Изобретение относится к пиразолопиридиновым производным формулы (I), фармацевтической композиции на их основе, и их применению для лечения и/или профилактики нарушений или состояний, связанных с никотинамидадениндинуклеотидфосфатоксидазой (НАДФН-оксидазой), а также к способу их получения и интермедиату формулы (VIII).
Изобретение относится к медицине, а именно к эндокринологии, и может быть использовано для лечения неалкогольного жирового гепатоза при сахарном диабете 2 типа. Заявляемый препарат мексикор обеспечивает снижение проявлений цитолиза и холестаза, уменьшение индекса стеатоза, позволяет улучшить метаболические липидные и гликемические показатели и снизить инсулинорезистентность.
Фармацевтическая композиция содержит алеглитазар или его натриевую соль в дозе от 0,01 до 0,9 мг. Фармацевтическая композиция алеглитазара применяется для лечения или профилактики диабета типа II или сердечно-сосудистых заболеваний.

Изобретение относится к области биотехнологии. Охарактеризовано применение терапевтически эффективного количества пептида GGF2, содержащего домен, подобный эпидермальному фактору роста (EGF-подобный), в лечении или профилактике сердечной недостаточности у млекопитающего путем инъекции указанного пептида каждые 48 часов дозой, составляющей от приблизительно 0,001 мг/кг до приблизительно 10 мг/кг.

Изобретение относится к производным фенола формулы (1), где R1 представляет собой С1-С6 алкильную группу, С1-С6 алкинильную группу, С1-С6 галогеналкильную группу, С1-С6 алкилсульфанильную группу или атом галогена, R2 представляет собой циано группу или атом галогена, R3 представляет собой атом водорода, и Х представляет собой -S(=O)2.

Группа изобретений относится к композициям, содержащим вазоактивный интестинальный пептид (VIP) или его фрагменты, и к применению таких композиций в лечении фиброза аорты.

Настоящее изобретение относится к области фармацевтики и представляет собой фармацевтическую композицию для парентерального введения, включающую субмикронные частицы сложного эфира докозагексаеновой кислоты, диспергированные в водной фазе с использованием смеси по меньшей мере двух сурфактантов, выбранных из а) по меньшей мере одного полиоксиэтиленового эфира жирной кислоты и b) по меньшей мере одного производного фосфолипида, а также способ получения указанной фармацевтической композиции.

Настоящее изобретение относится к области иммунологии. Предложен слитый белок - антагонист Notch1, который состоит из Fc-области человека, слитой с EGF-подобным повтором 1-13 Notch1 или EGF-подобным повтором 1-24 Notch1.

Изобретение относится к новым соединениям общей формулы (1), которые обладают сродством к µ-опиоидному рецептору и ORL1-рецептору. Изобретение также относится к применению этих соединений для получения лекарственных средств, которые могут быть использованы при лечении страха, стресса и связанных со стрессом синдромов, депрессий, эпилепсии, болезни Альцгеймера, старческого слабоумия, общих познавательных дисфункций, нарушений обучения и памяти (как ноотроп), синдромов отмены, злоупотребления алкоголем и/или наркотиками и/или злоупотребления медикаментами и/или алкогольной, наркотической, медикаментозной зависимости и др.

Изобретение относится к би- и полициклическим замещенным изохинолину и изохинолинонам формулы (I), или к его стереоизомерным и/или таутомерным формам и/или к его фармацевтически приемлемым солям, где R1 представляет собой ОН; R3, R4, R5 и R8 представляют собой Н; R7 представляет собой галоген или (C1-C6) алкил; R6 представляет собой один (С1-С4) алкилен, присоединенный к циклоалкильному кольцу, в котором (С1-С4)алкилен образует вторую связь с другим атомом углерода циклоалкильного кольца с образованием бициклической кольцевой системы, где в бициклической кольцевой системе один атом углерода замещен группой, независимо выбираемой из О, S или SO2; или если m и s равны 2 или m равно 3 и s равно 1, R6 представляет собой группу СН2-СН-(СН2)2, которая через одну группу СН2 присоединена к циклоалкильному кольцу, а две другие группы СН2 присоединены к различным атомам углерода циклоалкильного кольца, и если m равно 3 и s равно 3, R6 представляет собой две метиленовые группы, присоединенные к различным атомам углерода циклоалкильного кольца, где метиленовые группы или группа СН2-СН-(СН2)2 присоединены к атомам углерода циклоалкильного кольца и образуют систему адамантана формулы , где L может быть присоединен к любому вторичному или третичному атому углерода, или R6 вместе с R11 и атомом N образуют (С5) гетероциклоалкил, который соединен с циклоалкильным остатком в виде спироциклической кольцевой системы, где бициклическая кольцевая система, или система адамантана, или содержащая (С5) гетероциклоалкил кольцевая система представляют собой незамещенные или необязательно замещенные заместителем R9; R9 представляет собой (C1-C6)алкил, (С2-С6)алкенил, (С6)арил или циклопропил; R11 и R12 независимо друг от друга представляют собой Н или (C1-C6)алкилен-(C6)арил; n равно 0 или 1; m равно 2 или 3; s равно 1, 2 или 3; L представляет собой О; его стереоизомерные и/или таутомерные формы и/или его фармацевтически приемлемые соли.
Изобретение относится к медицине, а именно к акушерству и гинекологии, и может быть использовано для лечения и тактики ведения беременных с лекарственным гепатитом.

Изобретение относится к медицине, а именно к терапии и инфекционным болезням, и может быть использовано для профилактики и лечения бронхиальной астмы, осложняющих ее респираторных вирусных инфекций и других воспалительных заболеваний дыхательных путей.

Изобретение относится к пептидным производным общей формулы (I), их стереоизомерам, их смесям и/или их фармацевтически приемлемым солям, к способам их получения, к фармацевтическим композициям, содержащим их, и к применению их для лечения, предупреждения и/или диагностики тех состояний, расстройств и/патологий, при которых экспрессируются соматостатиновые рецепторы sstr1, sstr2, sstr3, sstr4 и/или sstr5.

Группа изобретений относится к медицине и касается способов лечения дефицита гормона роста или инсулиноподобного фактора роста 1 у пациента, включающих введение иммуногенного количества вакцины, содержащей химерный полипептид соматостатина-14, связанный с инактивированной хлорамфениколацетилтрансферазой (САТ), и адъювант; вакцины для лечения пациента, имеющего дефицит гормона роста или инсулиноподобного фактора роста 1; способа лечения ожирения у пациента, включающего введение иммуногенного количества вакцины.

Предложены: композиция для лечения рака, включающая (а) конъюгат, содержащий (i) полипетидный вектор, содержащий аминокислотную последовательность, имеющую по меньшей мере 70%-ную идентичность по отношению к AngioPep-2 (SEQ ID NO: 97); и (ii) паклитаксел или аналог паклитаксела, конъюгированные с указанным полипетидом; (б) необязательный агент, регулирующий тоничность; (в) буферный агент; (г) наполнитель; (д) полиоксиэтиленовый эфир жирной кислоты; и (е) 0,01-8% DMSO (варианты), способы ее получения (варианты), способ лечения рака, контейнер, содержащий указанную композицию и набор, включающий контейнер с данной композицией.

Изобретение относится к применению пептида, имеющего последовательность, имеющую происхождение из аминокислотной последовательности белка SNAP-25, для лечения боли и/или воспаления.

Группа изобретений относится к области фармакологии и медицины и касается пролонгированной доставки аналога компстатина, и также, возможно, дополнительного активного агента, при высвобождении его из макроскопического гелеподобного включения, формирующегося при введении жидкого состава, содержащего аналог компстатина, во внесосудистое пространство, такое как стекловидная камера глазного яблока, в теле млекопитающего.

Группа изобретений относится к медицине и фармацевтике и касается способа лечения мезотелиомы плевры путем введения конъюгата, содержащего нацеливающий пептид, содержащий мотив NGR и цитокин, представляющий собой TNF, выбранный из группы, состоящей из TNFα, TNFβ, а также относится к фармацевтическому составу, содержащему указанный конъюгат, растворенный в подходящих буферах.

Группа изобретений относится к биохимии. Предложены соединения лабиринтопептинов А1, А2, или А3 формулы (I), где {A}, {B}, {C}, R1-R6, m и n имеют значения, указанные в формуле изобретения.

Изобретение относится к медицине, а именно к дерматологии и стоматологии, и может быть использовано для лечения красного плоского лишая слизистой оболочки полости рта.
Группа изобретений относится к фармацевтической промышленности, в частности к композициям для лечения и/или предупреждения ожирения. Композиция включает пептидное соединение Pro-Val-Asn-Phe-Lys-Phe-Leu-Ser-His в воде, содержащей раствор солей в физиологически приемлемой концентрации.
Наверх