Аналоги оксинтомодулина

Изобретение относится к пептидным аналогам оксинтомодулина (ОХМ, глюкагон-37), которые были модифицированы для придания устойчивости к расщеплению и инактивации дипептидилпептидазой IV (DPP-IV) и для увеличения времени полужизни in vivo пептидного аналога наряду с предоставлением возможности пептидному аналогу действовать в виде двойного агониста GLP-1/глюкагонового рецептора (GCGR). Пептидные аналоги применимы для лечения метаболических нарушений, таких как диабет и ожирение. 3 н. и 13 з.п. ф-лы, 16 ил., 11 табл., 12 пр.

 

ПЕРЕКРЕСТНЫЕ ССЫЛКИ НА РОДСТВЕННЫЕ ЗАЯВКИ

Данная заявка на патент является частичным продолжением Международной заявки на патент №PCT/US2009/034448, зарегистрированной 19 февраля 2009, содержание которой включено в изобретение полностью.

ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ

(1) Область изобретения

Данное изобретение относится к пептидным аналогам оксинтомодулина (ОХМ, глюкагон-37), которые были модифицированы для придания устойчивости к расщеплению и инактивации дипептидилпептидазой IV (DPP-IV) и для увеличения времени полужизни in vivo пептидного аналога, наряду с предоставлением возможности пептидному аналогу действовать в виде двойного агониста рецептора GLP-1 (глюкагон-подобного петида-1)/глюкагонового рецептора (GCGR) и применения таких пептидных аналогов для лечения метаболических нарушений, таких как диабет и ожирение.

(2) Описание родственного уровня техники

Гормон оксинтомодулин (ОХМ, глюкагон-37) является посттрансляционным продуктом процессинга препроглюкагона в кишечнике и центральной нервной системе (ЦНС) и секретируется из L-клеток в кишку в ответ на прием пищи. Открытый в 1983 году, ОХМ был вовлечен в регуляцию приема пищи и потребление энергии (Jarrouse et al., Endocrinol. 115: 102-105 (1984); Schjoldager et al., Eur. J. Clin. Invest., 18: 499-503 (1988)). Центральное или периферическое введение ОХМ крысам вызывает снижение потребления пищи в короткий срок с минимальными эффектами при опорожнении желудка (Dakin et al. Endocrinology, 142: 4244-4250 (2001), Dakin et al. Endocrinology, 145: 2687-2695 (2004)). Повторное интрацеребровентрикулярное введение ОХМ крысам приводит к повышенным внутренним температурам и сниженной прибавки в весе по сравнению с получающими одинаковое кормление животными, давая возможность предполагать наличие эффектов как на калорийность потребляемой пищи, так и на расход энергии (Dakin et al. Am. J. Physiol. Endocrinol. Metab., 283: E1173-E1177 (2002)).

В родственных исследованиях периферическое введение ОХМ дозозависимо ингибировало как быстро индуцированное (поглощение пищи), так и поглощение пищи в темновой период, но, в отличие от GLP-1, не влияло на эффект опорожнения желудка. ОХМ также снижал уровни грелина натощак и повышал c-fos иммунореактивность в аркуатных (дугообразных) ядрах (ARC). Повторное семидневное IP (внутрибрюшинное) введение ОХМ вызвало снижение увеличения массы тела и ожирения у крыс (см. Dakin et al. Endocrinology, 145: 2687-2695 (2004)).

Изучение действия ОХМ на мышах показало, что хотя ОХМ может активировать как глюкагоновые рецепторы, так и рецепторы GLP-1 (пер., глюкагоноподобного пептида-1), для анорексического действия ОХМ требуется только рецептор GLP-1, поскольку интрацеребровентрикулярный ОХМ ингибирует поглощение пищи у мышей с нокаутом (гена) глюкагонового рецептора. Однако анорексические эффекты ОХМ полностью отсутствуют у мышей с нокаутом (гена) рецептора GLP-1. Кроме того, эксендин-4, но не ОХМ, регулирует потребление энергии у мышей. Следовательно, ОХМ, по-видимому, является слабым агонистом рецептора GLP-1 при использовании в фармакологических концентрациях (см. Baggio et al., Gastroenterol. 127: 546-58 (2004)). Также было обнаружено, что ОХМ улучшает нарушение толерантности к глюкозе у мышей, которых кормили рационом с высоким содержанием жиров (Dakin et al., Am. J. Physiol. Endocrinol. Metab. 294: E142-E147 (2008)) и повышает собственную частоту сердечных сокращений у мышей независимо от рецептора GLP-1 (Sowden et al., Am. J. Physiol. Regul. Integr. Сотр. Physiol. 292: R962-R970 (2007)). Также было показано, что ОХМ избирательно влиял на рекрутирование бета-аррестина рецептором GLP-1 и на передачу сигнала через Galpha (Jorgensen et al., J. Pharma. Exp. Therapeut. 322: 148-154 (2007)) и избирательно влиял на активацию гипоталамических нейронов после периферического введения ОХМ (Choudhri et al., Biochem. Biophys. Res. Commun. 350: 298-306 (2006)).

На людях, единственная 90-минутная внутривенная инфузия ОХМ здоровым пациентам с нормальным весом снижала шкалу голода и поглощение пищи при питании по типу шведский стол приблизительно на 19%. Кумулятивная двенадцатичасовая калорийность потребляемой пищи была снижена приблизительно на 11% без каких-либо сообщений о тошноте или изменениях вкусовой привлекательности пищи (Cohen et al., J. Clin. Endocrinol. Metab., 88: 4696-4701 (2003); Lykkegaard et al., ADA Scientific Sessions, Abstract #1506-P (2003)). Совсем недавно препрандиальные инъекции ОХМ на протяжении четырех недель у тучных здоровых добровольцев (BMI (пер., индекс массы тела) приблизительно 33) приводили к существенному снижению калорийности потребляемой пищи в первый день лечения (приблизительно на 25%), которое поддерживалось на протяжении всего курса исследования (35%-ное снижение после четырех недель) (Wynne et al., Diabetes 54: 2390-2395 (2005)). Устойчивую потерю веса наблюдали в конце исследования у леченых пациентов (1,9%, с учетом коррекции на возможный плацебо-эффект). Уровни ОХМ в плазме были аналогичны уровням, наблюдаемым в исследовании инфузии (максимальная концентрация приблизительно 950 пМ). Отсутствие какой-либо тахифилаксии и низкая частота легкой и кратковременной тошноты (приблизительно 3%), несмотря на относительно высокие дозы, необходимые в связи с низкой стабильностью ОХМ in vivo (t1/2 в плазме <12 минут), превращает этот гормон в один из немногих мишеней ожирения как для подтверждения на людях, так и для привлекательного профиля переносимости.

ОХМ имеет очень короткое время полужизни и быстро инактивируется поверхностно-клеточной дипептидилпептидазой IV (DPP-IV) (Zhu et al., J. Biol. Chem. 278: 22418-22423 (2002)). Однако ингибиторы DPP-IV являются нейтральными в отношении веса в клинических исследованиях, давая возможность предположить, что такие сверхфизиологические уровни ОХМ (900-1000 пМ) могут потребоваться для достижения потери веса у людей. Пептидные аналоги ОХМ для стимулирования потери веса у людей стали объектом опубликованной международной заявки №№ WO 03/022304, WO 2004/062685 и WO 2006/134340.

Таким образом, ОХМ демонстрирует потенциал в качестве лечения метаболических нарушений, таких как диабет и ожирение. Однако, вследствие плохой стабильности ОХМ in vivo, существует потребность в создании аналогов ОХМ, которые могут быть безопасно и эффективно введены для лечения метаболических нарушений, таких как диабет и ожирение. Кроме того, было бы желательно, если бы были разработаны аналоги или производные, которые были бы модифицированы путем конъюгации с молекулами, которые улучшили бы стабильность и фармакокинетику, более конкретные модификации, которые придают устойчивость к расщеплению DPP-IV. Кроме того, было бы желательно обеспечить аналоги ОХМ, которые способны действовать в виде двойных агонистов рецептора GLP-1/глюкагонового рецептора.

КРАТКОЕ ИЗЛОЖЕНИЕ ИЗОБРЕТЕНИЯ

Данное изобретение обеспечивает пептидные аналоги оксинтомодулина (ОХМ, глюкагон-37), которые были модифицированы для придания устойчивости к расщеплению и инактивации дипептидилпептидазой IV (DPP-IV) и для увеличения времени полужизни in vivo пептидного аналога, наряду с предоставлением возможности пептидному аналогу действовать в виде двойного агониста рецептора GLP-1/глюкагона (GCGR), и применение таких пептидных аналогов для лечения метаболических нарушений, таких как диабет и ожирение. В частности, описанные здесь аналоги снижают потребление пищи и массу тела, повышают скорость метаболизма, опосредуют глюкозозависимую секрецию инсулина (GDIS) из панкреатических островков (пер., островков Лангерганса) и улучшают толерантность к глюкозе, посредством чего обеспечивают режим лечения индивидуумов, страдающих от метаболического нарушения, такого как метаболический синдром, ожирение, диабет, метаболический синдром X, гипергликемия, нарушенная гликемия натощак, дислипидемия, атеросклероз и другие предиабетические состояния.

Таким образом, данное изобретение обеспечивает пептид, содержащий аминокислотную последовательность человеческого оксинтомодулина (ОХМ), показанную в SEQ ID NO:1, где вторую аминокислоту с N-конца замещают аминокислотой, которая придает пептиду устойчивость к расщеплению и инактивации дипептидилпептидазой IV, пептид включает в себя молекулу липида или холестерина, ковалентно связанную с пептидом; пептид необязательно включает в себя от одной до трех аминокислотных замен в дополнение к замене в положении 2 и пептид необязательно включает в себя защитную группу, которую, если присутствует, присоединяют к С-концевой карбоксильной группе пептида; причем пептид способен действовать в виде двойного агониста рецептора GLP-1 и глюкагонового рецептора и имеет время полужизни в сыворотке большее, чем время полужизни человеческого ОХМ, и его фармацевтически приемлемые соли. В дополнительных аспектах аминокислота, используемая вместо второй аминокислоты с N-конца, выбрана из группы, состоящей из D-серина и α-аминоизомасляной кислоты.

Дополнительно обеспечивают пептид, содержащий аминокислотную последовательность человеческого оксинтомодулина (ОХМ), показанную в SEQ ID NO:1, где вторую аминокислоту с N-конца замещают аминокислотой, выбранной из группы, состоящей из D-серина и α-аминоизомасляной кислоты; С-конец пептида включает в себя цистеиновый остаток, в котором тиольную группу цистеинового остатка ковалентно связывают с молекулой холестерина гидрофильным линкером; пептид необязательно включает в себя от одной до трех аминокислотных замен в дополнение к замене в положении 2 и пептид необязательно включает в себя защитную группу, которую, если присутствует, присоединяют к С-концевой карбоксильной группе пептида; причем пептид действует в виде двойного агониста рецептора GLP-1 и глюкагонового рецептора и имеет время полужизни в сыворотке большее, чем время полужизни человеческого ОХМ, и его фармацевтически приемлемые соли.

Дополнительно обеспечивают пептид, содержащий аминокислотную последовательность человеческого оксинтомодулина (ОХМ), показанную в SEQ ID NO:1, где вторую аминокислоту с N-конца замещают аминокислотой, которая придает пептиду устойчивость к расщеплению и инактивации дипептидилпептидазой IV, пептид включает в себя молекулу липида или холестерина, ковалентно связанную с пептидом; пептид включает в себя одну или несколько аминокислотных замен, выбранных из группы, состоящей из положений 17, 18 и 27; и пептид необязательно включает в себя защитную группу, которую, если присутствует, присоединяют к С-концевой карбоксильной группе пептида; причем пептид действует в виде двойного агониста рецептора GLP-1 и глюкагонового рецептора и имеет время полужизни в сыворотке большее, чем время полужизни человеческого ОХМ, и его фармацевтически приемлемые соли. В дополнительных аспектах одна или несколько аминокислотных замен выбраны из группы, состоящей из глутаминовой кислоты для аргинина в положении 17, аланина для аргинина в положении 18, норлейцина или О-метил-L-гомосерина для метионина в положении 27.

Дополнительно обеспечивают пептид, содержащий аминокислотную последовательность человеческого оксинтомодулина (ОХМ), показанную в SEQ ID NO:1, где вторую аминокислоту с N-конца замещают аминокислотой, которая придает пептиду устойчивость к расщеплению и инактивации дипептидилпептидазой IV, пептид включает в себя молекулу липида или холестерина, ковалентно связанную с пептидом; пептид необязательно включает в себя от одной до трех аминокислотных замен в дополнение к замене в положении 2; пептид не имеет аминокислотной последовательности RNRNNIA (SEQ ID NO:104) и пептид необязательно включает в себя защитную группу, которую, если присутствует, присоединяют к С-концевой карбоксильной группе пептида; причем пептид действует в виде двойного агониста рецептора GLP-1 и глюкагонового рецептора и имеет время полужизни в сыворотке большее, чем время полужизни человеческого ОХМ, и его фармацевтически приемлемые соли.

В дополнительных аспектах аминокислотная замена в положении 2 является аминокислотой, выбранной из группы, состоящей из D-серина и α-аминоизомасляной кислоты, и молекула холестерина ковалентно связана с тиольной группой цистеина гидрофильным линкером и цистеиновый остаток ковалентно связан с С-концом пептида пептидной связью. В дополнительных аспектах пептид дополнительно включает в себя одну или несколько аминокислотных замен в положениях аминокислот, выбранных из группы, состоящей из положений 17, 18 и 27. В дополнительных аспектах пептид дополнительно включает в себя одну или несколько аминокислотных замен, выбранных из группы, состоящей из аргинина в положении 17 на глутаминовую кислоту, аргинина в положении 18 на аланин, метионина в положении 27 на норлейцин или О-метил-L-гомосерин.

В дополнительных аспектах любого из вышеуказанных пептидов пептид включает в себя молекулу холестерина, ковалентно связанную с тиольной группой цистеинового остатка на С-конце пептида. В конкретных аспектах молекула холестерина ковалентно связана с тиольной группой гидрофильным линкером. Гидрофильный линкер может быть пептидом или полимером, таким как этоксиполимер (ethoxy polymer), который включает в себя от одного до десяти этокси-звеньев. В дополнительных аспектах гидрофильный линкер представляет собой этоксиполимер, который включает в себя четыре этокси-звена. В других аспектах пептида пептид включает в себя липидную молекулу, ковалентно связанную ε-аминогруппой остатка лизина, ковалентно связанного с С-концом пептида, который в конкретных вариантах является пальмитоилом. В дополнительных вариантах осуществления остаток лизина связан с С-концом пептида посредством линкерной молекулы. В конкретных аспектах линкерная молекула включает в себя одну или несколько остатков гамма-глутаминовой кислоты, и в других аспектах линкерная молекула является 1-амино-4,7,10-тиокса-13-тридеканамин янтарной кислотой

Дополнительно обеспечивают пептидный аналог ОХМ, выбранный из пептидных аналогов, представлены в таблице 1 и таблице 2, и применение одного или нескольких пептидных аналогов ОХМ, представленных в таблице 1 и таблице 2, в производстве лекарственного средства для лечения метаболического нарушения.

Дополнительно обеспечивают пептидный аналог, содержащий структуру

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTK (SEQ ID NO:106),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовую кислоту (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновую кислоту (Аср) или 1-амино-1-циклопентан-карбоновую кислоту (Асре); Х2 означает Ser (серин) (S) или Lys (лизин) (K); Х3 означает Ser (серин) (S) или Glu (глутаминовую кислоту) (Е); Х4 означает остаток аргинина (R) или остаток глутаминовой кислоты (Е); Х5 означает остаток аргинина (R) или аланина (А); Х6 означает Gln (глютамин) (Q) или Lys (лизин) (K); Х7 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1, необязательно, но если присутствует, является аминокислотной последовательностью RNRNNIA (SEQ ID NO:104) или линкерной молекулой; Z2 необязательно, но если присутствует, является остатком лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина; и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его (пептидного аналога) фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р (пептида), или с аминокислотой, расположенной внутри Р.

В дополнительных аспектах вышеуказанных пептидов Z2 является цистеиновым остатком, который в частных вариантах осуществления может быть ковалентно связан своей тиольной группой с молекулой холестерина или с липидной молекулой. В других вариантах молекула холестерина или липидная молекула ковалентно связана с тиольной группой цистеина гидрофильным линкером. В частных аспектах гидрофильный линкер является этоксиполимером, который включает в себя от одного до двадцати четырех этокси-звеньев или, в более конкретных аспектах, гидрофильный линкер является этоксиполимером, который включает в себя четыре этокси-звена.

В дополнительных аспектах вышеуказанных пептидов Z2 является остатком лизина, у которого в частных вариантах осуществления ε-аминогруппа лизина ковалентно связана с молекулой холестерина или с липидной молекулой или непосредственно, или посредством гидрофильного линкера. В частных вариантах осуществления липидная молекула является пальмитоилом.

В дополнительных аспектах вышеуказанных пептидов L1 является линкерной молекулой. В частных аспектах линкерная молекула является гидрофильной линкерной молекулой. Еще в дополнительных аспектах линкерная молекула содержит одну или несколько остатков гамма-глутаминовой кислоты, и в других аспектах линкерная молекула является 1-амино-4,7,10-тиокса-13-тридеканамином янтарной кислоты (1-amino-4,7,10-tioxa-13-tridecanamine succinimic acid).

В частных вариантах осуществления вышеуказанного пептида пептид содержит структуру, выбранную из ОХМ70 (SEQ ID NO:12); ОХМ110 (SEQ ID NO:19); OXM115 (SEQ ID NO:21); OXM177 (SEQ ID NO:24); OXM212 (SEQ ID NO:27); OXM213 (SEQ ID NO:28); OXM216 (SEQ ID NO:29); OXM290 (SEQ ID NO:46); OXM301 (SEQ ID NO:51) или ОХМ325 (SEQ ID NO:65). В дополнительных частных вариантах осуществления вышеуказанного пептида пептид содержит структуру, выбранную из ОХМ237 (SEQ ID NO:31); ОХМ238 (SEQ ID NO:32); OXM259 (SEQ ID NO:33); OXM260 (SEQ ID NO:34); OXM261 (SEQ ID NO:35); OXM262 (SEQ ID NO:36); OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OXM265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44) и ОХМ308 (SEQ ID NO:45).

В частных вариантах осуществления вышеуказанного пептида, когда пептид не имеет RNRNNIA (SEQ ID NO:104), пептид содержит структуру, выбранную из ОХМ291 (SEQ ID NO:47); ОХМ292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO:52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:54); OXM305 (SEQ ID NO:55); OXM311 (SEQ ID NO:56); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID N0-58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66) или OXM329 (SEQ ID NO:67).

В дополнительных частных вариантах осуществления, когда пептид не имеет RNRNNIA (SEQ ID NO:104), пептид содержит структуру, выбранную из ОХМ345 (SEQ ID NO:69); ОХМ355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM407 (SEQ ID NO:88); OXM408 (SEQ ID NO:89); OXM410 (SEQ ID NO:91); OXM411 (SEQ ID NO:92); OXM412 (SEQ ID NO:93); OXM414 (SEQ ID NO:95); OXM415 (SEQ ID NO:96); OXM416 (SEQ ID NO:97; OXM417 (SEQ ID NO:98); OXM418 (SEQ ID NO:99; OXM419 (SEQ ID NO:100; OXM420 (SEQ ID NO:101) или ОХМ421 (SEQ ID NO:102).

Дополнительно обеспечивают пептидный аналог, содержащий структуру

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTK (SEQ ID NO:106),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовую кислоту (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновую кислоту (Аср) или 1-амино-1-циклопентан-карбоновую кислоту (Асре); Х2 означает Ser (серин) (S) или Lys (лизин) (K); Х3 означает Ser (серин) (S) или Glu (глутаминовую кислоту) (Е); Х4 означает остаток аргинина (R) или остаток глутаминовой кислоты (Е); Х5 означает остаток аргинина (R) или аланина (А); Х6 означает Gln (глютамин) (Q) или Lys (лизин) (K); Х7 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1, необязательно, но если присутствует, является линкерной молекулой; Z2 необязательно, но если присутствует, является остатком лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина; и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его (пептидного аналога) фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р (пептида) или с аминокислотой, расположенной внутри Р.

В дополнительных аспектах вышеуказанных пептидов Z2 является цистеиновым остатком, который в частных вариантах осуществления может быть ковалентно связан своей тиольной группой с молекулой холестерина или с липидной молекулой. В других вариантах молекула холестерина или липидная молекула ковалентно связана с тиольной группой цистеина гидрофильным линкером. В частных аспектах гидрофильный линкер является этоксиполимером, который включает в себя от одного до двадцати четырех этокси-звеньев или, в более конкретных аспектах, гидрофильный линкер является этоксиполимером, который включает в себя четыре этокси-звена.

В дополнительных аспектах вышеуказанных пептидов Z2 является остатком лизина, у которого в частных вариантах осуществления ε-аминогруппа лизина ковалентно связана с молекулой холестерина или с липидной молекулой или непосредственно, или посредством гидрофильного линкера. В частных вариантах осуществления липидная молекула является пальмитоилом.

В дополнительных аспектах вышеуказанных пептидов L1 является линкерной молекулой. В частных аспектах линкерная молекула является гидрофильной линкерной молекулой. Еще в дополнительных аспектах линкерная молекула содержит одну или несколько остатков гамма-глутаминовой кислоты, и в других аспектах линкерная молекула является 1-амино-4,7,10-тиокса-13-тридеканамином янтарной кислоты.

В частных вариантах осуществления вышеуказанного пептида пептид содержит структуру, выбранную из ОХМ291 (SEQ ID NO:47); ОХМ292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO:52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:54); OXM305 (SEQ ID NO:55); OXM311 (SEQ ID NO:56); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO:58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66) или ОХМ329 (SEQ ID NO:67).

В дополнительных частных вариантах пептид содержит структуру, выбранную из ОХМ345 (SEQ ID NO:69); ОХМ355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM407 (SEQ ID NO:88); OXM408 (SEQ ID NO:89); OXM410 (SEQ ID NO:91); OXM411 (SEQ ID NO:92); OXM412 (SEQ ID NO:93); OXM414 (SEQ ID NO:95); OXM415 (SEQ ID NO:96); OXM416 (SEQ ID NO:97; OXM417 (SEQ ID NO:98); OXM418 (SEQ ID NO:99; OXM419 (SEQ ID NO:100; OXM420 (SEQ ID NO:101) или ОХМ421 (SEQ ID NO:102).

Дополнительно обеспечивают пептидный аналог, содержащий структуру

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTKRNRNNIA (SEQ ID NO:107),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (alb), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовую кислоту (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновую кислоту (Аср) или 1-амино-1-циклопентан-карбоновую кислоту (Асре); Х2 означает Ser (серин) (S) или Lys (лизин) (K); Х3 означает Ser (серин) (S) или Glu (глутаминовую кислоту) (Е); Х4 означает остаток аргинина (R) или остаток глутаминовой кислоты (Е); Х5 означает остаток аргинина (R) или аланина (А); Х6 означает Gln (глютамин) (Q) или Lys (лизин) (K); Х7 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1, необязательно, но если присутствует, является линкерной молекулой; Z2 необязательно, но если присутствует, является остатком лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина; и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его (пептидного аналога) фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р (пептида) или с аминокислотой, расположенной внутри Р.

В дополнительных аспектах вышеуказанных пептидов Z2 является цистеиновым остатком, который в частных вариантах осуществления может быть ковалентно связан своей тиольной группой с молекулой холестерина или с липидной молекулой. В других вариантах молекула холестерина или липидная молекула ковалентно связана с тиольной группой цистеина гидрофильным линкером. В частных аспектах гидрофильный линкер является этоксиполимером, который включает в себя от одного до двадцати четырех этокси-звеньев или, в более конкретных аспектах, гидрофильный линкер является этоксиполимером, который включает в себя четыре этокси-звена.

В дополнительных аспектах вышеуказанных пептидов Z2 является остатком лизина, у которого в частных вариантах осуществления ε-аминогруппа лизина ковалентно связана с молекулой холестерина или с липидной молекулой или непосредственно, или посредством гидрофильного линкера. В частных вариантах осуществления липидная молекула является пальмитоилом.

В дополнительных аспектах вышеуказанных пептидов L1 является линкерной молекулой. В частных аспектах линкерная молекула является гидрофильной линкерной молекулой. Еще в дополнительных аспектах линкерная молекула содержит одну или несколько остатков гамма-глутаминовой кислоты, и в других аспектах линкерная молекула является 1-амино-4,7,10-тиокса-13-тридеканамином янтарной кислоты.

В частных вариантах осуществления вышеуказанного пептида пептид содержит структуру, выбранную из ОХМ290 (SEQ ID NO:46); ОХМ301 (SEQ ID NO:51); OXM321 (SEQ ID NO:63); OXM325 (SEQ ID NO:65) или ОХМЗЗО (SEQ ID NO:68).

В дополнительных частных вариантах осуществления вышеуказанного пептида пептид содержит структуру, выбранную из ОХМ70 (SEQ ID NO:12); OXM110 (SEQ ID NO:19); OXM115 (SEQ ID NO:21); OXM177 (SEQ ID NO:24); OXM212 (SEQ ID NO:27); OXM213 (SEQ ID NO:28) или ОХМ216 (SEQ ID NO:29).

В дополнительных частных вариантах осуществления вышеуказанного пептида пептид содержит структуру, выбранную из ОХМ237 (SEQ ID N0.31); ОХМ238 (SEQ ID NO:32); OXM259 (SEQ ID NO:33); OXM260 (SEQ ID NO:34); OXM261 (SEQ ID NO:35); OXM262 (SEQ ID NO:36); OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OXM265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44) и ОХМ308 (SEQ ID NO:45).

Дополнительно обеспечивают пептидные аналоги, которые являются двойным агонистом рецептора GLP-1/глюкагона (GCGR) и имеют pI менее 6,0. Было обнаружено, что пептидные аналоги, содержащие молекулу холестерина или жирной кислоты и имеющие pI менее 6,0, имели пониженную способность стимулировать дегрануляцию тучных клеток, как определено в анализе селективности и специфичности препарата in vitro с использованием клеточной линии тучных клеток LAD2. Таким образом, дополнительно обеспечивают пептидный аналог, содержащий аминокислотную последовательность HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO:109), в которой вторую аминокислоту с N-конца пептида замещают аминокислотой, которая придает пептиду устойчивость к расщеплению и инактивации дипептидилпептидазой IV; пептид включает в себя молекулу липида или холестерина, ковалентно связанную с пептидом спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты; пептид необязательно включает в себя от одной до трех аминокислотных замен в дополнение к замене в положении 2; и пептид необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой пептида; причем пептидный аналог имеет pI менее чем 6,0 и является двойным агонистом рецептора GLP-1 и глюкагонового рецептора, и его фармацевтически приемлемые соли. В частных аспектах пептидные аналоги имеют pI между 4 и 6 или pI приблизительно 5,0, например pI приблизительно 5,4.

В дополнительных аспектах аминокислота для замены второй аминокислоты с N-конца пептидного аналога выбрана из группы, состоящей из D-серина, α-аминоизомасляной кислоты и 1-амино-1-циклобутан-карбоновой кислоты (1-amino-1-cyclobutane carboxylic acid).

В частных аспектах пептидный аналог включает в себя молекулу холестерина, ковалентно связанную с тиольной группой цистеинового остатка, который ковалентно связан с ε-аминогруппой остатка лизина на С-конце пептидного аналога спейсером, содержащим одну или несколько остатков гамма-глутаминовой кислоты. В дополнительном варианте молекула холестерина ковалентно связана с тиольной группой гидрофильным линкером, который в частных вариантах является этоксиполимером, который включает в себя от одного до двенадцати этокси-звеньев, например этоксиполимер, который включает в себя четыре этокси-звена.

В частных аспектах пептидный аналог включает в себя липидную молекулу, ковалентно связанную с ε-аминогруппой остатка лизина: в частных вариантах осуществления липидная молекула является жирной кислотой, такой как молекула пальмитоила, миристоила или стеароила. В дополнительном варианте липидная молекула ковалентно связана с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты. В дополнительном варианте липидная молекула ковалентно связана с ε-аминогруппой остатка лизина на С-конце одним или несколькими остатками гамма-глутаминовой кислоты. В дополнительном варианте липидная молекула ковалентно связана с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты и остаток лизина связан с лизинговым остатком на С-конце одним или несколькими остатками гамма-глутаминовой кислоты.

В дополнительных аспектах пептидный аналог дополнительно включает в себя одну или несколько аминокислотных замен в аминокислотных положениях, выбранных из группы, состоящей из положений 10, 12, 16, 17, 18 и 27. В частных вариантах осуществления пептидный аналог включает в себя одну или несколько аминокислотных замен, выбранных из группы, состоящей из лизина для тирозина в положении 10, серина для лизина в положении 12, глутаминовой кислоты или α-аминоизомасляной кислоты для серина в положении 16, глутаминовой кислоты для аргинина в положении 17, аланина для аргинина в положении 18, лизина для глутамина в положении 20 и норлейцина или O-метил-L-гомосерина для метионина в положении 27.

В дополнительном варианте тирозин в положении 10 в пептидном аналоге заменяют лизином и липидную молекулу ковалентно связывают с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты. В другом варианте глутамин в положении 20 в пептидном аналоге заменяют лизином и липидную молекулу ковалентно связывают с ε-аминогруппой лизина одним или несколькими остатками гамма-глутаминовой кислоты. В другом варианте пептидный аналог дополнительно включает в себя один или несколько остатков гамма-глутаминовой кислоты, ковалентно связанных с С-концом.

Дополнительно обеспечивают пептидный аналог, содержащий структуру

Z1-P-M-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTKX9X10 (SEQ ID NO:110),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовую кислоту (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновую кислоту (Аср) или 1-амино-1-циклопентан-карбоновую кислоту (Асре); Х2 означает остаток тирозина (Y) или лизина (K); Х3 означает остаток серина (S) или лизина (K); Х4 означает остаток серина (S), α-аминоизомасляной кислоты (aib) или глутаминовой кислоты (Е); Х5 означает остаток аргинина (R) или глутаминовой кислоты (Е); Х6 означает остаток аргинина (R) или аланина (А); Х7 означает остаток глутамина (Q) или лизина (K); Х8 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о); Х9 означает остаток гамма-глутаминовой кислоты (yGlu); X10 означает остаток гамма-глутаминовой кислоты (yGlu) или отсутствует; Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, М означает (i) цистеиновый остаток, ковалентно связанный с молекулой холестерина гидрофильным линкером, (ii) остаток лизина, ковалентно связанный с липидной молекулой спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты, или (iii) липидную молекулу, причем М ковалентно связан с С-концевой или с расположенной внутри Р (пептида) аминокислотой спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты; и Z2 означает необязательно присутствующую защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли, причем пептидный аналог или его соль имеет pI менее чем 6,0 и является двойным агонистом рецептора GLP-1 и агонистом глюкагонового рецептора. В частных аспектах пептидные аналоги имеют pI между 4 и 6, или pI приблизительно 5,0; 5,1; 5,2; 5,3; 5,4; 5,5; 5,6; 5,7; 5,8 или 5,9, или pI приблизительно 5,4-5,5.

В дополнительных аспектах пептидного аналога М означает цистеиновый остаток, ковалентно связанный с молекулой холестерина гидрофильным линкером и цистеиновый остаток связан с С-концом Р (пептида). В дополнительных вариантах гидрофильный линкер является этоксиполимером, который включает в себя от одного до двадцати четырех этокси-звеньев, который в конкретных аспектах может включать в себя, например, четыре этокси-звена.

В дополнительных аспектах М означает остаток лизина, ковалентно связанный с липидной молекулой спейсером, содержащим один или несколько остатков - гамма-глутаминовой кислоты и остаток лизина, связанный с С-концом Р или М, означает остаток лизина, ковалентно связанный с липидной молекулой спейсером, содержащим один или несколько остатков - гамма-глутаминовой кислоты, и остаток лизина находится в положении Х2 или Х7 (пептида) Р. В конкретных аспектах липидная молекула является молекулой пальмитоила, миристоила или стеароила.

В частных аспектах пептидный аналог означает ОХМ317 (SEQ ID NO:60); ОХМ318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66) или ОХМ329 (SEQ ID NO:67). В дополнительных аспектах пептидный аналог означает ОХМ345 (SEQ ID NO:69); ОХМ355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM407 (SEQ ID NO:88); OXM408 (SEQ ID NO:89); OXM410 (SEQ ID NO:91); OXM411 (SEQ ID NO:92); OXM412 (SEQ ID NO:93); OXM414 (SEQ ID NO:95); OXM415 (SEQ ID NO:96); OXM416 (SEQ ID NO:97; OXM417 (SEQ ID NO:98); OXM418 (SEQ ID NO:99; OXM419 (SEQ ID NO:100; OXM420 (SEQ ID NO:101) или ОХМ421 (SEQ ID NO:102).

Дополнительно обеспечивают применение любого из вышеуказанных пептидов и их фармацевтически приемлемые соли в производстве лекарственного средства для лечения нарушения обмена веществ.

Определения

Агонист GLP-1 представляет собой пептид, небольшую молекулу или химическое соединение, которое связывается с рецептором GLP-1 и стимулирует одну и ту же биологическую активность, что и GLP-1. В одном варианте осуществления изобретения агонист рецептора GLP-1 связывается с рецептором, по меньшей мере, с 1%-ной аффинностью, как и природный GLP-1. В другом варианте агонист рецептора GLP-1 связывается с рецептором с равной или большей аффинностью, чем природный GLP-1.

Агонист глюкагона представляет собой пептид, небольшую молекулу или химическое соединение, которое связывается с глюкагоновым рецептором и стимулирует одну и ту же биологическую активность, что и глюкагон. В одном варианте осуществления изобретения агонист глюкагонового рецептора связывается с рецептором по меньшей мере с 1%-ной аффинностью, как и природный глюкагон. В другом варианте агонист глюкагонового рецептора связывается с рецептором с равной или большей аффинностью, чем природный глюкагон.

В применении здесь "двойной агонист рецептора GLP-1/глюкагон " означает "молекулу ко-агониста рецептора GLP1/глюкагонового рецептора", которая обнаруживает активность как с глюкагоновым рецептором, так и с рецептором GLP1. В целом, двойной агонист рецептора GLP1 и агонист глюкагонового рецептора обнаруживает по меньшей мере приблизительно 10%-ную активность с глюкагоновым рецептором относительно природного глюкагона и также обнаруживает по меньшей мере приблизительно 10%-ную активность с рецептором GLP-1 относительно природного GLP-1.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Фиг.1 демонстрирует результаты анализа ex vivo при сравнении гликогенолиза природного ОХМ с OXM(Q3E). Фигура показывает, что природный ОХМ индуцирует гликогенолиз в зависимости от дозы и индуцирует полный гликогенолиз при 1,5 нМ и имеет ЕС50 (пер., эффективную концентрацию агониста, вызывающую полумаксимальный эффект) приблизительно 0,5 нМ, тогда как OXM-Q3E индуцировал только приблизительно 58% при 300 нМ, согласующуюся с его низкой активностью агониста GCGR.

Фиг.2 демонстрирует результаты эксперимента оккупации рецептора GCG in vivo, показывающие, что глюкагон (GCG) при 1,5 мг/кг давал 84% оккупации GCGR и ОХМ 3 мг/кг давал 31% оккупации GCGR, но что OXM-Q3E давал 0% оккупации GCGR.

Фиг.3А и 3В демонстрируют уровни глюкозы в крови и скорости инфузии глюкозы, соответственно, в ответ на ОХМ и OXM-Q3E.

Фиг.4 демонстрирует результаты теста на толерантность к внутрибрюшинно (i.p.) вводимой глюкозе (IPGTT) на тощих мышах при подкожном (s.c.) введении ОХМ и OXM-Q3E.

Фиг.5А демонстрирует измерение ex vivo гликогенолиза в перфузированной печени в присутствии ОХМ70, ОХМ110, ОХМ177, ОХМ115 и ОХМ216.

Фиг.5В демонстрирует оккупацию GGCR после подкожного (s.c.) или внутривенного (i.v.) введения ОХМ70, ОХМ110, ОХМ177, ОХМ115 и ОХМ216 по сравнению с природным ОХМ в конкурентном анализе у мышей дикого типа.

Фиг.6 суммирует высокую эффективность ОХМ70 in vivo на снижение поглощения пищи и массы тела у устойчивых мышей DIO. Поглощение пищи измеряли приблизительно через два часа и спустя 18 часов. Также измеряли изменения массы тела через 18 часов (в течение ночи) (*Р<0,05 против наполнителя, n=5-6 на группу).

Фиг.7 суммирует высокую эффективность ОХМ110 и ОХМ177 in vivo на снижение поглощения пищи и массы тела у устойчивых мышей DIO. Поглощение пищи измеряли приблизительно через два часа и спустя 18 часов. Также измеряли изменения массы тела через 18 часов (в течение ночи) (*Р<0,05 против наполнителя, n=5-6 на группу).

Фиг.8 суммирует высокую эффективность ОХМ216, ОХМ115 и ОХМ177 in vivo на снижение поглощения пищи и массы тела у устойчивых мышей DIO. Поглощение пищи измеряли приблизительно через два часа и спустя 18 часов. Также измеряли изменения массы тела через 18 часов (в течение ночи) (*Р<0,05 против наполнителя, n=5-6 на группу).

Фиг.9A-D демонстрируют фармакологические конечные точки изучения хронической массы тела и поглощения пищи у мышей DIO для пептидных аналогов ОХМ ОХМ110, ОХМ177 и ОХМ115. Фиг.9А демонстрирует кумулятивные изменения поглощения пищи. Фиг.9 В демонстрирует кумулятивные изменения массы тела. Фиг.9С демонстрирует уровни базальной глюкозы в течение нескольких дней исследования. Фиг.9D демонстрирует анализ IPGTT на 13-й день исследования.

Фиг.10 демонстрирует результаты теста на толерантность к внутрибрюшинно (i.p.) вводимой глюкозе (IPGTT) на тощих мышах при подкожном введении ОХМ70.

Фиг.11 демонстрирует результаты теста на толерантность к внутрибрюшинно (i.p.) вводимой глюкозе (IPGTT) на тощих мышах при подкожном введении ОХМ110.

Фиг.12 демонстрирует результаты теста на толерантность к внутрибрюшинно (i.p.) вводимой глюкозе (IPGTT) на тощих мышах при подкожном введении ОХМ177.

Фиг.13 демонстрирует результаты теста на толерантность к внутрибрюшинно (i.p.) вводимой глюкозе (IPGTT) на тощих мышах при подкожном введении ОХМ115.

Фиг.14А демонстрирует эффекты ОХМ115 на уровень метаболизма у мышей DIO на протяжении периода времени.

Фиг.14В демонстрирует процентное изменение уровня метаболизма, вызываемое ОХМ115 у мышей DIO.

Фиг.15 суммирует высокую эффективность in vivo нескольких +/+ пептидов на снижение поглощения пищи и массы тела у устойчивых мышей DIO.

Фиг.16 демонстрирует однократную дозу нескольких +/+ пептидов на снижение поглощения пищи и массы тела у устойчивых мышей DIO.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Терапия на основе ОХМ имеет потенциал для благоприятного влияния как на ожирение, так и, что еще должно быть тщательно охарактеризовано, на сопутствующие эффекты на улучшение диабета. Эффективность потери веса и снижение поглощения пищи при периферическом введении ОХМ были хорошо установлены на людях (Wynne et at., Diabetes 54: 2390-2395 (2005)). Совсем недавно было показано, что ОХМ повышает скорость метаболизма и конкретно обусловленные активностью энергетические расходы у страдающих ожирением субъектов (Wynne et al., Int. J. Obes. 30: 1729-1736 (2006), предварительная публикация в Интернете, April 18, 2006; doi:10.1038/sj.ijo.0803344). Также было показано, что ОХМ снижает массу тела у людей (см., например, опубликованные международные заявки на патент №№ WO 03/022304, WO 2004/062685 и WO 2006/134340); однако эффекты пептида ОХМ и сходных двойных агонистов рецептора GLP-1/глюкагонового рецептора (GLP-1R/GCGR) на гликемический контроль независимо от потери веса не были систематически изучены. Способность ОХМ оказывать агонистическую активность как на глюкагоновый рецептор, так и на рецептор GLP-1 делает ОХМ привлекательным кандидатом для лечения метаболических заболеваний, в случае, когда желательно, чтобы лечение положительно взаимодействовало непосредственно с глюкагоновыми и GLP-1 рецепторами.

ОХМ (и GLP-1) имеют очень короткое время полужизни и быстро инактивируются поверхностно-клеточной дипептидилпептидазой IV (DPP-IV). Мутации могут быть включены в пептид ОХМ для придания пептиду устойчивости к расщеплению DPP-IV; однако было также обнаружено, что многие из этих мутаций инактивировали природный пептид или негативно сказывались на способности пептида взаимодействовать с глюкагоновым рецептором (GCGR) или с рецептором GLP-1 (GLP-1 R) (см. опубликованную международную заявку на патент №W02007/100535, включенную в изобретение полностью). ОХМ (и GLP-1) также быстро выводится почками. Конъюгирование пептидов с объемными заместителями, такими как полиэтиленгликоль, может снижать почечный клиренс пептида; однако было обнаружено, что при включении этих объемных заместителей в пептид ОХМ многие из полученных пептидных аналогов ОХМ имели пониженную способность или не обладали способностью эффективно взаимодействовать с глюкагоновым рецептором. Прежде чем могут быть выдвинуты эффективные способы лечения метаболических заболеваний на основе введения пептидов ОХМ, проблемы, связанные со стабильностью и фармакокинетикой, должны быть решены.

Описанные здесь пептидные аналоги ОХМ решают эти проблемы.

Во-первых, ограниченная стабильность in vivo природного ОХМ и GLP-1 обусловленная расщеплением DPP-IV и быстрым почечным клиренсом, что вызывает необходимость частого введения лекарственного средства (подкожные инъекции три раза в день для ОХМ, продолженная инфузия для GLP-1) в больших дозах у людей, была решена путем мутации сайта расщепления DPP-IV (предпоследний остаток на N-конце) и липидизацией пептида ОХМ для увеличения времени полужизни in vivo (t1/2). Ожидается, что t1/2 липидизированных (например, ацилированных или конъюгированных с молекулой холестерина) пептидных аналогов ОХМ у людей будет подходящим по меньшей мере для введения один раз в день. Описанные здесь пептидные аналоги ОХМ являются более подходящими для терапевтических целей, чем природный ОХМ, которые требует введения лекарственного средства три раза в день.

Во-вторых, профиль переносимости полипептидов данного изобретения, как ожидают, будет аналогичным профилю переносимости природного ОХМ у людей, который может быть лучше, чем профиль переносимости общепринятых миметиков GLP-1, таких как эксенатид и лираглютид. Таким образом, длительная эффективность описанных здесь аналогов может быть лучше, чем общепринятых миметиков GLP-1, таких как препарат Баета (Byetta®) (Amylin Pharmaceuticals), обусловленная минимальной тошнотой и рвотой, которые обычно были дозолимитирующими для миметиков GLP-1. В отличие от последнего, для смягчения тошноты может понадобиться титрование доз для полипептидов данного изобретения.

В-третьих, никаких систематических исследований не было произведено для оценки потенциала для улучшения контроля (уровня) глюкозы. Поскольку ОХМ является сильным агонистом глюкагонового рецептора, то ожиданием было бы, что длительное введение привело бы к ухудшению контроля (уровня) глюкозы (гипергликемии). Однако, неожиданно, что описанные здесь аналоги ОХМ, которые включают в себя сбалансированный рецептор GLP-1 и коагонизм GCGR, дают повышенное ослабление поглощения пищи и массы тела в случае длительного введения и приводят к улучшенной толерантности к глюкозе. Пептидные аналоги ОХМ, которые обладают активностью двойного агониста рецептора GLP-1 (GLP-1 R) и рецептора к глюкагону (GCGR), обозначают здесь в виде (+/+). Пептидные аналоги ОХМ, которые являются только агонистами GLP-1, обозначают здесь в виде (+/0).

Получение пептидных аналогов ОХМ пролонгированного действия не было прямым. Начальные исследования авторы данного изобретения фокусировали на сайт-специфической конъюгации с объемным заместителем полиэтиленгликолем (PEG) в представляющих интерес положениях по всему пептиду. Неожиданно, но присоединение PEG по всем проанализированным положениям приводило к существенному снижению активности GCGR и/или GLP-1R. Таким образом, авторы данного изобретения исследовали другие способы улучшения фармакокинетических свойств при сохранении активности GCGR. Присоединение холестеринового конъюгата по различным положениям пептида указывало на С-концевую конъюгацию как наиболее благоприятный способ. Однако исследования in vitro и in vivo указывали на то, что присоединение холестерина приводило к существенному изменению активности в сыворотке и пониженной эффективности in vivo. Таким образом, дополнительное исследование привело к нетривиальному включению гидрофильного линкера между пептидной и холестериновой группой или к прямому присоединению ацильной цепи к С-концевому остатку.

Первичные показания состоят в том, что описанные здесь аналоги ОХМ могут быть использованы для лечения ожирения и/или диабета. Вторичные показания представляют собой метаболический синдром, гипергликемию, нарушенную гликемию натощак и другие предиабетические состояния. Дополнительные показания включают в себя все показания в отношении GLP-1, такие как синдром раздраженной толстой кишки и другие заболевания всасывания кишечника, ишемия, инсульт и неврологические нарушения, в том числе тревога, нарушенное познание и болезнь Альцгеймера.

На основе опубликованных исследований с ОХМ на людяхпредполагают, что описанные здесь аналоги ОХМ проявят, по меньшей мере, сопоставимую, если не более высокую эффективность и лучший профиль безопасности, чем современные агенты для похудения, такие как орлистат (Xenical® (Roche), ингибитор липазы) и сибутрамин (Meridia® (Abbott Laboratories), ингибитор обратного захвата серотонина/норэпинефрина), для которых желудочно-кишечная непереносимость (диарея, метеоризм) и гипертензия являются обычными побочными эффектами соответственно.

В частных аспектах пептидные аналоги ОХМ необязательно включают в себя защитную группу, ковалентно соединенную с N-концевой аминогруппой. Защитная группа, ковалентно соединенная с N-концевой аминогруппой пептида, снижает реакционную способность аминоконца в условиях in vivo. Амино-защитные группы включают в себя -С1-10-алкил, -С1-10 замещенный алкил, -С2-10-алкенил, -С2-10-замещенный алкенил, арил, -С1-6-алкил арил, -С(O)-(СН2)1-6-СООН, -С(O)-С1-6-алкил, -С(O)-арил, -С(O)-O-С1-6-алкил или -С(O)-O-арил. В частных вариантах осуществления изобретения аминоконцевая защитная группа выбрана из группы, состоящей из ацетила, пропила, сукцинила, бензила, бензилоксикарбонила и t-бутилоксикарбонила. Деаминирование N-концевой аминокислоты представляет другую модификацию, которая предусмотрена для снижения реакционной способности аминоконца в условиях in vivo.

Пептидные аналоги ОХМ могут быть модифицированы для получения защитной группы, ковалентно связанной с С-концевой карбоксильной группой, которая снижает реакционную способность карбокси-конца в условиях in vivo. Например, группы карбоновых кислот пептида как карбокси-концевые, так и боковой цепи, могут быть обеспечены в форме соли фармацевтически приемлемого катиона, или этерифицированы с образованием С1-6-сложного эфира, или превращены в амид формулы NRR2, где R и R2 означают каждый независимо Н или С1-6-алкил, или комбинированы с образованием гетероциклического кольца, например 5- или 6-членного кольца. Защитная группа карбокси-конца предпочтительно прикреплена к α-карбонильной группе последней аминокислоты. Защитные группы карбокси-конца включают в себя, но не ограничиваются ими, амид, метиламид и этиламид. Аминогруппы пептида, как Т-концевые, так и боковой цепи, могут быть в форме фармацевтически приемлемой соли присоединения кислоты, такой как HCl, HBr, уксусная, бензойная, толуолсульфоновая, малеиновая, винная, и других органических солей, или могут быть модифицированы в С1-6-алкил или диалкиламино или дополнительно превращены в амид.

Пептидные аналоги ОХМ, которые способны действовать в виде двойных агонистов GLP-1 и глюкагона, содержат аминокислотную последовательность человеческого оксинтомодулина (ОХМ), показанную в SEQ ID NO:1, в которой вторую аминокислоту с N-конца замещают аминокислотой, которая придает пептиду устойчивость к расщеплению и инактивации дипептидилпептидазой IV; (содержит) липидную молекулу или молекулу холестерина, ковалентно связанную с пептидным аналогом ОХМ; необязательно (содержит) от одной до трех аминокислотных замен в дополнение к замене в положении 2; и необязательно содержит защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой пептида. В дополнительных вариантах осуществления пептидные аналоги дополнительно не имеют аминокислотную последовательность RNRNNIA (SEQ ID NO:104). В целом, пептидные аналоги ОХМ, имеющие вышеуказанную структуру, будут действовать в виде двойного агониста рецептора GLP-1 и глюкагонового рецептора и имеют период полужизни в сыворотке выше, чем период полужизни в сыворотке природного человеческого ОХМ.

В более конкретных вариантах данного изобретения пептидный аналог ОХМ может быть представлен структурой

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSKYLDSX2X3AQDFVQWLX4NTK (SEQ ID NO:103),

где Х1 означает остаток D-серина или α-аминоизомасляной кислоты (aib); X2 означает остаток аргинина (R) или глутаминоври кислоты (Е); Х3 означает остаток аргинина (R) или аланина (А); Х4 означает остаток метионина (М), норлейцина (Nle) или O-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1 является необязательной, но которая, если присутствует, представляет собой аминокислотную последовательность RNRNNIA (SEQ ID NO:104) или линкерную молекулу; Z2 является необязательной, но которая, если присутствует, представляет собой остаток лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина;

и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р или с находящейся внутри аминокислотой Р (пептида).

В дополнительном варианте пептидный аналог ОХМ может быть представлен структурой

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSKYLDSX2X3AQDFVQWLX4NTK (SEQ ID NO:103),

где Х1 означает остаток D-серина или α-аминоизомасляной кислоты (alb); X2 означает остаток аргинина (R) или глутаминовой кислоты (Е); Х3 означает остаток аргинина (R) или аланина (А); Х4 означает остаток метионина (М), норлейцина (Nle) или О-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1 является необязательной, но которая, если присутствует, представляет собой линкерную молекулу; Z2 является необязательной, но которая, если присутствует, представляет собой остаток лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина; и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р или с находящейся внутри аминокислотой Р (пептида).

В дополнительном варианте пептидный аналог ОХМ может быть представлен структурой

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSKYLDSX2X3AQDFVQWLX4NTKRNRNNIA (SEQ ID NO:105),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовой кислоты (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновой кислоты (Аср) или 1-амино-1-циклопентан-карбоновой кислоты (Асре); Х2 означает остаток аргинина (R) или глутаминовой кислоты (Е); Х3 означает остаток аргинина (R) или аланина (А); Х4 означает остаток метионина (М), норлейцина (Me) или О-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1 является необязательной, но которая, если присутствует, представляет собой аминокислотную последовательность RNRNNIA (SEQ ID NO:104) или линкерную молекулу; Z2 является необязательной, но которая, если присутствует, представляет собой остаток лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина;

и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р или с находящейся внутри аминокислотой Р (пептида).

В дополнительных конкретных вариантах пептидный аналог ОХМ может быть представлен структурой

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTK (SEQ ID NO:106),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовой кислоты (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновой кислоты (Аср) или 1-амино-1-циклопентан-карбоновой кислоты (Асре); Х2 означает Ser (серин) (S) или Lys (лизин) (K); Х3 означает Ser (серин) (S) или Glu (глутаминовая кислота) (Е); Х4 означает остаток аргинина (R) или остаток глутаминовой кислоты (Е); Х5 означает остаток аргинина (R) или аланина (А); Х6 означает Gin (глютамин) (Q) или Lys (лизин) (K); Х7 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1, необязательно, но если присутствует, является аминокислотной последовательностью RNRNNIA (SEQ ID NO:104) или линкерной молекулой; Z2 является необязательной, но которая, если присутствует, представляет собой остаток лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина; и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р или с находящейся внутри аминокислотой Р (пептида).

В дополнительном варианте пептидный аналог ОХМ может быть представлен структурой

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTK (SEQ ID NO:106),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовой кислоты (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновой кислоты (Аср); или 1-амино-1-циклопентан-карбоновой кислоты (Асре); Х2 означает Ser (серин) (S) или Lys (лизин) (K); Х3 означает Ser (серин) (S) или или Glu (глутаминовая кислота) (Е); Х4 означает остаток аргинина (R) или остаток глутаминовой кислоты (Е); Х5 означает остаток аргинина (R) или аланина (А); Х6 означает Gln (глютамин) (Q) или Lys (лизин) (K); Х7 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1, необязательно, но если присутствует, является линкерной молекулой; Z2 является необязательной, но которая, если присутствует, представляет собой остаток лизина (K), остаток лизина ковалентно-связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина; и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р или с находящейся внутри аминокислотой Р(пептида).

В дополнительном варианте пептидный аналог ОХМ может быть представлен структурой

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTKRNRNNIA (SEQ ID NO:107),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-цикпобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовой кислоты (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновой кислоты (Аср); или 1-амино-1-циклопентан-карбоновой кислоты (Асре); Х2 означает Ser (серин) (S) или Lys (лизин) (K); Х3 означает Ser (серин) (S) или Glu (глутаминовая кислота) (Е); Х4 означает остаток аргинина (R) или остаток глутаминовой кислоты (Е); Х5 означает остаток аргинина (R) или аланина (А); Х6 означает Gln (глютамин) (Q) или Lys (лизин) (K); Х7 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о);

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1, необязательно, но если присутствует, является линкерной молекулой; Z2 является необязательной, но которая, если присутствует, представляет собой остаток лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина; и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р или с находящейся внутри аминокислотой Р (пептида).

В дополнительных конкретных вариантах пептидный аналог ОХМ может быть представлен структурой

Z1-P-L1-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTKX9 (SEQ ID NO:108),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовой кислоты (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновой кислоты (Аср) или 1-амино-1-циклопентан-карбоновой кислоты (Асре); Х2 означает Tyr (тирозин) или Lys (лизин); Х3 означает Ser (серин) (S) или Lys (лизин) (K); Х4 означает Ser (серин) (S) или Glu (глутаминовая кислота) (Е); Х5 означает остаток аргинина (R) или глутаминовой кислоты (Е); Х6 означает остаток аргинина (R) или аланина (А); Х7 означает (глютамин) (Q) или Lys (лизин) (K); Х8 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о); Х9 является необязательной, но если присутствует, означает один или несколько остатков гамма-глутаминовой кислоты;

Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, L1, необязательно, но если присутствует, является аминокислотной последовательностью RNRNNIA (SEQ ID NO:104) или линкерной молекулой; Z2 является необязательной, но которая, если присутствует, представляет собой остаток лизина (K), остаток лизина ковалентно связан с липидной молекулой, остаток лизина ковалентно связан с молекулой холестерина, цистеиновый остаток (С), цистеиновый остаток ковалентно связан с липидной молекулой; цистеиновый остаток ковалентно связан с молекулой холестерина; и Р или Z2 необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли. L1-Z2 могут быть связаны с С-концевой аминокислотой Р или с находящейся внутри аминокислотой Р (пептида).

В каждом из вышеприведенных вариантов липидная молекула или молекула холестерина может быть прямо или опосредованно связана с боковой цепью аминокислоты. При опосредованном связывании липидной молекулы или молекулы холестерина с боковой цепью аминокислоты липидную молекулу или молекулу холестерина связывают с боковой цепью аминокислоты посредством линкерной молекулы. В конкретных аспектах липид или холестерин связывают прямо с боковой цепью аминокислоты, которую затем связывают с пептидным аналогом ОХМ линкерной молекулой (L1).

В частных вариантах осуществления описанных здесь аналогов ОХМ, в тех случаях, когда остатки 16 и 20 представляют Glu и Lys соответственно, боковые цепи указанных остатков могут принимать участие в лактамном мостике между указанными остатками Glu и Lys.

Во многих вариантах осуществления линкерная молекула является гидрофильным линкером. Химическая структура линкерной молекулы, однако, не является критичной, поскольку она (линкерная молекула) служит, в первую очередь, в виде спейсера. Однако в некоторых вариантах линкерная молекула может сама по себе обеспечивать улучшенные свойства пептидных аналогов ОХМ. Примеры линкерных молекул включают в себя, но не ограничиваются ими, аминокислоты и пептиды; алкильные линкеры, такие как -NH-(CH2)s-C(O)-, где s=2-20, эти алкильные линкеры могут дополнительно быть заменены любой пространственно незатрудненной группой, такой как низший алкил (например, С1-6), низший ацил, галоген (например, Cl, Br), CN, NH2, фенил и т.п.; этоксиполимер, который включает в себя от одного до двенадцати этокси-звеньев; Ttds (1-амино-4,7,10-триокса-13-тридеканамин янтарную кислоту); и один, два, три или несколько остатков гамма-глутаминовой кислоты.

В целом, линкерная молекула является ковалентно связанной с С-концевой аминокислотой пептида (Р) и Z2 является ковалентно связанной с линкерной молекулой. В частных аспектах линкерная молекула является ковалентно связанной с находящейся внутри аминокислотой пептида Р и Z2 является ковалентно связанной с линкерной молекулой. В дополнительных аспектах, в случаях, когда L1-Z2 являются ковалентно связанными с находящейся внутри аминокислотой пептида Р, Х9 может включать в себя один или несколько остатков гамма-глутаминовой кислоты.

Пептидные аналоги ОХМ включают в себя диастереоизомеры, а также их рацемические и выделенные энантиометнически чистые формы. В целом, аминокислоты находятся в L-форме с конкретными аминокислотами в D-форме. Как известно в данной области, индивидуальные аминокислоты могут быть представлены следующим образом: А=Ala=аланин; С=Cys=цистеин; D=Asp=аспарагиновая кислота; E=Glu=глютаминовая кислота; Р=Phe=фенилаланин; G=Gly=глицин; Н=His=гистидин; I=Ile=изолейцин; K=Lys=лизин; L=Leu=лейцин; М=Met=метионин; N=Asn=аспарагин; Р=Pro=пролин; Q=Gln=глутамин; R=Arg=аргинин; S=Ser=серин; Т=Thr=треонин; V=Val=валин; W=Trp=триптофан и Y=Tyr=тирозин.

Таблица 1 демонстрирует структуры представленного ряда пептидных аналогов ОХМ на основе полноразмерной молекулы ОХМ, которые обладают активностью как с глюкагоновым рецептором, так и с рецептором GLP-1 (+/+). Пептидные аналоги ОХМ ОХМ29, 208, 209 и 229 представляют собой предшественники пептидных аналогов (тиолированные пептиды), которые использовали для реакции конъюгации с молекулами бромхолестерина.

Таблица 1
Пептидные аналоги ОХМ (+/+)
SEQ ID NO Наименование Структура
4 ОХМ29 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC-CONH2
8 ОХМ36 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2
12 ОХМ70 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2
19 ОХМ110 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK (пальмитоил)-CONH2
21 ОХМ115 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC7-CONH2
24 ОХМ177 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK (пальмитоил)-CONH2
25 ОХМ208 HαQGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC-CONH2
26 ОХМ209 HαQGTFTSDYSKYLDSRRAQDFVQWLoNTKRNRNNIAC-CONH2
27 ОХМ212 HαQGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC4-CONH2
28 ОХМ213 HαQGTFTSDYSKYLDSRRAQDFVQWLoNTKRNRNNIAC4-CONH2
29 ОХМ216 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC7-CONH2
30 ОХМ229 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC-CONH2
31 ОХМ237 HsQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIA-C7-CONH2
32 ОХМ238 HsQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIA-C5-CONH2
33 ОХМ259 H-ACX-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
34 ОХМ260 H-Abu-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
35 ОХМ261 H-(D-Abu)-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
36 ОХМ262 H-Nva-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
37 ОХМ263 H-Cpa-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
38 ОХМ264 H-Prg-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
39 ОХМ265 H-Alg-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
40 ОХМ266 H-(2-Cha)-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
41 ОХМ267 H-(Dtbg)-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
42 ОХМ268 H-Vg-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
43 ОХМ306 H-Acp-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
44 ОХМ307 H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
45 ОХМ308 H-Acpe-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
α = α-аминоизомасляная кислота; s = D-Ser (D-серин); m = метионинсульфоксид; n = норлейцин; о = O-метил-L-гомосерин; Асх = 1-амино-1-циклогексан-карбоновая кислота; Abu = α-аминомасляная кислота; D-Abu = D-α-аминомасляная кислота; Nva = аминовалериановая кислота; Сра = β-цикпопропилаланин; Prg = пропаргилглицин; Alg = аллилглицин; 2-Cha = 2-амино-2-циклогексил-пропионовой кислоты; D-tbg = D-терт-бутилглицин; Vg = винилглицин; Аср = 1-амино-1-циклопропан-карбоновая кислота; Acb = 1-амино-1-циклобутан-карбоновая кислота; Асре = 1-амино-1-циклопетан-карбоновая кислота; С4 = Cys(холест-5-ен-3-ил{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}ацетат);
C5=Cys(CH2CONH2), соответствует цистеиновому остатку, в котором тиол боковой цепи подвергали взаимодействию с иодацетамидом;
С7 = Cys(холест-5-ен-3-ил 1-{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}-2-оксо-6,9,12,15-тетраокса-3-аза-октадекан-18-оат) или Cys(оха4-холестерин).

Пептидные аналоги ОХМ ОХМ36 и ОХМ115 получали из ОХМ229, который включает в себя природный человеческий пептид ОХМ, но с D-серином в положении 2 аминокислоты и с цистеиновым остатком в пептидной связи на С-конце и в котором С-концевая карбоксильная группа была амидирована. ОХМ36 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2 (SEQ ID NO:8), в которой С4 означает цистеиновый остаток, в котором холест-5-ен-3-ил{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}ацетат ковалентно связан с ним, как показано ниже.

ОХМ115 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC7-CONH2 (SEQ ID NO:21), в которой С7 означает холест-5-ен-3-ил 1-{[(2Р)-3-амино-2-(амино)-3-оксопропил]тио}-2-оксо-6,9,12,15-тетраокса-3-азаоктадекан-18-оат (или Cys(оха4-холестерин)), как показано ниже.

С7 отличается от С4 тем, что С7 имеет гидрофильный спейсер, образованный четырьмя повторами этиленгликоля (этокси-звенья) между холестериновой группой и молекулой цистеина. Группа С7 повышает растворимость полученного пептид-холестеринового конъюгата. Кроме того, в присутствии плазмы сыворотки конъюгат пептид-С7 демонстрирует менее заметный сдвиг сыворотки, чем конъюгаты пептид-С4. Было обнаружено, что это является важным для поддержания оптимально сбалансированной активности на два рецептора GLP-1R и глюкагоновый рецептор. Результаты, показанные в примерах, иллюстрируют этот аспект.

Пептидные аналоги ОХМ ОХМ70 и ОХМ216 получали из ОХМ29, который включает в себя природный человеческий пептид ОХМ, но с α-аминоизомасляной кислотой в положении 2 аминокислоты и с цистеиновым остатком в пептидной связи на С-конце и в котором С-концевая карбоксильная группа была амидирована. ОХМ70 имеет структуру HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2 (SEQ ID NO:12), в которой С4 означает холест-5-ен-3-ил{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}ацетат, как показано для ОХМ36. ОХМ216 имеет структуру HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC7-CONH2 (SEQ ID NO:29), в которой С7 означает холест-5-ен-3-ил 1-{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}-2-оксо-6,9,12,15-тетраокса-3-азаоктадекан-18-оат (или Cys(оха4-холестерин)), как для ОХМ115.

Пептидный аналог ОХМ ОХМ212 получали из ОХМ208, который включает в себя природный человеческий пептид ОХМ, но с α-аминоизомасляной кислотой в положении 2 аминокислоты, норлейцином вместо остатка метионина в положении 27, с цистеиновым остатком в пептидной связи на С-конце и в котором С-концевая карбоксильная группа была амидирована. ОХМ212 имеет структуру HαQGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC4-CONH2 (SEQ ID NO:26), в которой С4 означает холест-5-ен-3-ил{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}ацетат, как показано для ОХМ36.

Пептидный аналог ОХМ ОХМ213 получали из ОХМ209, который включает в себя природный человеческий пептид ОХМ, но с α-аминоизомасляной кислотой в положении 2 аминокислоты, О-метил-L-гомосерином вместо остатка метионина в положении 27, с цистеиновым остатком в пептидной связи на С-конце и в котором С-концевая карбоксильная группа была амидирована. ОХМ213 имеет структуру HαQGTFTSDYSKYLDSRRAQDFVQWLYNTKRNRNNIAC4-CONH2 (SEQ ID NO:28), в которой С4 означает холест-5-ен-3-ил{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}ацетат, как показано для ОХМ36.

ОХМ237 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIAC7-CONH2 (SEQ ID NO:31). Ее конструировали для включения в ее состав D-Ser (D-серина) (s) в положении 2, Met (метионина) (О) в положении 27, и Cys(Oxa4-холестерина) (С7) в положении 38.

ОХМ238 конструировали для включения в ее состав D-Ser (s) в местоположении 2, Met(O) в положении 27, и Cys(ацетамида) (С5) в местоположении 38. Этот пептид имеет одну и ту же пептидную последовательность ОХМ237 и является контрольным пептидом без холестерина, но с цистеинтиолом, блокированным ацетамидом.

ОХМ259-ОХМ268 и ОХМ306-308 (как показано в таблице 1) имеют аминокислотную последовательность ОХМ, но в которой аминокислота в положении 2 была замещена неприродной аминокислотой для идентификации аминокислотных замен, которые придают устойчивость к каталитической активности DPP4.

Пептидные аналоги ОХМ, которые не имеют аминокислотную последовательность RNRNNIA (SEQ ID NO:55), также могут демонстрировать полную агонистическую активность в отношении рецепторов GLP-1 и глюкагона. Эти пептидные аналоги ОХМ наряду с некоторыми дополнительными пептидами на основе полноразмерного пептида ОХМ показаны в таблице 2. Эти укороченные пептидные аналоги ОХМ являются вариантами рода пептидов Glucagon К (GcgK), которые описаны в находящейся в общей собственности опубликованной международной заявке на патент №W02007100535. Пептиды GcgK являются пептидами, у которых последовательность ОХМ была укорочена с С-конца для элиминации семи аминокислотных остатков на С-конце. Полученный пептид является одним из пептидов глюкагона с дополнительным остатком лизина на С-конце. Данный пептид GcgK соответствует модели +/+, в которой пептиды демонстрируют субнаномолярную активность как в отношении GLP-1R, так и GCGR. Наоборот, природный ОХМ демонстрирует наномолярную активность в отношении обоих рецепторов. Дополнительное преимущество пептида GcgK состоит в том, что оба основных остатков аргинина на С-конце были элиминированы. Это было важно в конструировании пептидных аналогов, содержащих липид (липидизированных) (ацилированных или содержащих холестерин), имеющих активность двойного агониста GLP-1/GCGR. Данные заявителей показали, что пептидные аналоги, содержащие липид, с pI выше 7 на основе ОХМ последовательности стимулируют дегрануляцию тучных клеток, тогда как пептидные аналоги, содержащие липид, с pI приблизительно 5, по-видимому, не стимулируют дегрануляцию тучных клеток (см. пример 11). Таким образом, на основе результатов заявителей для снижения риска стимулированной пептидом дегрануляции тучных клеток, (значение) pI пептидных аналогов на основе липидов должно быть приблизительно 5. Таким образом, в частных аспектах содержащие липид (липидизированные) пептидные аналоги имеют pI менее чем 6,0. В дополнительных аспектах содержащие липид (липидизированные) пептидные аналоги имеют pI между 4,5 и 6,0. В дополнительном аспекте содержащие липид (липидизированные) пептидные аналоги имеют pI приблизительно 5,4. Снижение pI делали с использованием одного или нескольких следующих трех различных способов: 1) заменой остатков в пептиде, 2) введением карбоксилатной группы в С-конец и 3) введением отрицательно заряженных остатков, таких как один или несколько остатков гамма-карбоксиглутаминовой кислоты в виде спейсеров.

Таким образом, в одном аспекте пептидных аналогов ОХМ с pI менее чем 6,0 ацильную или холестериновую группу ковалентно связывают с пептидом посредством спейсера, который содержит два остатка гамма-карбоксиглутаминовой кислоты. Примеры этих пептидных аналогов включают в себя пептидные аналоги, показанные в таблице 2. Например, пептиды с pI приблизительно 5,4 включают в себя, но не ограничиваются ими, ОХМ345, ОХМ380, ОХМ381, ОХМ392, ОХМ395, ОХМ398, ОХМ399, ОХМ400 и ОХМ401. В другом аспекте пептидных аналогов с pI менее чем 6,0 ацильную или холестериновую группу ковалентно связывают с расположенной внутри аминокислотой в пептидных аналогах посредством спейсера, который содержит один или два остатка гамма-карбоксиглутаминовой кислоты и пептид дополнительно включает в себя один или несколько остатков гамма-карбоксиглутаминовой кислоты, ковалентно связанных с остатком лизина на С-конце. Примеры этих пептидных аналогов включают в себя, но не ограничиваются ими, ОХМ407, ОХМ408, ОХМ414 и ОХМ418. В другом аспекте пептидных аналогов с pI менее чем 6,0 ацильную или холестериновую группу ковалентно связывают с С-концом пептид посредством спейсера, который содержит один остаток гамма-карбоксиглутаминовой кислоты и пептид дополнительно включает в себя одну или несколько аминокислотных замен для снижения pI пептида. ОХМ374 представляет собой пример такого пептидного аналога.

Таким образом, дополнительно обеспечивают пептидный аналог, содержащий аминокислотную последовательность HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO:109), в которой вторую аминокислоту с N-конца пептида замещают аминокислотой, которая придает пептиду устойчивость к расщеплению и инактивации дипептидилпептидазой IV; пептид включает в себя молекулу липида или холестерина, ковалентно связанную с пептидом спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты; пептид необязательно включает в себя от одной до трех аминокислотных замен в дополнение к замене в положении 2; и пептид необязательно включает в себя защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой пептида; где пептидный аналог имеет (значение) pI менее чем 6,0 и является двойным агонистом рецептора GLP-1 и агонистом глюкагонового рецептора и его фармацевтически приемлемые соли. В частных аспектах пептидные аналоги имеют pI между 4 и 6 или pI приблизительно 5,0, например pI приблизительно 5,4.

В дополнительных аспектах аминокислота, для замены второй аминокислоты с N-конца пептидного аналога, выбрана из группы, состоящей из D-серина, α-аминоизомасляной кислоты и 1-амино-1-циклобутан-карбоновой кислоты.

В частных аспектах пептидный аналог включает в себя молекулу холестерина, ковалентно связанную с тиольной группой цистеинового остатка, который ковалентно связан с ε-аминогруппой остатка лизина на С-конце пептидного аналога спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты. В дополнительном варианте молекулу холестерина ковалентно связывают с тиольной группой гидрофильным линкером, который в конкретных вариантах представляет собой этоксиполимер, который включает в себя от одного до двенадцати этокси-звеньев, например этоксиполимер, который включает в себя четыре этокси-звена.

В частных аспектах пептидный аналог включает в себя липидную молекулу, ковалентно связанную с ε-аминогруппой остатка лизина: конкретных вариантах липидная молекула является жирной кислотой, такой как молекула пальмитоила, миристоила или стеароила. В дополнительном варианте липидную молекулу ковалентно связывают с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты. В дополнительном варианте липидную молекулу ковалентно связывают с ε-аминогруппой остатка лизина на С-конце одним или несколькими остатками гамма-глутаминовой кислоты. В дополнительном варианте липидную молекулу ковалентно связывают с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты и остаток лизина связывают с остатком лизина на С-конце одним или несколькими остатками гамма-глутаминовой кислоты.

В дополнительных аспектах пептидный аналог дополнительно включает в себя одну или несколько аминокислотных замен в положениях аминокислот, выбранных из группы, состоящей из положений 10, 12, 16, 17, 18 и 27. В частных вариантах пептидный аналог включает в себя одну или несколько аминокислотных замен, выбранных из группы, состоящей из лизина вместо тирозина в положении 10, серина вместо лизина в положении 12, глутаминовой кислоты или α-аминоизомасляной кислоты вместо серина в положении 16, глутаминовой кислоты вместо аргинина в положении 17, аланина вместо аргинина в положении 18, лизина вместо глютамина в положении 20 и норлейцина или O-метил-L-гомосерина вместо метионина в положении 27.

В дополнительном варианте тирозин в положении 10 пептидного аналога заменяют лизином и липидную молекулу ковалентно связывают ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты. В другом варианте глутамин в положении 20 пептидного аналога заменяют лизином и липидную молекулу ковалентно связывают ε-аминогруппой лизина одним или несколькими остатками гамма-глутаминовой кислоты. В другом варианте пептидный аналог дополнительно включает в себя один или несколько остатков гамма-глутаминовой кислоты, ковалентно связанных с С-концом.

Дополнительно обеспечивают пептидный аналог, содержащий структуру

Z1-P-M-Z2,

где Р означает пептид, имеющий аминокислотную последовательность

HX1QGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTKX9X10 (SEQ ID NO:110),

где Х1 означает остаток D-серина, α-аминоизомасляной кислоты (aib), 1-амино-1-циклобутан-карбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексил-пропионовой кислоты (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропан-карбоновой кислоты (Аср); или 1-амино-1-циклопентан-карбоновой кислоты (Асре); Х2 означает остаток тирозина (Y) или лизина (K); Х3 означает остаток серина (S) или лизина (K); Х4 означает остаток серина (S), α-аминоизомасляной кислоты (aib) или глутаминовой кислоты (Е); Х5 означает остаток аргинина (R) или глутаминовой кислоты (Е); Х6 означает остаток аргинина (R) или аланина (А); Х7 означает остаток глутамина (Q) или лизина (K); Х8 означает остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или O-метил-L-гомосерина (о); Х9 означает остаток гамма-глутаминовой кислоты (yGlu); X10 означает остаток гамма-глутаминовой кислоты (yGlu) или отсутствует; Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, соединена с N-концевой аминогруппой, М означает (i) цистеиновый остаток, ковалентно связанный с молекулой холестерина гидрофильным линкером, (ii) остаток лизина, ковалентно связанный с липидной молекулой спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты, или (iii) липидную молекулу, причем М ковалентно связан с С-концевой или с расположенной внутри Р (пептида) аминокислотой спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты; и Z2 означает необязательно присутствующую защитную группу, которая, если присутствует, соединена с С-концевой карбоксильной группой; и его фармацевтически приемлемые соли, причем пептидный аналог или его соль имеет pI менее чем 6,0 и является двойным агонистом рецептора GLP-1 и агонистом глюкагонового рецептора. В частных аспектах пептидные аналоги имеют pI между 4 и 6, или pI приблизительно 5,0; 5,1; 5,2; 5,3; 5,4; 5,5; 5,6; 5,7; 5,8 или 5,9, или pI приблизительно 5,4-5,5.

В дополнительных аспектах пептидного аналога М означает цистеиновый остаток, ковалентно связанный с молекулой холестерина гидрофильным линкером и цистеиновый остаток связан с С-концом Р (пептида). В дополнительных вариантах гидрофильный линкер является этоксиполимером, который включает в себя от одного до двадцати четырех этокси-звеньев, который в конкретных аспектах может включать в себя, например, четыре этокси-звена.

В дополнительных аспектах М означает остаток лизина, ковалентно связанный с липидной молекулой спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты и остаток лизина, связанный с С-концом Р или М, означает остаток лизина, ковалентно связанный с липидной молекулой спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты, и остаток лизина находится в положении Х2 или Х7 (пептида) Р. В конкретных аспектах липидная молекула является молекулой пальмитоила, миристоила или стеароила.

Примеры этих пептидных аналогов показаны в таблице 2.

Таблица 2
Пептидные аналоги ОХМ (+/+)
SEQ ID NO. Наименование Структура
46 ОХМ290 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC-CONH2
47 ОХМ291 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKC-CONH2
48 ОХМ292 HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKC-CONH2
49 ОХМ293 HsQGTFTSDYSKYLDSERAQDFVQWLMNTKC-CONH2
50 ОХМ294 HsQGTFTSDYSKYLDSRAAQDFVQWLMNTKC-CONH2
51 ОХМ301 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC7-CONH2
52 ОХМ302 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKC7-CONH2
53 ОХМ303 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKC7-CONH2
54 ОХМ304 HsQGTFTSDYSKYLDSERAQDFVQWLMNTKC7-CONH2
55 ОХМ305 HsQGTFTSDYSKYLDSRAAQDFVQWLMNTKC7-CONH2
56 ОХМ311 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKK(пальмитоил)-CONH2
57 ОХМ312 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKK(пальмитоил)-CONH2
58 ОХМ314 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-Ttds-K(пальмитоил)-CONH2
59 ОХМ313 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-Ttds-K(пальмитоил)-CONH2
60 ОХМ317 HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-C4-CONH2
61 ОХМ318 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-γE-C4-CONH2
62 ОХМ319 HaQGTFTSDYSKYLDSEAAQDFVQWLMNTKC7-CONH2
63 ОХМ321 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA-γE-C4-CONH2
64 ОХМ323 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKR-C7-CONH2
65 ОХМ325 HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC7-COOH
66 ОХМ327 HaQGTFTSDYSKYLDSERAQDFVQWLMNTKC7-CONH2
67 ОХМ329 HaQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-C4-COOH
68 ОХМЗЗО HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA-γE-K(пальмитоил)-CONH2
69 ОХМ345 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C4-COOH
70 ОХМ355 HSQGTFTSDYSSYLDSRRAQDFVQWLMNTK-γE-C4-COOH
71 ОХМ357 HSQGTFTSDYSKYLDSRAAQDFVQWLMNTK-γE-C4-COOH
72 ОХМ359 HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK-γe-С7-COOH
73 ОХМ361 HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK-γE-C7-COOH
74 ОХМ373 HSQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-C4-COOH
75 ОХМ374 HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-C7-COOH
76 ОХМ380 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C7-COOH
77 ОХМ381 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C9-COOH
78 ОХМ383 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C7-COOH
79 ОХМ388 H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C7-COOH
80 ОХМ392 HsQGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE-С10-СООН (лактамный мостик между Е и K)
81 ОХМ395 HαQGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE-C10-COOH (лактамный мостик между Е и K)
82 ОХМ398 H-Acb-QGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE-C10-COOH (лактамный мостик между Е и K)
83 ОХМ399 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C10-COOH
84 ОХМ400 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-С10-СООН
85 ОХМ401 H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C10-COOH
86 ОХМ404 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-K(γE-пальмитоил)-CONH2
87 ОХМ406 HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-γE-C10-CONH2
88 ОХМ407 HsQGTFTSDYSKYLDSRRAK(γE-пальмитоил)DFVQWLMNTK-γEγE-CONH2
89 ОХМ408 HsQGTFTSDYSKYLDSRRAK(γE-γE-пальмитоил)DFVQWLMNTK-YE-CONH2
90 ОХМ409 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDSRRAQDFVQWLMNTK-CONH2
91 ОХМ410 HsQGTFTSDYSKYLDERRAK(YE-YE-пальмитоил)DFVQWLMNTK-CONH2
92 ОХМ411 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-CONH2
93 ОХМ412 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-С11-СООН
94 ОХМ413 HαDGTFTSDYSKYLDSRRAQDFVK(DOTA)WLmNTK-γE-γE-C10-CONH2
95 ОХМ414 HsQGTFTSDK(γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-YE-CONH2
96 ОХМ415 HsQGTFTSDK(пальмитоил)SKYLDERRAQDFVQWLMNTK-YE-YE-CONH2
97 ОХМ416 HαQGTFTSDK(γE-γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-CONH2
98 ОХМ417 H-Acb-QGTFTSDK(γE-γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-CONH2
99 ОХМ418 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDaRRAQDFVQWLMNTK-γE-CONH2
100 ОХМ419 HaQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-K(γE-пальмитоил)-CONH2
101 OXM420 H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-K(γE-пальмитоил)-CONH2
102 OXM421 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C12-COOH
α = α-аминоизомасляная кислота; s = D-Ser (D-серин); K(Pam) = K(пальмитоил); m = метионинсульфоксид; Acb = 1-амино-1-циклобутан-карбоновая кислота;
C1 = Cys(mPEG) 5 кДа (килодальтон);
С2 = Cys(mPEG) 20 кДа;
С3 = Cys(mPEG) 240 кДа, каждый соответствует цистеиновому остатку, ПЭГилированному с использованием тиола боковой цепи с линейным метоксиПЭГ (mPEG) или разветвленным mPEG [(mPEG)2] указанной молекулярной массы (MW);
С4 = Cys(холест-5-ен-3-ил{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}ацетат);
C5=Cys(CH2CONH2), соответствует цистеиновому остатку, в котором тиол боковой цепи подвергали взаимодействию с иодацетамидом;
С6=Cys(mPEG)2 60 kDa, каждый соответствует цистеиновому остатку, ПЭГилированному с использованием тиола боковой цепи с линейным метоксиПЭГ (mPEG) или разветвленным mPEG2mPEG [(mPEG)2] указанной молекулярной массы (MW);
С7=Cys(холест-5-ен-3-ил 1-{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}-2-оксо-6,9,12,15-тетраокса-3-аза-октадекан-18-оат) или Cys(Oxa4-холестерин);
С8=Cys(N-этилмалеимидил);
С9=S-{1-[46-(холест-5-ен-3-илокси)-3,43,46-триоксо-7,10,13,16,19,22,25,28,31,34,37,40-додекаокса-4,44-диазагексатетраконт-1-ил]-2,5-диоксопирролидин-3-ил}-L-цистеин или Cys(мал-окса12-холестерин);
C10=S-[42-(холест-5-ен-3-илокси)-2,42-диоксо-6,9,12,15,18,21,24,27,30,33,36,39-додекаокса-3-азадотетраконт-1-ил]-L-цистеин или Cys(окса12-холестерин);
С11=5-[78-(холест-5-ен-3-илокси)-2,78-диоксо-6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51,54,57,60,63,66,69,72,75-тетракосаокса-3-азаоктагептаконт-1-ил]-L-цистеин или Cys(окса24-холестерин);
С12=S-[38-(холест-5-ен-3-илокси)-2-оксо-6,9,12,15,18,21,24,27,30,33,36-ундекаокса-3-азаоктатриаконт-1-ил]-L-цистеин или Cys(окса12-O-холестерин);
Ttds=1-амино-4,7,10-тиокса-13-тридеканамин янтарная кислота;
γЕ=гамма-глутаминовая кислота.

Пептид ОХМ290 является предшественником ОХМ301 и ОХМ291-294 являются предшественниками остальных пептидных аналогов, показанных в таблице 2. ОХМ301 является аналогом, имеющим D-Ser в положении 2 аминокислоты для устойчивости к DPPIV, замена Glu (глутамином) и Ala (аланином), соответственно, остатков Аrg17 (аргинина17) и Arg18 (аргинина18) и группу С(Oxa4-холестерин) (С7) для улучшенных фармакокинетических свойств in vivo. Замены Arg17 и Arg18 делали для повышения стабильности in vivo, поскольку эти остатки являются первичными сайтами протеолитического расщепления.

ОХМ302 является пептидным аналогом, который не имеет аминокислотной последовательности RNRNNIA (SEQ ID NO:96) на С-конце (см. находящуюся в общей собственности опубликованную международную заявку на патент № WO2007/100535, которая включена в изобретение путем ссылки полностью). Таким образом, ОХМ302 является на одну аминокислоту длиннее, чем глюкагоновый пептид, одним остатком лизина на С-конце. В ОХМ302, который имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:52), существует D-Ser в положении 2 аминокислоты для устойчивости к DPPIV и группа С(Oxa4-холестерин) (С7)) для улучшенных фармакокинетических свойств in vivo.

ОХМ303 имеет структуру HsQGTFTSDYSKYLDSEAAQDPVQWLMNTKC7-CONH2 (SEQ ID NO:53). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV, замена Glu (глутамином) и Ala (аланином), соответственно, остатков Arg17 (аргинина 17) и Arg18 (аргинина18) улучшает стабильность и группа С(Oxa4-холестерин) (С7) улучшает фармакокинетические свойства пептидного аналога in vivo.

ОХМ304 имеет структуру HsQGTFTSDYSKYLDSERAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:54). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV, замена Glu (глутамином) остатка Arg17 (аргинина17) улучшает стабильность и группа С(Oxa4-холестерин) (С7) улучшает фармакокинетические свойства пептидного аналога in vivo.

ОХМ305 имеет структуру HsQGTFTSDYSKYLDSERAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:55). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV, замена Ala (аланином) остатка Arg18 (аргинина18) улучшает стабильность и группа С(Oxa4-холестерин) (С7) улучшает фармакокинетические свойства пептидного аналога in vivo.

ОХМ311 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-K(пальмитоил)-CONH2 (SEQ ID NO:56). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV и группа К(пальмитоил) улучшает фармакокинетические свойства пептидного аналога in vivo.

ОХМ312 имеет структуру HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKK(пальмиотил)-CONH2 (SEQ ID NO:57). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV, замена Glu (глутамином) и Ala (аланином), соответственно, остатков Arg17 (аргинина17) и Arg18 (аргинина18) улучшает стабильность и группа K(пальмитоил) улучшает фармакокинетические свойства пептидного аналога in vivo.

ОХМ314 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-Ttds-К(пальмитоил)-CONH2 (SEQ ID NO:58). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV и группа К(пальмитоил) улучшает фармакокинетические свойства пептидного аналога in vivo. Ttds (1-амино-4,7,10-триокса-13-тридеканамин янтарная кислота) является линкером, который действует в виде гибкого и гидрофильного спейсера между пептидной последовательностью и группой K(пальмитоил).

ОХМ313 имеет структуру HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-Ttds-К(пальмитоил)-CONH2 (SEQ ID NO:59). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV, замена Glu (глутамином) и Ala (аланином), соответственно, остатков Arg17 (аргинина17) и Arg18- (аргинина18) - улучшает стабильность и группа Ttds-K(пальмитоил) улучшает фармакокинетические свойства пептидного аналога in vivo.

ОХМ317 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-C4-CONH2 (SEQ ID NO:60). В пептиде существует D-Ser в положении 2 аминокислоты для устойчивости к DPPIV и остаток гамма-глутаминовой (кислоты) связан с холест-5-ен-3-ил{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}ацетатом (С4) для улучшения фармакокинетических свойств in vivo. Остаток гамма-глутаминовой кислоты (γЕ) является линкером, который действует в виде гибкого спейсера между пептидной последовательностью и группой С4.

ОХМ318 имеет структуру HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-γE-C4-CONH2 (SEQ ID NO:61). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV, замена Glu (глутамином) и Ala (аланином), соответственно, остатков Arg17 (аргинина17) и Arg18 (аргинина18) улучшает стабильность и группа γЕ-С4 улучшает фармакокинетические свойства пептидного аналога in vivo.

ОХМ319 имеет структуру HαQGTFTSDYSKYLDSEAAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:62). В пептиде существует Aib в положении 2 аминокислоты для устойчивости к DPPIV, и группа С(Oxa4-холестерин) (С7) улучшает фармакокинетические свойства пептидного аналога in vivo.

ОХМ321 имеет структуру HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA-γE-C4-CONH2 (SEQ ID NO:63). ОХМ321 является аналогом, имеющим D-Ser в положении 2 аминокислоты для устойчивости к DPPIV, замена Glu (глутамином) и Ala (аланином), соответственно, остатков Arg17 (аргинина17) и Arg18 (аргинина18) и группа С(-холестерин) (С4) улучшает фармакокинетические свойства in vivo. Замены в Arg17 и Arg18 делали для повышения стабильности in vivo, поскольку эти остатки являются первичными сайтами протеолитического расщепления. Остаток гамма-глутаминовой кислоты (γЕ) является линкером, который действует в виде гибкого спейсера между пептидной последовательностью и группой С4.

ОХМ323 имеет структуру HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKR-C7-CONH2 (SEQ ID NO:64). D-Ser в положении 2 аминокислоты обеспечивает устойчивость к DPPIV, замена Glu (глутамином) и Ala (аланином) остатков Arg17 (аргинина17) и Arg18 (аргинина18) обеспечивает пептид с улучшенной стабильностью и группа С(Окса4-холестерин) (С7) обеспечивает пептид с улучшенными фармакокинетическими свойствами in vivo.

ОХМ325 имеет структуру HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC7-С02Н (SEQ ID NO:65). ОХМ325 является аналогом, имеющим D-Ser в положении 2 аминокислоты для устойчивости к DPPIV, замена Glu (глутамином) и Ala (аланином), соответственно, остатков Аrg17 (аргинина17) и Arg18 (аргинина18) и группа С(-холестерин) (С4) улучшает фармакокинетические свойства in vivo. Замены в Arg17 и Arg18 делали для повыщения стабильности in vivo, поскольку эти остатки являются. первичными сайтами протеолитического расщепления.

ОХМ327 имеет структуру HαQGTFTSDYSKYLDSERAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:66). Aib в положении 2 обеспечивает устойчивость к DPPIV, замена Glu (глутамином) остатка Arg17 (аргинина17) обеспечивает пептид с улучшенной стабильностью и группа С(Oxa4-холестерин) (С7) обеспечивает пептид с улучшенными фармакокинетическими свойствами in vivo.

ОХМ329 имеет структуру HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-C4-CO2H (SEQ ID NO:67). Aib в положении 2 обеспечивает устойчивость к DPPIV и группа С(Oxa4-холестерин) (С7) обеспечивает пептид с улучшенными фармакокинетическими свойствами in vivo. Остаток гамма-глутаминовой кислоты (γЕ) является линкером, который действует в виде гибкого спейсера между пептидной последовательностью и группой С4.

ОХМ330 имеет структуру HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA-γE-K(Pam)-CONH2 (SEQ ID NO:68). ОХМ330 является аналогом, имеющим D-Ser в положении 2 аминокислоты для устойчивости к DPPIV, замена Glu (глутамином) и Ala (аланином), соответственно остатков Arg17 (аргинина17) и Arg18 (аргинина18) и группа К(пальмитоил) улучшает фармакокинетические свойства пептидного аналога in vivo. Остаток гамма-глутаминовой кислоты (γЕ) является линкером, который действует в виде гибкого спейсера между пептидной последовательностью и группой K(пальмитоил). Замены в Arg17 и Arg18 делали для повышения стабильности in vivo, поскольку эти остатки являются первичными сайтами протеолитического расщепления.

ОХМ345 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C4-СООН (SEQ ID NO:69). ОХМ345 конструировали для получения D-Ser (s) (D-серина) в положении 2, двух (остатков) гамма-глутаминовой кислоты в положениях 31 и 32 в виде спейсеров между пептидной последовательностью и холестериновой группой, одного Cys(холестерина) в положении 33 (С4).

ОХМ355 имеет структуру HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK-γE-C4-СООН (SEQ ID NO:70). ОХМ355 конструировали для получения D-Ser (s) (D-серина) в положении 2, замены Lys12Ser, одной гамма-глутаминовой кислоты в положении 31 в виде спейсера между пептидной последовательностью и холестерином, одного Cys(холестерина) в положении 32 (С4). Серин в положении 12 присутствует в пептидной последовательности GLP-1. Таким образом, ожидается, что он должен иметь по меньшей мере сопоставимую активность с GLP-1R. Замена Lys12Ser устраняет положительный заряд, что приводит к pI приблизительно 5.

ОХМ357 имеет структуру HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK-γE-C4-COOH (SEQ ID NO:71). ОХМ357 конструировали для получения D-Ser (s) в положении 2, одной гамма-глутаминовой кислоты в положении 31 в виде спейсера между пептидной последовательностью и холестерином, одного Cys(холестерина) (С4) в положении 32. ОХМ357 отличается от ОХМ345 наличием только одной γ -Glu, тогда как ОХМ345 имеет две γ-Glu.

ОХМ359 имеет структуру HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK-γE-C7-СООН (SEQ ID NO:72). ОХМ359 конструировали для получения D-Ser (s) в положении 2, замены Lys12Ser, одной гамма-глутаминовой кислоты в положен ии 31 в виде спейсера между пептидной последовательностью и холестерином, одного Cys(Oxa4-холестерин) в положении 32 (С7). Таким образом, ОХМ359 отличается от ОХМ355 наличием С7 (холестериновой группы с тетраэтиленгликолевым спейсером) вместо С4 (холестерин без этиленгликолевого спейсера).

ОХМ361 имеет структуру HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK-γE-C7-COOH (SEQ ID NO:73). ОХМ361 конструировали для получения D-Ser (s) в положении 2, замены Arg18 Ala, одной гамма-глутаминовой кислоты в положении 31 в виде спейсера между пептидной последовательностью и холестерином, одного Суз(Oxa4-холестерин) в положении 32 (С7 в таблице). Замена Arg18 Ala устраняет положительный заряд, кторый важен для доведения оптимального значения pI до 5.

ОХМ373 имеет структуру HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-C4-СООН (SEQ ID NO:74). ОХМ373 конструировали для получения D-Ser (s) в положении 2, замены Ser16 Glu, одной гамма-глутаминовой кислоты в положении 31 в виде спейсера между пептидной последовательностью и холестерином, одного Cys(холестерин) в положении 32 (С4). Glu в положении 16 присутствует в пептиде эксендин-4, так что эта замена, как ожидается, по меньшей мере совместима с активацией GLP-1R.

ОХМ374 имеет структуру HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-C7-СООН (SEQ ID NO:75). ОХМ374 конструировали для получения D-Ser (s) в положении 2, замены Ser16 Glu, одной гамма-глутаминовой кислоты в положении 31 в виде спейсера между пептидной последовательностью и холестерином, одного Cys(Oxa4-холестерина) в положении 32 (С7). Таким образом, оличие между ОХМ373 и 374 обусловлено наличием тетраэтиленгликолевого спейсера, присоединенного к холестериновой группе в ОХМ374.

ОХМ380 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C7-СООН (SEQ ID NO:76). ОХМ380 конструировали для получения D-Ser (s) в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(Oxa4-холестерин) (С7) в положении 33. ОХМ380 имеет одну и ту же пептидную последовательность, что и ОХМ345, но отличается спейсером Оха4, связанным с холестериновой группой.

ОХМ381 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C9-СООН (SEQ ID NO:77). ОХМ381 конструировали для получения D-Ser (s) в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(малеимид-окса12-холестерин) (С9) в положении 33. OXM381 имеет одну и ту же пептидную последовательность, что и ОХМ345 и ОХМ380, отличающуюся спейсером малеимид-окса12, связанным с холестерином. Структура С9 показана ниже.

ОХМ383 имеет структуру HaQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C7-СООН (SEQ ID NO:78). ОХМ383 конструировали для получения Aib (О) в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(Oxa4-холестерин) (С7) в положении 33. ОХМ383 отличается от ОХМ380 только в отношении аминокислоты в положении 2.

ОХМ388 имеет структуру Н-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-С7-СООН (SEQ ID NO:79). ОХМ388 конструировали для получения Acb в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(Oxa4-холестерин) (С7) в положении 33. ОХМ388 отличается от ОХМ380 и 383 только в отношении аминокислоты в положении 2.

ОХМ392 имеет структуру HsQGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE-C10-СООН (лактамный мостик между Е и K) (SEQ ID NO:80). ОХМ392 конструировали для получения Ser (s) в положении 2, замен Ser16Glu и Gln20Lys, причем Glu16 и Lys20 связаны лактамным мостиком между боковыми цепями, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Су8(окса12-холестерина) (С10) в положении 33. Лактамный мостик находится между положением i (16) и i+4 (20) и предназначен для стабилизации альфа-спиральной конформации пептида и для стабилизации пептида против протеолитического разрушения.

Группа С10 отличается от группы С9 тиоэфирной связью, связывающей тиольную группу цистеина с окса12-холестерином. В С9 существует малеимидная тиоэфирная связь, тогда как в С10 существует ацетамидная тиоэфирная (связь). Структура С10 показана ниже.

OXM395 имеет структуру HαQGTFTSDYSKYLDERRAKDFVQWLMNTK-YE-YE-СЮ-COOH (лактамный мостик между Е и K) (SEQ ID NO:81). OXM395 конструировали для получения Aib (D) в положении 2, замен Ser16Glu и Gln20Lys, причем Glu16 и Lys20 связаны лакгамным мостиком между боковыми цепями, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(окса12-холестерина) (С10) в положении 33. Лактамный мостик находится между положением 16(i) и 20 (i+4) и предназначен для стабилизации альфа-спиральной конформации пептида и для стабилизации пептида против протеолитического разрушения.

ОХМ398 имеет структуру H-Acb-QGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE-С10-СООН (лактамный мостик между Е и К) (SEQ ID NO:82). ОХМ398 конструировали для получения Acb в положении 2, замен Ser16Glu и Gln20Lys, причем Glu16 и Lys20 связаны лакгамным мостиком между боковыми цепями, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(окса12-холестерина) (С10) в положении 33. Лактамный мостик находится между положением 16 (i) и 20 (i+4) и предназначен для стабилизации альфа-спиральной конформации пептида и для стабилизации пептида против протеолитического разрушения.

ОХМ392, 395 и 398 отличаются только одной аминокислотой, которая находится в положении 2.

ОХМ399 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C10-СООН (SEQ ID NO:83). ОХМ399 конструировали для получения D-Ser (s) в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(окса12-холестерина) (С10) в положении 33. ОХМ399 отличается от ОХМ392 только тем, что он не имеет лактамный мостик, который присутствует в ОХМ392.

ОХМ400 имеет структуру HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C10-СООН (SEQ ID NO:84). ОХМ400 конструировали для получения Aib (D) в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(окса12-холестерина) (С10) в положении 33. ОХМ400 отличается от ОХМ395 только тем, что он не имеет лактамный мостик, который присутствует в ОХМ395.

ОХМ401 имеет структуру Н-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-С10-СООН (SEQ ID NO:85). ОХМ401 конструировали для получения Acb в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(окса12-холестерина) (С10) в положении 33. ОХМ401 отличается от ОХМ398 только тем, что он не имеет лактамный мостик, который присутствует в ОХМ398. ОХМ399, ОХМ400 и 401 отличаются друг от друга аминокислотой в положении 2.

ОХМ404 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-K(γE-пальмитоил)-СОМН2 (SEQ ID NO:86). ОХМ404 конструировали для получения D-Ser (s) в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и пальмитоильной группой, одного Lys(γЕ-пальмитоил) в положении 33. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ406 имеет структуру HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-γE-C10-CONH2 (SEQ ID NO:87). ОХМ406 конструировали для получения D-Ser (s) в положении 2, замены Ser16Glu, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и холестерином, одного Cys(окса12-холестерин) (С10) в положении 33. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ407 имеет структуру HsQGTFTSDYSKYLDSRRAK(γE-пальмитоил)DFVQWLMNTK-γEγE-CONH2 (SEQ ID NO:88). ОХМ407 конструировали для получения D-Ser (s) в положении 2, двух гамма-глутаминовых кислот в положениях 31 и 32 в качестве спейсера между пептидной последовательностью и пальмитоильной группой, одного Lys(γЕ-пальмитоил) в положении 33. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ408 имеет структуру HsQGTFTSDYSKYLDSRRAK(γE-γE-пальмитоил)DFVQWLMNTK-γE-CONH2 (SEQ ID NO:89). ОХМ408 конструировали для получения D-Ser (s) в положении 2, одной гамма-глутаминовой кислоты в положении 31, и пальмитоильной группы, связанной с двумя остатками γ-глутаминовой кислоты и с боковой цепью аминогруппы лизина Lys(γЕ-γЕ-пальмитоил)] в положении 20. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ409 имеет структуру HsQGTFTSDK(γE-γE-пальмитоил)SKYLDSRRADFVQWLMNTK-CONH2 (SEQ ID NO:89). OXM409 конструировали для получения D-Ser (s) в положении 2 и пальмитоильной группы, связанной с двумя остатками γ-глутаминовой кислоты и с боковой цепью аминогруппы лизина [Lys(γЕ-γЕ-пальмитоил)] в положении 10. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ410 имеет структуру HsQGTFTSDYSKYLDERRAK(γE-γE-пальмитоил)DFVQWLMNTK-CONH2 (SEQ ID NO:91). ОХМ410 конструировали для получения D-Ser (s) в положении 2, замены Ser16Glu и пальмитоильной группы, связанной с двумя остатками γ-глутаминовой кислоты и с боковой цепью аминогруппы лизина [Lys(γЕ-γЕ-пальмитоил)] в положении 20. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ411 имеет структуру HsQGTFTSDK(γE-γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:92). ОХМ411 конструировали для получения D-Ser (s) в положении 2, замены Ser16Glu и пальмитоильной группы, связанной с двумя остатками γ-глутаминовой кислоты и с боковой цепью аминогруппы лизина [Lys(γЕ-γЕ-пальмитоил)] в положении 10. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ412 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C11-СООН (SEQ ID NO:93). ОХМ412 конструировали для получения D-Ser (s) в положении 2, двух остатков гамма-глутаминовой кислоты в положениях 31 и 32 в виде спейсера между пептидной последовательностью и холестерином, одного Cys(окса24-холестерин) (С11) в положении 33. ОХМ412 отличается от ОХМ399 длиной окса-спейсера, связанного с холестериновой группой. Структура С11 показана ниже.

ОХМ413 имеет структуру HαDGTFTSDYSKYLDSRRAQDFVK(DOTA)WLmNTK-γE-γE-C10-CONH2 (SEQ ID NO:94). ОХМ413 конструировали в виде пептида для воспроизведения, нацеленного на GLP-1R in vivo. Последовательность содержит Aib в положении 2, Asp в положении 3 для придания селективности по GLP-1R, Lys(DOTA) в положении 24, Met(O) в положении 27, двух остатков гамма-глутаминовой кислоты в положениях 31 и 32 в виде спейсера между пептидной последовательностью и холестерином, одного Cys(окса12-холестерин) (С10) в положении 33. Пептид в данном варианте осуществления амидирован по С-концу. Структура Fmoc-Lys(DOTA)-OH показана ниже.

ОХМ414 имеет структуру HsQGTFTSDK(γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-YE-CONH2 (SEQ ID NO:95). ОХМ414 конструировали для получения D-Ser (s) в положении 2, двух γ-глутаминовых кислот в положении 31, замены Ser16Glu и пальмитоильной группы, связанной с боковой цепью аминогруппы лизина Lys(пальмитоил)] в положении 10. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ415 имеет структуру HsQGTFTSDK(пальмитоил)SKYLDERRAQDFVQWLMNTK-γE-γE-CONH2 (SEQ ID NO:96). ОХМ415 конструировали для получения D-Ser (s) в положении 2, одной γ-глутаминовой кислоты в положении 31, замены Ser16Glu и пальмитоильной группы, связанной с одним остатком γ-глутаминовой кислоты и с боковой цепью аминогруппы лизина [Lys(γE-пальмитоил)] в положении 10. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ416 имеет структуру HαQGTFTSDK(γE-γE-nanbMHTonn)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:97). ОХМ416 конструировали для получения Aib (α) в положении 2, замены Ser16Glu и пальмитоильной группы, связанной с двумя остатками γ-глутаминовой кислоты и с боковой цепью аминогруппы лизина Lys(γЕ-γЕ-пальмитоил)] в положении 10. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ417 имеет структуру H-Acb-QGTFTSDK(γE-γE-nanbMHTonn)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:98). ОХМ417 конструировали для получения Acb в положении 2, замены Ser16Glu и пальмитоильной группы, связанной с двумя остатками γ-глутаминовой кислоты и с боковой цепью аминогруппы лизина Lys(γЕ,γЕ-пальмитоил)] в положении 10. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ418 имеет структуру HsQGTFTSDK(γE-γE-пальмитоил)SKYLDaRRAQDFVQWLMNTK-γE-CONH2 (SEQ ID NO:99). ОХМ418 конструировали для получения D-Ser (s) в положении 2, одной гамма-глутаминовой кислоты в положении 31, замены Ser16Aib (a) и пальмитоильной группы, связанной с двумя остатками γ-глутаминовой кислоты и с боковой цепью аминогруппы лизина Lys(γЕ-γЕ-пальмитоил)] в положении 10. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ419 имеет структуру HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-K(γE-пальмитоил)-СОNН2 (SEQ ID NO:100). ОХМ419 конструировали для получения Aib (a) в положении 2, двух γ-глутаминовых кислот в положениях 31 и 32 в виде спейсера между пептидной последовательностью и пальмитоильной группой, одного Lys(γЕ-пальмитоил) в положении 33. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ420 имеет структуру H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-К(γЕ-пальмитоил)-СОNН2 (SEQ ID NO:101). ОХМ420 конструировали для получения Acb в положении 2, двух γ-глутаминовых кислот в положениях 31 и 32 в виде спейсера между пептидной последовательностью и пальмитоильной группой, одного Lys(γE-пальмитоил) в положении 33. Пептид в данном варианте осуществления амидирован по С-концу.

ОХМ421 имеет структуру HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C12-СООН (SEQ ID NO:102). ОХМ421 конструировали для получения D-Ser (s) в положении 2, двух остатков гамма-глутаминовой кислоты в положениях 31 и 32 в виде спейсера между пептидной последовательностью и холестерином, одного Cys(окса12-O-холестерина) (С12) в положении 33. Cys(окса12-O-холестерин) отличается от Cys(окса12-холестерин) наличием холестерина, связанного через эфирную связь со спейсером окса12. Эфирная связь может придавать большую стабильность по отношению к сложноэфирной связи, присутствующей в Cys(окса12-холестерине) или группе С11. Структура Cys(окса12-O-холестерина) показана ниже.

Фармацевтические композиции

Дополнительно обеспечивают фармацевтические композиции, содержащие терапевтически эффективное количество одного или нескольких описанных здесь аналогов ОХМ для лечения нарушения обмена веществ у индивидуума. Такие нарушения включают в себя, но не ограничиваются ими, ожирение, метаболический синдром или синдром X, диабет II типа, осложнения при диабете, такие как ретинопатия, гипертензия, дислипидемия, сердечно-сосудистое заболевание, камни в желчном пузыре, остеоартрит и некоторые формы раков. Связанные с ожирением нарушения здесь связаны с ожирением, вызываемые (ожирением) или возникают в результате ожирения.

"Ожирение" ("тучность") означает состояние, при котором существует избыток телесного жира. Действующее определение ожирения основано на индексе массы тела (ВМI), вычисленного в виде массы тела на рост в метрах квадратных (кг/м2). "Ожирение" относится к состоянию, при котором иной здоровый субъект имеет индекс массы тела (ВМI), выше или равный 30 кг/м2, или состоянию, при котором субъект с по меньшей мере одним сопутствующим заболеванием имеет ВМI, выше или равный 27 кг/м2. Или же "страдающий ожирением (тучный) субъект" относится к здоровому субъекту с индексом массы тела (ВМI), выше или равном 30 кг/м2, или субъекту с по меньшей мере одним сопутствующим заболеванием с ВМI, выше или равном 27 кг/м2. Или же "субъект с риском ожирения" означает здоровый субъект с ВМI от 25 кг/м2 до менее чем 30 кг/м2, субъект с по меньшей мере одним сопутствующим заболеванием с ВМI 25 кг/м2 до менее чем 27 кг/м2.

Повышенные риски, связанные с ожирением, происходят при более низком индексе массы тела (ВМI) у жителей Азии. В азиатских странах, в том числе Японии, "ожирение" относится к состоянию, при котором субъект с по меньшей мере одним вызванным ожирением или связанным с ожирением сопутствующим заболеванием, которое требует снижения веса, или которое было бы улучшено снижением веса, имеет ВМI, выше или равный 25 кг/м2. В азиатских странах, в том числе Японии, "страдающий ожирением (тучный) субъект" относится к субъекту с по меньшей мере одним вызванным ожирением или связанным с ожирением сопутствующим заболеванием, которое требует снижения веса или которое было бы улучшено снижением веса, с ВМI, выше или равном 25 кг/м2. В азиатских странах "субъект с риском ожирения" означает субъект с ВМI выше чем 23 кг/м2 до менее чем 25 кг/м2.

В применении здесь термин "ожирение" предназначен для охвата всех перечисленных выше определений ожирения.

Вызванные ожирением или связанные с ожирением сопутствующие заболевания включают в себя, но не ограничиваются ими, диабет, инсулиннезависимый диабет 2 типа, нарушенную толерантность к глюкозе, нарушенную гликемию натощак, синдром инсулинорезистентности, дислипидемию (пер., нарушение липидного состава крови), гипертензию, гиперурикемию, подагру, болезнь коронарных артерий, инфаркт миокарда, стенокардию, синдром апноэ во сне, пикквикский синдром, жировую инфильтрацию печени; церебральный инфаркт, тромбоз сосудов головного мозга, преходящее ишемическое нарушение мозгового кровообращения, ортопедические нарушения, деформирующий артрит, люмбодиния, расстройство менструального цикла (дисменорею) и бесплодие. В частности, сопутствующие заболевания включают в себя: гипертензию, гиперлипидемию, дислипидемию, нарушение толерантности к глюкозе, сердечно-сосудистое заболевание, приступы апноэ во сне, сахарный диабет и другие связанные с ожирением состояния.

"Лечение" (ожирения и связанных с ожирением нарушений) относится к введению соединений данного изобретения для снижения или поддержания массы тела страдающего ожирением субъекта. Одним из результатов лечения может быть снижение массы тела страдающего ожирением субъекта относительно массы тела субъекта непосредственно перед введением соединений данного изобретения. Другим результатом лечения может быть предупреждение возврата к прежнему весу тела, весу тела, ранее утраченному в результате диеты, физических упражнений или медикаментозного лечения. Другим результатом лечения может быть снижение появления и/или тяжести связанных с ожирением заболеваний. Лечение соответствующим образом может приводить к уменьшению потребления субъектом пищи или калорий, в том числе общему сокращению поглощения пищи или сокращению поглощения конкретных компонентов диеты, таких как углеводы или жиры; и/или ингибированию поглощения питательных веществ; и/или ингибированию снижения скорости обмена веществ; и снижению веса пациентов, нуждающихся в этом. Лечение также приводит к изменению скорости обмена веществ, например к повышению скорости обмена веществ, вместо или в дополнение к ингибированию снижения скорости обмена веществ; и/или к минимизации метаболической резистентности, которая обычно является результатом потери веса.

"Предупреждение" (ожирения или связанных с ожирением нарушений) относится к введению соединений данного изобретения для снижения или поддержания массы тела субъекта с риском ожирения. Одним результатом предупреждения может быть снижение массы тела субъекта с риском ожирения относительно массы тела субъекта непосредственно перед введением соединений данного изобретения. Другим результатом предупреждения может быть предупреждение возврата к прежнему весу тела, весу тела, ранее утраченному в результате диеты, физических упражнений или медикаментозного лечения. Другим результатом предупреждения может быть предупреждение появления ожирения, если лечение проводится до начала ожирения у субъекта с риском ожирения. Другим результатом предупреждения может быть снижение появления и/или тяжести связанных с ожирением заболеваний, если лечение проводится до начала ожирения у субъекта с риском ожирения. Кроме того, если лечение начинают у уже страдающего ожирением субъекта, то такое лечение может предупреждать появление, прогрессирование или тяжесть связанных с ожирением заболеваний, таких как, но не ограничиваются ими, атеросклероз, диабет II типа, болезнь поликистозных яичников, сердечно-сосудистое заболевание, остеоартрит, кожные заболевания, гипертензия (гипертония), инсулинрезистентность, гиперхолестеринемия, гипертриглицеридемия и желчнокаменная болезнь.

Связанные с ожирением заболевания здесь ассоциированы с ожирением, вызываемые ожирением или происходят в результате ожирения. Примеры связанных с ожирением заболеваний включают в себя переедание и булимию, гипертензию, диабет, повышенные концентрации инсулина в плазме крови и инсулинрезистентность, дислипидемию, гиперлипидемию, рак внутриматочный, молочных желез, предстательной железы и рак ободочной кишки, остеоартрит, синдром обструктивного апноэ во сне, желчнокаменную болезнь, камни в желчном пузыре, сердечное заболевание, нерегулярные сердечные сокращения и аритмию, инфаркт миокарда, застойную сердечную недостаточность, ишемическую болезнь сердца, скоропостижную смерть, удар, болезнь поликистозных яичников, краниофарингиому, синдром Прадера-Вилли, синдром Фрелиха, субъектов с дефицитом гормона роста, нормальный вариант низкорослости, синдром Турнера (Тернера) и другие патологические состояния, указывающие на пониженную метаболическую активность или сокращение расхода энергии в состоянии покоя как процент общей масса тела без жира, например, у детей с острым лимфоцитарным лейкозом. Дополнительные примеры связанных с ожирением нарушений представляют собой метаболический синдром, также известный как синдром X, синдром инсулинорезистентности, репродуктивная и сексуальная дисфункция, например бесплодие, гипогонадизм у мужчин и гирсутизм у женщин, нарушения двигательной активности желудочно-кишечного тракта, например связанный с ожирением гастроэзофагеальный рефлюкс, респираторные заболевания, например синдром гиповентиляции вследствие ожирения (пикквикский синдром), сердечно-сосудистые нарушения, воспаление, например системное воспаление сосудистой системы, артериосклероз, гиперхолестеринемия, гиперурикемия, люмбаго, заболевание желчного пузыря, подагра и рак почки. Соединения данного изобретения также применимы для снижения риска снижения вторичных последствий ожирения, например снижения риска гипертрофии левого желудочка.

В применении здесь термин "диабет" включает в себя как инсулинозависимый сахарный диабет (IDDM, также известен как сахарный диабет I типа) и инсулиннезависимый сахарный диабет (NIDDM, также известен как сахарный диабет II типа). Сахарный диабет I типа, или инсулинозависимый сахарный диабет, является результатом абсолютного дефицита инсулина, гормона, который регулирует утилизацию глюкозы. Сахарный диабет II типа, или инсулиннезависимый сахарный диабет (т.е. инсулиннезависимый сахарный диабет), часто происходит в условиях нормальных или даже повышенных уровней инсулина и, очевидно, является результатом неспособности тканей отвечать должным образом на инсулин. Большинство из страдающих диабетом II типа также страдают ожирением. Соединения данного изобретения применимы как для диабета I типа, так и для диабета II типа. Соединения особенно эффективны для лечения диабета II типа. Соединения данного изобретения также применимы для лечения и/или предупреждения гестационного сахарного диабета.

Патент США №6852690, который включен в изобретение полностью, раскрывает способы стимуляции метаболизма питательных веществ, содержащие введение пациенту, не страдающему диабетом, композиции, содержащей эффективное с точки зрения питания количество одного или нескольких питательных веществ или их любой комбинации, и одного или нескольких инсулинотропных пептидов. Описанные здесь пептидные аналоги ОХМ являются инсулинотропными и могут быть введены пациентам с нарушенным метаболизмом глюкозы, например с инсулинрезистентностью, но не с сахарным клиническим диабетом, а также пациентам, которые по каким-либо причинам не могут получать питание через пищеварительный тракт. Такие пациенты включают в себя хирургических больных, коматозных больных, шоковых больных, пациентов с желудочно-кишечным заболеванием, пациентов с заболеванием, связанным с гормонами пищеварения, и т.п. В частности, страдающие ожирением пациенты, пациенты с атеросклерозом, пациенты с сосудистым заболеванием, пациенты с гестационным сахарным диабетом, пациенты с заболеванием печени, например с циррозом печени, пациенты с акромегалией, пациенты с избытком глюкокортикоидов, например при лечении кортизолом или с синдромом Кушинга, пациенты с активированными контррегуляторными гормонами, таких, которые возникнут после травмы, несчастных случаев и (хирургической) операции и т.п., пациенты с гипертриглицеридемией и пациенты с хроническим панкреатитом могут быть легко и соответствующим образом снабжены питанием в соответствии с изобретением, не подвергая пациента гипо- или гипергликемии. В частности, введение такому пациенту преследует цель обеспечить терапию по доставке как можно быстрее пищевых и энергетических потребностей пациенту наряду с поддержанием глюкозы в плазме пациента ниже так называемого порога выведения приблизительно от 160 до 180 миллиграмм на децилитр глюкозы в крови. Хотя здоровые пациенты, не имеющие уровни глюкозы несколько ниже порога выведения, также могут быть подвергнуты лечению в соответствии с данным изобретением, как описано выше, пациенты с нарушенным метаболизмом глюкозы, например пациенты с гипергликемией, уровень глюкозы в плазме которых находится чуть выше порога выведения, также находят терапию подходящей для их состояния. В частности, такие пациенты, у которых степень гипергликемии ниже порога выведения с интермиттирующими интервалами, могут получать комбинацию лечения питательными веществами плюс инсулинотропными пептидами в соответствии с любым из следующих режимов. Здоровые пациенты, не страдающие от такой гипергликемии, также могут быть лечены с использованием описанных здесь пептидных аналогов.

Описанные здесь пептидные аналоги ОХМ могут быть использованы в фармацевтической композиции при комбинировании с фармацевтически приемлемым носителем. Такие композиции содержат терапевтически эффективное количество одного или нескольких описанных здесь аналогов ОХМ и фармацевтически приемлемый носитель. Такая композиция также может состоять из (в дополнение к описанному здесь аналогу ОХМ и носителю) разбавители, наполнители, соли, буферы, стабилизаторы, солюбилизаторы и другие материалы, хорошо известны в данной области. Композиции, содержащие описанные здесь аналоги ОХМ, могут быть введены, при желании, в форме солей, при условии, что соли являются фармацевтически приемлемыми. Соли могут быть получены с использованием стандартных процедур, известных специалистам в области синтетической органической химии.

Термин "индивидуум" предназначен для включения людей и сопутствующих или одомашненных животных, таких как собаки, кошки, лошади и т.п. Таким образом, композиции, содержащие формулу I, также применимы для лечения или предупреждения ожирения и связанных с ожирением заболеваний у кошек и собак. По существу, термин "млекопитающее" включает в себя сопутствующих животных, таких как кошки и собаки.

Термин "фармацевтически приемлемые соли" относится к солям, полученным из фармацевтически приемлемых нетоксичных оснований или кислот, в том числе неорганических или органических оснований и неорганических или органических кислот. Соли, произведенные из неорганических оснований, включают в себя соли алюминия, аммония, кальция, меди, железа (3), железа (2), лития, магния, марганца (3), марганца (2), калия, натрия, цинка и т.п. Особенно предпочтительными являются соли аммония, кальция, магния, калия и натрия. Соли, произведенные из фармацевтически приемлемых органических нетоксичных оснований, включают в себя соли первичного, вторичного и третичного аминов, замещенных аминов, в том числе - природно встречающиеся замещенные амины, циклические амины, и катионные ионообменные смолы, такие как аргинин, бетаин, кофеин, холин, N,N'-дибензилэтилендиамин, диэтиламин, 2-диэтиламиноэтанол, 2-диметиламиноэтанол, этаноламин, этилендиамин, N-этилморфолин, N-этилпиперидин, глукамин, глюкозамин, гистидин, гидрабамин, изопропиламин, лизин, метилглюкамин, морфолин, пиперазин, пиперидин, полиаминовые смолы, прокаин, пурины, теобромин, триэтиламин, триметиламин, трипропиламин, трометамин и т.п. Термин "фармацевтически приемлемая соль" дополнительно включает в себя все приемлемые соли, такие как ацетат, лактобионат, бензолсульфонат, лаурат, бензоат, малат, бикарбонат, малеат, бисульфат, манделат, битартрат, мезилат, борат, метилбромид, бромид, метилнитрат, кальция эдетат, метилсульфат, камсилат, мукат, карбонат, напсилат, хлорид, нитрат, клавуланат, N-метилглюкамин, цитрат, соль аммония, дигидрохлорид, олеат, эдетат, оксалат, эдисилат, памоат (эмбонат), эстолат, пальмитат, эзилат, пантотенат, фумарат, фосфат/дифосфат, глюцептат, полигалактуронат, глюконат, салицилат, глутамат, стеарат, гликолиларсанилат, сульфат, гексилрезорцинат, субацетат, гидрабамин, сукцинат, гидробромид, таннат, гидрохлорид, тартрат, гидроксинафтоат, теоклат, йодид, тозилат, изотионат, триэтиодид, лактат, паноат, валерат и т.п., которые могут быть использованы в виде лекарственной формы для изменения растворимости или характеристики гидролиза или могут быть использованы в композициях с замедленным высвобождением или пролекарств. Будет понятным, что в применении здесь ссылки на описанные здесь аналоги ОХМ призваны также включать в себя фармацевтически приемлемые соли.

Как используют здесь, термин "фармацевтически приемлемый" означает нетоксичный материал, который не препятствует эффективности биологической активности активного ингредиента (ингредиентов), одобренный государственным контрольным органом или властью штата, или перечисленный в Фармакопее США или другой общепризнанной фармакопее для применения на животных и более конкретно, на людях. Термин "носитель" относится к разбавителю, адъюванту, вспомогательному веществу или носителю, с которым вводят терапевтическое средство, включает в себя, но не ограничивается ими, такие стерильные жидкости как вода и масла. Характеристики носителя будут зависеть от способа введения. Описанные здесь аналоги ОХМ могут быть в виде мономеров (например, гетеродимеров или гомодимеров) или в виде комплексов с самим собой или другими пептидами. Таким образом, фармацевтические композиции данного изобретения могут содержать один или несколько описанных здесь аналогов ОХМ в такой форме мультимера или в форме образованного комплекса.

В применении здесь, термин "терапевтически эффективное количество" означает общее количество каждого активного компонента фармацевтической композиции или способ, который достаточен для выявления значимой пользы для пациента, т.е. лечения, заживления, предупреждения или улучшения релевантного медицинского показания, или повышает скорость лечения, заживления, предупреждения или улучшения таких состояний. При применении к отдельному активному ингредиенту, введенному в чистом виде, термин относится к этому ингредиенту в чистом виде. При применении к комбинации, термин относится к комбинированным количествам активных ингредиентов, которые вызывают терапевтический эффект, независимо от того вводят ли в сочетании, серийно или совместно.

Фармацевтическая композиция может содержать один или несколько описанных здесь аналогов ОХМ; один или несколько описанных здесь аналогов ОХМ и один или несколько других агентов для лечения метаболического нарушения; или фармацевтическая композиция, содержащая один или несколько описанных здесь аналогов ОХМ может быть использована одновременно с фармацевтической композицией, содержащей агент для лечения метаболического нарушения. Такие нарушения включают в себя, но не ограничиваются ими, ожирение, метаболический синдром или синдром X, сахарный диабет II типа, осложнения, вызванные диабетом, гипертензию, дислипидемию, сердечно-сосудистое заболевание, камни в желчном пузыре, остеоартрит и некоторые формы раков.

В тех случаях, когда фармацевтическая композиция содержит другой агент для лечения метаболического нарушения или лечение включает в себя другую фармацевтическую композицию, содержащую агент для лечения метаболического нарушения, агент включает в себя, но не ограничивается ими, агонисты каннабиноидных рецепторов (СВ1), агонисты рецепторов глюкагоноподобного пептида 1 (GLP-1), ингибиторы липазы, лептин, тетрагидролипстатин, 2-4-динитрофенол, акарбозу, сибутрамин, фентамин, блокаторы абсорбции жира, симвастатин, мевастатин, эзетимиб, аторвастатин, ситаглиптин, метформин, орлистат, Кнекса, топирамат, налтрексон, буприопин, фентермин, лозартан, лозартан с гидрохлортиазидом и т.п.

Подходящие агенты для применения в сочетании с соединением данного изобретения включают в себя, но не ограничиваются ими:

(a) агонист рецептора нейромедина U, как описано в международной заявке на патент № WO 2007/109135.

(b) противодиабетические агенты, такие как (1) агонисты PPARy, такие как глитазоны (например, циглитазон; дарглитазон; энглитазон; изаглитазон (МСС-555); пиоглитазон (ACTOS); розиглитазон (AVANDIA); троглитазон; ривоглитазон, BRL49653; CLX-0921; 5-BTZD, GW-0207, LG-100641, R483 и LY-300512 и т.п. и соединения, описанные в WO 97/10813, 97/27857, 97/28115, 97/28137, 97/27847, 03/000685 и 03/027112 и SPPARMS (селективные модуляторы PPAR-гамма), например Т131 (Amgen), FK614 (Fujisawa), нетоглитазон и метаглидазен; (2) бигуаниды, такие как буформин; метформин; и фенформин и т.п.; (3) ингибиторы протеинтирозинфосфатазы-18 (РТР-1В), такие как ISIS 113715, А-401674, А-364504, IDD-3, IDD 2846, КР-40046, KR61639, МС52445, МС52453, С7, ОС-060062,-ОС-86839, ОС29796, ТТР-277 ВС1, и эти агенты описаны в WO 04/041799, 04/050646, 02/26707, 02/26743, 04/092146, 03/048140, 04/089918, 03/002569, 04/065387, 04/127570 и US 2004/167183; (4) сульфонилмочевины, такие как ацетогексамид; хлорпропамид; диабинез; глибенкламид; глипизид; глибурид; глимепирид; гликлазид; глипентид; гликвидон; глизоламид; толазамид и толбутамид и т.п.; (5) меглитиниды, такие как репаглинид, метиглинид (GLUFAST) и натеглинид и т.п.; (6) ингибиторы альфа-глюкозидгидролаз, такие как акарбоза; адипозин; камиглибоза; эмиглитат; миглитол; воглибоза; прадимицин-Q; сальбостатин; CKD-711; MDL-25,637; MDL-73,945 и MOR 14 и т.п.; (7) ингибиторы альфа-амилазы, такие как тендамистат, трестатин и AI-3688 и т.п.; (8) стимуляторы секреции инсулина, такие как линоглирид, натеглинид, митиглинид (GLUFAST), ID1101 А-4166 и т.п.; (9) ингибиторы окисления жирных кислот, такие как кломоксир и этомоксир и т.п.; (10) антагонисты А2, такие как мидаглизол; изаглидол; дериглидол; идазоксан; эароксан и флупароксан и т.п.; (11) инсулин или миметики инсулина, такие как биота, LP-100, новарапид, инсулин детемир, инсулин лиспро, инсулин гларгин, инсулин-цинк суспензия (ленте и ультраленте); инсулин Lys-Pro, GLP-1 (17-36), GLP-1 (73-7) (инсулинтропин); GLP-1 (7-36)-NH2) эксенатид/эксендин-4, эксенатид LAR, линаглутид, AVE0010, CJC 1131, BIM51077, CS 872, TH0318, BAY-694326, GP010, ALBUGON (GLP-1 слитый с альбумином), HGX-007 (агонист Ерас), S-23521, и соединения, описанные в WO 04/022004, WO 04/37859 и т.п.; (12) не относящиеся к тиазолидиндионам, такие как JT-501 и фарглитазар (GW-2570/GI-262579) и т.п.; (13) двойные агонисты PPARa/y, такие как АУЕ 0847, CLX-0940, GW-1536, GW1929, GW-2433, KRP-297, L-796449, LBM 642, LR-90, LY510919, МК-0767, ONO 5129, SB 219994, TAK-559, TAK-654, 677954 (GlaxoSmithkline), E-3030 (Eisai), LY510929 (Lilly), АК109 (Asahi), DRF2655 (Dr. Reddy), DRF8351 (Dr. Reddy), MC3002 (Maxocore), TY51501 (ToaEiyo), навеглитазар, мураглитазар, пелиглитазар, тезаглитазар (GALIDA), реглитазар (JTT-501), чиглитазар (chiglitazar), и те, которые описаны в WO 99/16758, WO 99/19313, WO 99/20614, WO 99/38850, WO 00/23415, WO 00/23417, WO 00/23445, WO 00/50414, WO 01/00579, WO 01/79150, WO 02/062799, WO 03/033481, WO 03/033450, WO 03/033453; и (14) другие инсулинсенсибилизирующие лекарственные средства; (15) агонисты рецептора VPAC2; (16) GLK-модуляторы, такие как PSN105, RO 281675, RO 274375, и те, которые описаны в WO 03/015774, WO 03/000262, WO 03/055482, WO 04/046139, WO 04/045614, WO 04/063179, WO 04/063194, WO 04/050645 и т.п.; (17) ретиноидные модуляторы, такие как описанные в WO 03/000249; (18) ингибиторы GSK 3-бета/GSK 3, такие как 4-[2-(2-бромофенил)-4-(4-фторфенил-1Н-имидазол-5-ил]пиридин, СТ21022, СТ20026, СТ-98023, SB-216763, SB410111, SB-675236, CP-70949, XD4241, и эти соединения описаны в WO 03/037869, 03/03877, 03/037891, 03/024447, 05/000192, 05/019218 и т.п.; (19) ингибиторы гликогенфосфорилазы (HGLPa), такие как AVE 5688, PSN 357, GPi-879, которые описаны в WO 03/037864, WO 03/091213, WO 04/092158, WO 05/013975, WO 05/013981, US 2004/0220229 и JP 2004-196702 и т.п.; (20) промоторы потребления АТФ, такие как промоторы, описанные в WO 03/007990; (21) фиксированные комбинации агонистов PPARy и метформина, например AVANDAMET; (22) пан-PPAR-агонисты, такие как GSK 677954; (23) GPR40 (рецептор, сопряженный с G-белком, 40), также называемый SNORF 55, например BG 700, и такие как описаны в WO 04/041266, 04/022551, 03/099793; (24) GPR119 (также называемый RUP3; SNORF 25), например RUP3, HGPRBMY26, PFI 007, SNORF 25; (25) антагонисты аденозинового 2 В-рецептора, такие как ATL-618, ATI-802, E3080 и т.п.; (26) ингибиторы карнитинпальмитоилтрансферазы, например ST 1327 и ST 1326 и т.п.; (27) ингибиторы фруктозо-1,6-дифосфатазы, например CS-917, MB7803 и т.п.; (28) антагонисты глюкагона, например АТ77077, BAY 694326, GW 4123X, NN2501, и антагонисты, описанные в WO 03/064404, WO 05/00781, US 2004/0209928, US 2004/029943 и т.п.; (30) ингибиторы глюкозо-6-фосфатазы; (31) ингибиторы фосфоенолпируваткарбоксикиназы (РЕРСК); (32) активаторы киназы пируватдегидрогеназы (PDK); (33) агонисты RXR, такие как МС1036, CS00018, JNJ 10166806 и такие, как описаны в WO 04/089916, US 6759546 и т.п.; (34) ингибиторы SGLT, такие как AVE 2268, KGT 1251, T1095/RWJ 394718; (35) BLX-1002;

(с) агенты, снижающие уровень липидов, такие как (1) секвестранты желчных кислот, такие как холестирамин, колесевелам (colesevelem), колестипол, диалкиламиноалкил производные перекрестносшитого декстрана; Colestid®; LoCholest®; и Questran® и т.п.; (2) ингибиторы HMG-CoA-редуктазы, такие как аторвастатин, итавастатин, питавастатин, флувастатин, ловастатин, правастатин, ривастатин, розувастатин, симвастатин, розувастатин (ZD-4522) и т.п., конкретно симвастатин; (3) ингибиторы HMG-CoA-синтазы; (4) ингибиторы абсорбции холестерина, такие как FMVP4 (Forbes Medi-Tech), KT6-971 (Kotobuki Pharmaceutical), FM-VA12 (Forbes Medi-Tech), FM-VP-24 (Forbes Medi-Tech), сложные эфиры станола, бета-ситостерол, гликозиды стерола, такие как тиквезид; и азетидиноны, такие как эзетимиб, и те, которые описаны в WO 04/005247 и т.п.; (5) ингибиторы ацил-коэнзим А-холестерин-ацилтрансферазы (АСАТ), такие как авазимиб, эфлюцимиб, пактимиб (KY505), SMP 797 (Sumitomo), SM32504 (Sumitomo) и те, которые описаны в WO 03/091216 и т.п.; (6) ингибторы СЕТР, такие как JTT 705 (Japan Tobacco), торцетрапиб, СР 532,632, BAY63-2149 (Bayer), SC 591, SC 795 и т.п.; (7) ингибиторы скваленсинтетазы; (8) антиоксиданты, такие как пробукол и т.п.; (9) агонисты PPARa, такие как беклофибрат, бензафибрат, ципрофибрат, клофибрат, этофибрат, фенофибрат, гемкабен и гемфиброзил, GW 7647, ВМ 170744 (Kowa), LY518674 (Lilly), GW590735 (GlaxoSmithkline), KRP-101 (Kyorin), DRF10945 (Dr. Reddy), NS-220/R1593 (Nippon Shinyaku/Roche, ST1929 (Sigma Таи) МС3001/МС3004 (MaxoCore Pharmaceuticals), гемкабен-кальций, другие производные фиброевой кислоты, такие как атромид®, лопид® и трикор®, и те, которые описаны в патенте США №US 6548538 и т.п.; (10) модуляторы рецептора FXR, такие как GW 4064 (GlaxoSmithkline), SR 103912, QRX401, LN-6691 (Lion Bioscience), и описанные в WO 02/064125, WO 04/045511, и т.п.; (11) модуляторы рецептора LXR, такие как GW 3965 (GlaxoSmithkline), T9013137 и ХТС0179628 (X-Ceptor Therapeutics/Sanyo) и описанные в WO 03/031408, WO 03/063796, WO 04/072041, и т.п.; (12) ингибиторы синтеза липопротеинов, такие как ниацин; (13) ингибиторы системы ренин-ангиотензин; (14) частичные агонисты PPAR-δ, такие как описанные в WO 03/024395; (15) ингибиторы реабсорбции желчных кислот, такие как BARI 1453, SC435, РНА384640, S8921, AZD7706, и т.п., и секвестранты желчных кислот, такие как колесевелам (WELCHOL/ CHOLESTAGEL), (16) агонисты PPAR-γ, такие как GW 501516 (Ligand, GSK), GW 590735, GW-0742 (GlaxoSmithkline), T659 (Amgen/Tularik), LY934 (Lilly), NNC610050 (Novo Nordisk) и описанные в WO 97/28149, WO 01/79197, WO 02/14291, WO 02/46154, WO 02/46176, WO 02/076957, WO 03/016291, WO 03/033493, WO 03/035603, WO 03/072100, WO 03/097607, WO 04/005253, WO 04/007439 и JP 10237049 и т.п.; (17) ингибиторы синтеза триглицеридов; (18) ингибиторы микросомального транспорта триглицеридов (МТТР), такие как имплитапид, LAB687, JTT130 (Japan Tobacco), CP346086 и описанные в WO 03/072532 и т.п.; (19) модуляторы транскрипции; (20) ингибиторы скваленэпоксидазы; (21) индукторы рецептора липопротеина низкой плотности (LDL); (22) ингибиторы агрегации тромбоцитов; (23) ингибиторы 5-LO или FLAP; и (24) агонисты рецептора никотиновой кислоты (ниацина), в том числе агонисты НМ74А; (25) модуляторы PPAR, такие как описанные в WO 01/25181, WO 01/79150, WO 02/79162, WO 02/081428, WO 03/016265, WO 03/033453; (26) связанный с ниацином хром, как описано в WO 03/039535; (27) замещенные производные кислот, описанные в WO 03/040114; (28) HDL для инфузии, такие как LUV/ETC-588 (Pfizer), APO-A1 Milano/ETC216 (Pfizer), ETC-642 (Pfizer), ISIS301012, D4F (Bruin Pharma), синтетические тримерные ApoA1, Bioral Apo A1, направленные на пенистые клетки и т.п.; (29) ингибиторы 1 ВАТ, такие как BARI143/HMR145A/ HMR1453 (Sanofi-Aventis, РНА384640Е (Pfizer), S8921 (Shionogi) AZD7806 (AstrZeneca), AK105 (Asah Kasei) и т.п.; (30) ингибиторы Lp-PLA2, такие как SB480848 (GlaxoSmithkline), 659032 (GlaxoSmithkline), 677116 (GlaxoSmithkline) и т.п.; (31) другие агенты, которые влияют на липидный состав, в том числе ETC1001/ESP31015 (Pfizer), ESP-55016 (Pfizer), AGI1067 (AtheroGenics), АС3056 (Amylin), AZD4619 (AstrZeneca); и

(d) анти-гипертензивные агенты, такие как (1) диуретики, такие как тиазиды, в том числе хлорталидон, хлортиазид, дихлорфенамид, гидрофлюметиазид, индапамид и гидрохлортиазид; петлевые диуретики, такие как буметамид, этакриновая кислота, фуросемид и торсемид; калийсберегающие мочегонные средства, такие как амилорид и триамтерен; и антагонисты альдостерона, такие как спиронолактон, эпиренон и т.п.; (2) бета-адреноблокаторы, такие как ацебутолол, атенолол, бетаксолол, бевантолол, бисопролол, бопиндолол, картеолол, карведилол, целипролол, эсмолол, инденолол, метапролол, надолол, небиволол, пенбутолол, пиндолол, пропанолол, соталол, тертатолол, тилизолол и тимолол и т.п.; (3) блокаторы кальциевых каналов, такие как амлодипин, аранидипин, азелнидипин, барнидипин, бенидипин, бепридил, циналдипин, клевидипин, дилтиазем, эфонидипин, фелодипин, галлопамил, израдипин, лацидипин, лемилдипин, лерканидипин, никардипин, нифедипин, нилвадипин, нимодепин, низолдипин, нитрендипин, манидипин, пранидипин и верапамил и т.п.; (4) ингибиторы ангиотензин-конвертирующего фермента (АСЕ), такие как беназеприл; каптоприл; цилазаприл; делаприл; эналаприл; фозиноприл; имидаприл; лозиноприл; моэксиприл; квинаприл; квинаприлат; рамиприл; периндоприл; периндроприл; кваниприл; спираприл; тенокаприл; трандолаприл и зофеноприл и т.п.; (5) ингибиторы нейтральных эндопептидаз, такие как омапатрилат, кадоксатрил и экадотрил, фозидотрил, сампатрилат, AVE7688, ER4030 и т.п.; (6) антагонисты эндотелина, такие как тезозентан, А308165 и YM62899 и т.п.; (7) вазодилататоры (сосудорасширяющие), такие как гидралазин, клонидин, миноксидил и никотиниловый спирт и т.п.; (8) антагонисты рецепторов ангиотензина II, такие как кандесартан, эпросартан, ирбесартан, лосартан, пратосартан, тазосартан, телмисартан, валсартан и ЕХР-3137, FI6828K и RNH6270 и т.п.; (9) α/β-адреноблокаторы, такие как нипрадилол, аротинолол и амозулалол и т.п.; (10) альфа1-блокаторы, такие как теразозин, урапидил, празозин, буназозин, тримазозин, доксазозин, нафтодипил, индорамин, WHIP 164 и XEN010 и т.п.; (11) альфа-2 агонисты, такие как лофексидин, тиаменидин, моксонидин, рилменидин и гуанабенз и т.п.; (12) ингибиторы альдостерона и т.п.; (13) ангиопоэтин-2 связывающие агенты, такие как агенты, описанные в WO 03/030833; и

(e) агенты против ожирения, такие как (1) ингибиторы транспорта 5НТ (серотонина), такие как пароксетин, флуоксетин, фенфлурамин, флувоксамин, сертралин и имипрамин, и агенты, описанные в WO 03/00663, а также ингибиторы обратного захвата серотонина/норэпинефрина, такие как сибутрамин (MERIDIA/REDUCTIL) и ингибитор захвата дофамина/ингибиторы захвата норэпинефрина, такие как радафаксин гидрохлорид, 353162 (GlaxoSmithkline) и т.п.; (2) ингибиторы транспорта NE (норэпинефрина), такие как GW 320659, деспирамин, талсупрам и номифензин; (3) антагонист СВ1 (каннабиноидного рецептора СВ1)/обратных агонистов, такие как римонабант (ACCOMPLIA Sanofi Synthelabo), SR-147778 (Sanofi Synthelabo), AVE1625 (Sanofi-Aventis), BAY 65-2520 (Bayer), SLV 319 (Solvay), SLV326 (Solvay), CP945598 (Pfizer), E-6776 (Esteve), 01691 (Organix), ORG14481 (Organon), VER24343 (Vernalis), NESS0327 (Univ of Sassari/Univ of Cagliari), и описанные в патентах США №№4973587, 5013837, 5081122, 5112820, 5292736, 5532237, 5624941, 6028084 и 6509367; и WO 96/33159, WO 97/29079, WO 98/31227, WO 98/33765, WO 98/37061, WO 98/41519, WO 98/43635, WO 98/43636, WO 99/02499, WO 00/10967, WO 00/10968, WO 01/09120, WO 01/58869, WO 01/64632, WO 01/64633, WO 01/64634, WO 01/70700, WO 01/96330, WO 02/076949, WO 03/006007, WO 03/007887, WO 03/020217, WO 03/026647, WO 03/026648, WO 03/027069, WO 03/027076, WO 03/027114, WO 03/037332, WO 03/040107, WO 04/096763, WO 04/111039, WO 04/111033, WO 04/111034, WO 04/111038, WO 04/013120, WO 05/000301, WO 05/016286, WO 05/066126 и ЕР-658546 и т.п.; (4) агонисты/антагонисты грелина, такие как BVT81-97 (BioVitrum), RC1291 (Rejuvenon), SRD-04677 (Sumitomo), неацилированный грелин (TheraTechnologies) и, описанные в WO 01/87335, WO 02/08250, WO 05/012331 и т.п.; (5) антагонист/обратные агонисты Н3 (гистамина Н3), такие как тиоперамид, 3-(1Н-имидазол-4-ил)пропил-N-(4-пентенил)карбамат), клобенпропит, иодофенпропит, имопроксифан, GT2394 (Gliatech) и А331440 и агонисты, описанные в WO 02/15905; и О-[3-(1Н-имидазол-4-ил)пропанол]карбаматы (Kiec-Kononowicz, К. et al., Pharmazie, 55:349-55 (2000)), пиперидин-содержащие антагонисты рецептора гистамина НЗ (Lazewska, D. et al., Pharmazie, 56:927-32 (2001), производные бензофенона и родственные соединения (Sasse, A. et al., Arch. Pharm.(Weinheim) 334:45-52 (2001)), замещенные N-фенилкарбаматы (Reidemeister, S. et al., Pharmazie, 55:83-6 (2000)) и производные проксифана (Sasse, A. et al., J. Med. Chem.. 43:3335-43 (2000)) и модуляторы рецептора гистамина НЗ, такие как описанные в WO 03/024928 и WO 03/024929; (6) антагонисты рецептора меланиноконцентрирующего гормона 1 (MCH1R), такие как Т-226296 (Takeda), Т71 (Takeda/Amgen), AMGN-608450, AMGN-503796 (Amgen), 856464 (GlaxoSmithkline), A224940 (Abbott), A798 (Abbott), ATC0175/AR224349 (Arena Pharmaceuticals), GW803430 (GlaxoSmithkine), NBI-1A (Neurocrine Biosciences), NGX-1 (Neurogen), SNP-7941 (Synaptic), SNAP9847 (Synaptic), T-226293 (Schering Plough), TPI-1361-17 (Saitama Medical School/University of California Irvine) и описанные в WO 01/21169, WO 01/82925, WO 01/87834, WO 02/051809, WO 02/06245, WO 02/076929, WO 02/076947, WO 02/04433, WO 02/51809, WO 02/083134, WO 02/094799, WO 03/004027, WO 03/13574, WO 03/15769, WO 03/028641, WO 03/035624, WO 03/033476, WO 03/033480, WO 04/004611, WO 04/004726, WO 04/011438, WO 04/028459, WO 04/034702, WO 04/039764, WO 04/052848, WO 04/087680; патентные заявки Японии №№JP 13226269, JP 1437059, JP2004315511 и т.п.; (7) агонист/антагонисты MCH2R (меланиноконцентрирующего гормона 2R); (8) антагонисты NPY1 (нейропептида Y Y1), такие как BMS205749, BIBP3226, J-115814, BIBO 3304, LY-357897, СР-671906 и GI-264879A; и описанные в патенте США №6001836; и WO 96/14307, WO 01/23387, WO 99/51600, WO 01/85690, WO 01/85098, WO 01/85173 и WO 01/89528; (9) антагонисты NPY5 (нейропептида Y Y5), такие как 152,804, S2367 (Shionogi), E-6999 (Esteve), GW-569180A, GW-594884A (GlaxoSmithkline), GW-587081X, GW-548118X; FR 235208; FR 226928, FR 240662, FR 252384; 1229U91, GI-264879A, CGP71683A, C-75 (Fasgen) LY-377897, LY366377, PD-160170, SR-120562A, SR-120819A, S2367 (Shionogi), JCF-104 и Н409/22; и те соединения, описанные в патентах США №№6140354, 6191160, 6258837, 6313298, 6326375, 6329395, 6335345, 6337332, 6329395 и 6340683; и ЕР-01010691, ЕР-01044970 и FR252384; и международные публикации согласно РСТ №№WO 97/19682, WO 97/20820, WO 97/20821, WO 97/20822, WO 97/20823, WO 98/27063, WO 00/107409, WO 00/185714, WO 00/185730, WO 00/64880, WO 00/68197, WO 00/69849, WO 01/09120, WO 01/14376, WO 01/85714, WO 01/85730, WO 01/07409, WO 01/02379, WO 01/02379, WO 01/23388, WO 01/23389, WO 01/44201, WO 01/62737, WO 01/62738, WO 01/09120, WO 02/20488, WO 02/22592, WO 02/48152, WO 02/49648, WO 02/051806, WO 02/094789, WO 03/009845, WO 03/014083, WO 03/022849, WO 03/028726, WO 05/014592, WO 05/01493; и Norman et al., J. Med. Chem. 43: 4288-4312 (2000); (10) лептин, например рекомбинантный человеческий лептин (PEG-OB, Hoffman La Roche) и рекомбинантный человеческий метиониллептин (Amgen); (11) производные лептина, такие как описаны в патентах №№5552524; 5552523; 5552522; 5521283; и WO 96/23513; WO 96/23514; WO 96/23515; WO 96/23516; WO 96/23517; WO 96/23518; WO 96/23519 и WO 96/23520; (12) антагонисты опиоида, такие как налмефен (Revex®), 3-метоксиналтрексон, налоксон и налтрексон; и описанные в WO 00/21509; (13) антагонисты орексина, такие как SB-334867-A (GlaxoSmithkline); и описанные в WO 01/96302, 01/68609, 02/44172, 02/51232, 02/51838, 02/089800, 02/090355, 03/023561, 03/032991, 03/037847, 04/004733, 04/026866, 04/041791, 04/085403 и т.п.; (14) агонисты BRS3 (рецептора бомбезина 3 субтипа); (15) агонисты ССК-А (холецистокинина-А), такие как АР-R 15849, GI 181771, JMV-180, A-71378, A-71623, PD170292, PD 149164, SR146131, SR125180, бутабиндид, и те, которые описаны в патенте США №5739106; (16) CNTF (цилиарные нейротрофические факторы), такие как Gl-181771 (Glaxo-SmithKline); SR146131 (Sanofi Synthelabo); бутабиндид; и PD 170.292, PD 149164 (Pfizer); (17) производные CNTF, такие как аксокин (Regeneron); и те, которые описаны в WO 94/09134, WO 98/22128 и WO 99/43813; (18) агонисты GHS (рецептора стимулятора секреции гормона роста), такие как NN703, гексарелин, МК-0677, SM-130686, СР-424,391, L-692,429 и L-163,255, и те, которые описаны в патенте США №6358951, патентных заявках США №№2002/049196 и 2002/022637; и WO 01/56592, и WO 02/32888; (19) агонисты 5НТ2 с (рецептора серотонина 2 с), такие как APD3546/AR10A (Arena Pharmaceuticals), ATH88651 (Athersys), ATH88740 (Athersys), BVT933 (Biovitrum/GSK), DPCA37215 (BMS), IK264; LY448100 (Lilly), PNU 22394; WAY 470 (Wyeth), WAY629 (Wyeth), WAY161503 (Biovitrum), R-1065, VR1065 (Vernalis/Roche) YM 348; и те, которые описаны в патенте США №3914250; и международных публикациях согласно РСТ 01/66548, 02/36596, 02/48124, 02/10169, 02/44152; 02/51844, 02/40456, 02/40457, 03/057698, 05/000849 и т.п.; (20) агонисты Mc3r (рецептора меланокортина 3); (21) агонисты Mc4r (рецептора меланокортина 4), такие как CHIR86036 (Chiron), CHIR915 (Chiron); ME-10142 (Melacure), ME-10145 (Melacure), HS-131 (Melacure), NBI72432 (Neurocrine Biosciences), NNC 70-619 (Novo Nordisk), TTP2435 (Transtech) и те, которые описаны в международных публикациях согласно РСТ WO 99/64002, 00/74679, 01/991752, 01/0125192, 01/52880, 01/74844, 01/70708, 01/70337, 01/91752, 01/010842, 02/059095, 02/059107, 02/059108, 02/059117, 02/062766, 02/069095, 02/12166, 02/11715, 02/12178, 02/15909, 02/38544, 02/068387, 02/068388, 02/067869, 02/081430, 03/06604, 03/007949, 03/009847, 03/009850, 03/013509, 03/031410, 03/094918, 04/028453, 04/048345, 04/050610, 04/075823, 04/083208, 04/089951, 05/000339 и ЕР 1460069 и US 2005049269 и JP2005042839 и т.п.; (22) ингибиторы обратного захвата моноамина, такие как сибутрамин (Meridia ©/Reductil®) и его соли, и те соединения, которые описаны в патентах США №№4746680, 480670 и 5436272 и в публикациях патентов США №2002/0006964, и WO 01/27068, и WO 01/62341; (23) ингибиторы обратного захвата серотонина, такие как дексфенфлурамин, флуоксетин, и те, которые описаны в патенте США №6365633, и WO 01/27060, и WO 01/162341; (24) агонисты GLP-1 (глюкагоноподобного пептида 1); (25) топирамат (Topimax®); (26) фитофарм соединение 57 (СР 644,673); (27) ингибиторы АСС2 (ацетил-СоА-карбоксилазы-2); (28) агонисты β3 (бета-3-адренергического рецептора), такие как рафебергрон/А09677/ТАК677 (Dainippon/ Takeda), CL-316,243, SB 418790, BRL-37344, L-796568, BMS-196085, BRL-35135A, CGP12177A, BTA-243, GRC1087 (Glenmark Pharmaceuticals) GW 427353 (солабегрон гидрохлорид), Trecadrine, Zeneca D7114, N-5984 (Nisshin Kyorin), LY-377604 (Lilly), KT07924 (Kissei), SR 59119A, и те, которые описаны в патентах США №№5705515, US 5451677; и WO 94/18161, WO 95/29159, WO 97/46556, WO 98/04526 WO 98/32753, WO 01/74782, WO 02/32897, WO 03/014113, WO 03/016276, WO 03/016307, WO 03/024948, WO 03/024953, WO 03/037881, WO 04/108674 и т.п.; (29) ингибиторы DGAT1 (диацилглицеролацилтрансферазы 1); (30) ингибиторы DGAT2 (диацилглицеролацилтрансферазы 2); (31) ингибиторы FAS (синтазы жирных кислот), такие как церуленин и С75; (32) ингибиторы PDE (фосфодиэстеразы), такие как теофиллин, пентоксифиллин, запринаст, силденафил, амринон, милринон, цилостамид, ролипрам и циломиласт, а также и те, которые описаны в WO 03/037432, WO 03/037899; (33) агонисты тиреоидного гормона β, такие как КВ-2611 (KaroBioBMS), и те, которые описаны в WO 02/15845; и патентной заявке Японии №2000256190; (34) активаторы UCP-1 (разобщающего белка 1), 2 или 3, такие как фитановая кислота, 4-[(Е)-2-(5,6,7,8-тетрагидро-5,5,8,8-тетраметил-2-нафталенил)-1-пропенил]бензойная кислота (TTNPB) и ретиноевая кислота; и те, которые описаны в WO 99/00123; (35) ацилэстрогены, такие как олеоилэстрон, описанные в del Mar-Grasa, M. et al., Obesity Research, 9:202-9 (2001); (36) антагонисты глюкокортикоидных рецепторов, такие как СР472555 (Pfizer), KB 3305, и те, которые описаны в WO 04/000869, WO 04/075864 и т.п.; (37) ингибиторы 11β HSD-1 (11-бета-гидроксистероиддегидрогеназа 1 типа), такие как BVT 3498 (AMG 331), BVT 2733, 3-(1-адамантил)-4-этил-5-(этилтио)-4Н-1,2,4-триазол, 3-(1-адамантил)-5-(3,4,5-триметоксифенил)-4-метил-4Н-1,2,4-триазол, 3-адамантил-4,5,6,7,8,9,10,11,12,3а-декагидро-1,2,4-триазоло[4,3-а][11]аннулен, и соединения, которые описаны в WO 01/90091, 01/90090, 01/90092, 02/072084, 04/011410, 04/033427, 04/041264, 04/027047, 04/056744, 04/065351, 04/089415, 04/037251 и т.п.; (38) ингибиторы SCD-1 (стеароил-СоА десатураза 1); (39) ингибиторы дипептидилпептидазы IV (DPP-4), такие как тиазолидид изолейцина, пирролидид валина, ситаглиптин, саксаглиптин, NVP-DPP728, LAF237 (вилдаглиптин), Р93/01, TSL 225, ТМС-2А/2 В/2С, FE 999011, Р9310/К364, VIP 0177, SDZ 274-444, GSK 823093, E 3024, SYR 322, TS021, SSR 162369, GRC 8200, K579, NN7201, CR 14023, PHX 1004, РНХ 1149, PT-630, SK-0403; и соединения, которые описаны в WO 02/083128, WO 02/062764, WO 02/14271, WO 03/000180, WO 03/000181, WO 03/000250, WO 03/002530, WO 03/002531, WO 03/002553, WO 03/002593, WO 03/004498, WO 03/004496, WO 03/005766, WO 03/017936, WO 03/024942, WO 03/024965, WO 03/033524, WO 03/055881, WO 03/057144, WO 03/037327, WO 04/041795, WO 04/071454, WO 04/0214870, WO 04/041273, WO 04/041820, WO 04/050658, WO 04/046106, WO 04/067509, WO 04/048532, WO 04/099185, WO 04/108730, WO 05/009956, WO 04/09806, WO 05/023762, US 2005/043292 и ЕР 1258476; (40) ингибиторы липазы, такие как тетрагидролипстатин (орлистат/XENICAL), ATL962 (Alizyme/Takeda), GT389255 (Genzyme/Peptimmune)Triton WR1339, RHC80267, липстатин, теасапонин и диэтилумбеллиферил-фосфат, FL-386, WAY-121898, Bay-N-3176, валилактон, эстерацин, эбелактон А, эбелактон В и RHC 80267, и соединения, описанные в WO 01/77094, WO 04/111004, и патентах США №№4598089, 4452813, 5512565, 5391571, 5602151, 4405644, 4189438 и 4242453 и т.п.; (41) ингибиторы переносчика жирных кислот; (42) ингибиторы переносчика дикарбоксилата; (43) ингибиторы транспорта глюкозы; и (44) ингибиторы переносчика фосфата; (45) снижающие аппетит бициклические соединения, такие как 1426 (Aventis) и 1954 (Aventis), и соединения, описанные в WO 00/18749, WO 01/32638, WO 01/62746, WO 01/62747 и WO'03/015769; (46) агонисты пептидов YY и PYY, такие как PYY336 (Nastech/Merck), AC162352 (1C Innovations/Curis/Amylin), TM30335/TM30338 (7TM Pharma), PYY336 (Emisphere Tehcnologies), ПЭГилированный пептид YY3-36, те, которые описаны в WO 03/026591, 04/089279 и т.п.; (47) модуляторы метаболизма липидов, такие как масленичная кислота, эритродиол, урсоловая кислота, уваол, бетулиновая кислота, бетулин и т.п., и соединения, описанные в WO 03/011267; (48) модуляторы фактора транскрипции, такие как описаны в WO 03/026576; (49) модуляторы Mc5r (рецептора меланокортина 5), такие как описаны в WO 97/19952, WO 00/15826, WO 00/15790, US 20030092041 и т.п.; (50) нейротрофический фактор мозга (BDNF), (51) модуляторы Мс1r (рецептора меланокортина 1), такие как LK-184 (Proctor & Gamble) и т.п.; (52) антагонисты 5НТ6, такие как BVT74316 (BioVitrum), BVT5182c (BioVitrum), E-6795 (Esteve), Е-6814 (Esteve), SB399885 (GlaxoSmithkline), SB271046 (GlaxoSmithkline), RO-046790 (Roche) и т.п.; (53) белок 4 транспорта жирных кислот (FATP4); (54) ингибиторы ацетил-КоА-карбоксилазы (АСС), такие как СР640186, СР610431, СР640188 (Pfizer); (55) С-концевые фрагменты гормона роста, такие как AOD9604 (Monash Univ/Metabolic Pharmaceuticals) и т.п.; (56) оксинтомодулин; (57) антагонисты рецептора нейропептида FF, такие как описаны в WO 04/083218 и т.п.; (58) агонисты амилина, такие как симлин/прамлинтид/АС137 (Amylin); (59) экстракты Hoodia и Trichocaulon; (60) BVT74713 и другие препараты для подавления аппетита к липидам в кишечнике; (61) допаминовые агонисты, такие как бупропион (WELLBUTRIN/GlaxoSmithkline); (62) зонисамид (ZONEGRAN/Dainippon/Elan) и т.п.

Конкретные соединения, которые могут быть использованы в сочетании с описанными здесь аналогами ОХМ, включают в себя специфические антагонисты СВ1/обратные агонисты, в том числе описанные в WO 03/077847, в том числе: N-[3-(4-хлорофенил)-2(S)-фенил-1(S)-метилпропил]-2-(4-трифторметил-2-пиримидилокси)-2-метилпропанамид, N-[3-(4-хлорофенил)-2-(3-цианофенил)-1-метилпропил]-2-(5-трифторметил-2-пиридилокси)-2-метилпропанамид, N-[3-(4-хлорофенил)-2-(5-хлоро-3-пиридил)-1-метилпропил]-2-(5-трифторметил-2-пиридилокси)-2-метилпропанамид и их фармацевтически приемлемые соли, а также и описанные в WO 05/000809, которые включают в себя следующие: 3-{1-[бис(4-хлорофенил)метил]азетидин-3-илиден}-3-(3,5-дифторфенил)-2,2-диметилпропаннитрил, 1-{1-[1-(4-хлорофенил)пентил]азетидин-3-ил}-1-(3,5-дифторфенил)-2-метилпропанол-2-ол, 3-((S)-(4-хлорофенил){3-[(1S)-1-(3,5-дифторфенил)-2-гидрокси-2-метилпропил]азетидин-1-ил}метил)бензонитрил, 3-((S-(4-хлорофенил){3-[(1S)-1-(3,5-дифторфенил)-2-фтор-2-метилпропил]азетидин-1-ил}метил)бензонитрил, 3-((4-хлорофенил){3-[1-(3,5-дифторфенил)-2,2-диметилпропил]азетидин-1-ил}метил)бензонитрил, 3-((1S)-1-{1-[(S)-(3-цианофенил)(4-цианофенил)метил]азетидин-3-ил}-2-фтор-2-метилпропил)-5-фторбензонитрил, 3-[(S)-(4-хлорофенил)(3-{(1S)-2-фтор-1-[3-фтор-5-(4Н-1,2,4-триазол-4-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил и 5-((4-хлорофенил){3-[(1S)-1-(3,5-дифторфенил)-2-фтор-2-метилпропил]азетидин-1-ил}метил)тиофен-3-карбонитрил и их фармацевтически приемлемые соли; а также: 3-[(S)-(4-хлорофенил)(3-{(1S)-2-фтор-1-[3-фтор-5-(5-оксо-4,5-дигидро-1,3,4-оксадиазол-2-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 3-[(S)-(4-хлорофенил)(3-{(1S)-2-фтор-1-[3-фтор-5-(1,3,4-оксадиазол-2-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 3-[(S)-(3-{(1S)-1-[3-(5-амино-1,3,4-оксадиазол-2-ил)-5-фторфенил]-2-фтор-2-метилпропил}азетидин-1-ил)(4-хлорофенил)метил]бензонитрил, 3-[(S)-(4-цианофенил)(3-{(1S)-2-фтор-1-[3-фтор-5-(5-оксо-4,5-дигидро-1,3,4-оксадиазол-2-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 3-[(S)-(3-{(1S)-1-[3-(5-амино-1,3,4-оксадиазол-2-ил)-5-фторфенил]-2-фтор-2-метилпропил}азетидин-1-ил)(4-цианофенил)метил]бензонитрил, 3-[(S)-(4-цианофенил)(3-{(1S)-2-фтор-1-[3-фтор-5-(1,3,4-оксадиазол-2-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 3-[(S)-(4-хлорофенил)(3-{(1S)-2-фтор-1-[3-фтор-5-(1,2,4-оксадиазол-3-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 3-[(1S)-1-(1-{(S)-(4-цианофенил)[3-(1,2,4-оксадиазол-3-ил)фенил]-метил}азетидин-3-ил)-2-фтор-2-метилпропил]-5-фторбензонитрил, 5-(3-{1-[1-(дифенилметил)азетидин-3-ил]-2-фтор-2-метилпропил}-5-фторфенил)-1Н-тетразол, 5-(3-{1-[1-(дифенилметил)азетидин-3-ил]-2-фтор-2-метилпропил}-5-фторфенил)-1-метил-1H-тетразол, 5-(3-{1-[1-(дифенилметил)азетидин-3-ил]-2-фтор-2-метилпропил}-5-фторфенил)-2-метил-2Н-тетразол, 3-[(4-хлорофенил)(3-{2-фтор-1-[3-фтор-5-(2-метил-2Н-тетразол-5-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 3-[(4-хлорофенил)(3-{2-фтор-1-[3-фтор-5-(1-метил-1H-тетразол-5-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 3-[(4-цианофенил)(3-{2-фтор-1-[3-фтор-5-(1-метил-1H-тетразол-5-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 3-[(4-цианофенил)(3-{2-фтор-1-[3-фтор-5-(2-метил-2Н-тетразол-5-ил)фенил]-2-метилпропил}азетидин-1-ил)метил]бензонитрил, 5-{3-[(S)-{3-[(1S)-1-(3-бром-5-фторфенил)-2-фтор-2-метилпропил]азетидин-1-ил}(4-хлорофенил)метил]фенил}-1,3,4-оксадиазол-2-(3Н)-он, 3-[(1S)-1-(1-{(S)-(4-хлорофенил)[3-(5-оксо-4,5-дигидро-1,3,4-оксадиазол-2-ил)фенил]метил}азетидин-3-ил)-2-фтор-2-метилпропил]-5-фторбензонитрил, 3-[(1S)-1-(1-{(S)-(4-цианофенил)[3-(5-оксо-4,5-дигидро-1,3,4-оксадиазол-2-ил)фенил]метил}азетидин-3-ил)-2-фтор-2-метилпропил]-5-фторбензонитрил, 3-[(1S)-1-(1-{(S)-(4-цианофенил)[3-(1,3,4-оксадиазол-2-ил)фенил]метил}азетидин-3-ил)-2-фтор-2-метилпропил]-5-фторбензонитрил, 3-[(1S)-1-(1-{(5)-(4-хлорофенил)[3-(1,3,4-оксадиазол-2-ил)фенил]метил}азетидин-3-ил)-2-фтор-2-метилпропил]-5-фторбензонитрил, 3-((1S)-1-{1-[(S)-[3-(5-амино-1,3,4-оксадиазол-2-ил)фенил](4-хлорофенил)метил]азетидин-3-ил}-2-фтор-2-метилпропил)-5-фторбензонитрил, 3-((1S)-1-{1-[(S)-[3-(5-амино-1,3,4-оксадиазол-2-ил)фенил](4-цианофенил)метил]азетидин-3-ил}-2-фтор-2-метилпропил)-5-фторбензонитрил, 3-[(1S)-1-(1-{(S)-(4-цианофенил)[3-(1,2,4-оксадиазол-3-ил)фенил]метил}азетидин-3-ил)-2-фтор-2-метилпропил]-5-фторбензонитрил, 3-[(1S)-1-(1-{(S)-(4-хлорофенил)[3-(1,2,4-оксадиазол-3-ил)фенил]метил}азетидин-3-ил)-2-фтор-2-метилпропил]-5-фторбензонитрил, 5-[3-((S)-(4-хлорофенил){3-[(1S)-1-(3,5-дифторфенил)-2-фтор-2-метилпропил]азетидин-1-ил}метил)фенил]-1,3,4-оксадиазол-2(3H)-он, 5-[3-((S)-(4-хлорофенил){3-[(15)-1-(3,5-дифторфенил)-2-фтор-2-метилпропил]азетидин-1-ил}метил)фенил]-1,3,4-оксадиазол-2(3H)-он, 4-{(S)-{3-[(1S)-1-(3,5-дифторфенил)-2-фтор-2-метилпропил]азетидин-1-ил}[3-(5-оксо-4,5-дигидро-1,3,4-оксадиазол-2-ил)фенил]метил}бензонитрил, ACOMPLIA (римонабант, N-(1-пиперидинил)-5-(4-хлорофенил)-1-(2,4-дихлорофенил)-4-метилпиразол-3-карбоксамид, SR141716A), 3-(4-хлорофенил-N'-(4-хлорофенил)сульфонил-N-метил-4-фенил-4,5-дигидро-1Н-пиразол-1-карбоксамид (SLV-319), таранабант, N-[(1S,2S)-3-(4-хлорофенил)-2-(3-цианофенил)-1-метилпропил]-2-метил-2-[[5-(трифторметил)-2-пиридинил]окси]пропанамид и их фармацевтически приемлемые соли.

Конкретные антагонисты NPY5, которые могут быть использованы в сочетании с описанными здесь аналогами ОХМ, включают в себя: 3-оксо-N-(5-фенил-2-пиразинил)-спиро[изобензофуран-1(3Н),4'-пиперидин]-1'-карбоксамид, 3-оксо-N-(7-трифторметилпиридо[3,2-b]пиридин-2-ил)спиро-[изобензофуран-1(3Н),4'-пиперидин]-1'-карбоксамид, N-[5-(3-фторфенил)-2-пиримидинил-3-оксоспиро-[изобензофуран-1(3Н),4'-пиперидин]-1'-карбоксамид, транс-3'-оксо-N-(5-фенил-2-пиримидинил)спиро[циклогексан-1,1(3'Н)-изобензофуран]-4-карбоксамид, транс-3'-оксо-N-[1-(3-квинолил)-4-имидазолил]спиро[циклогексан-1,1'(3'Н)-изобензофуран]-4-карбоксамид, транс-3-оксо-N-(5-фенил-2-пиразинил)спиро[4-азаизо-бензофуран-1(3Н),1'-циклогексан]-4'-карбоксамид, транс-N-[5-(3-фторфенил)-2-пиримидинил]-3-оксоспиро[5- азаизобензофуран-1(3Н),1'-циклогексан]-4'-карбоксамид, транс-N-[5-(2-фторфенил)-2-пиримидинил]-3-оксоспиро[5-азаизобензофуран-1(3Н),1'-циклогексан]-4'-карбоксамид, транс-N-[1-(3,5-дифторфенил)-4-имидазолил]-3-оксоспиро[7-азаизобензофуран-1(3Н),1'-циклогексан]-4'-карбоксамид, транс-3-оксо-N-(1-фенил-4-пиразолил)спиро[4-азаизобензофуран-1(3Н),1'-циклогексан]-4'-карбоксамид, транс-N-[1-(2-фторфенил)-3-пиразолил]-3-оксоспиро[6-азаизобензофуран-1(3Н),1'-циклогексан]-4'-карбоксамид, транс-3-оксо-N-(1-фенил-3-пиразолил)спиро[6-азаизобензофуран-1(3Н),1'-циклогексан]-4'-карбоксамид, транс-3-оксо-N-(2-фенил-1,2,3-триазол-4-ил)спиро[6-азаизобензофуран-1(3Н),1'-циклогексан]-4'-карбоксамид и их фармацевтически приемлемые соли и сложные эфиры.

Конкретные ингибиторы АСС-1/2, которые могут быть использованы в сочетании с описанными здесь аналогами ОХМ включают в себя: 1'-[(4,8-диметоксихинолин-2-ил)карбонил]-6-(1H-тетразол-5-ил)спиро[хроман-2,4'-пиперидин]-4-он; (5-{1'-[(4,8-диметоксихинолин-2-ил)карбонил]-4-оксоспиро[хроман-2,4'-пиперидин]-6-ил}-2Н-тетразол-2-ил)метилпивалат; 5-{1'-[(8-циклопропил-4-метоксихинолин-2-ил)карбонил]-4-оксоспиро[хроман-2,4'-пиперидин]-6-ил}никотиновая кислота; 1'-(8-метокси-4-морфолин-4-ил-2-нафтоил)-6-(1Н-тетразол-5-ил)спиро[хроман-2,4'-пиперидин]-4-он; и 1'-[(4-этокси-8-этилхинолин-2-ил)карбонил]-6-(1Н-тетразол-5-ил)спиро[хроман-2,4'-пиперидин]-4-он и их фармацевтически приемлемые соли и сложные эфиры.

Конкретные соединения антагонисты MCH1R, которые могут быть использованы в сочетании с описанными здесь аналогами ОХМ, включают в себя: 1-{4-[(1-этилазетидин-3-ил)окси]фенил}-4-[(4-фторбензил)окси]пиридин-2(1Н)-он, 4-[(4-фторбензил)окси]-1-{4-[(1-изопропилазетидин-3-ил)окси]фенил}пиридин-2(1Н)-он, 1-[4-(азетидин-3-ил)окси)фенил]-4-[(5-хлоропиридин-2-ил)метокси]пиридин-2(1Н)-он, 4-[(5-хлоропиридин-2-ил)метокси]-1-{4-[(1-этилазетидин-3-ил)окси]фенил}пиридин-2(1Н)-он, 4-[(5-хлоропиридин-2-ил)метокси]-1-{4-[(1-пропилазетидин-3-ил)окси]фенил}пиридин-2(1H)-он и 4-[(5-хлоропиридин-2-ил)метокси]-1-(4-{[(2S)-1-этилазетидин-2-ил]метокси}фенил)пиридин-2(1Н)-он или его фармацевтически приемлемую соль.

Конкретный ингибитор DPP-IV, который может быть использован в сочетании с описанными здесь аналогами ОХМ, представляет собой 7-[(3R)-3-амино-4-(2,4,5-трифторфенил)бутаноил]-3-(трифторметил)-5,6,7,8-тетрагидро-1,2,4-триазоло[4,3-d]пиразин или его фармацевтически приемлемую соль.

Конкретные антагонисты/обратные агонисты Н3 (гистамина Н3), которые могут быть использованы в сочетании с описанными здесь аналогами ОХМ, включают в себя: антагонисты/обратные агонисты Н3, описанные в WO 05/077905, в том числе: 3-{4-[(1-циклобутил-4-пиперидинил)окси]фенил}-2-этилпиридо[2,3-d]-пиримидин-4(3Н)-он, 3-{4-[(1-циклобутил-4-пиперидинил)окси]фенил}-2-метилпиридо[4,3-d]пиримидин-4(3Н)-он, 2-этил-3-(4-{3-[(3S)-3-метилпиперидин-1-ил]пропокси}фенил)пиридо[2,3-d]пиримидин-4(3Н)-он, 2-метил-3-(4-{3-[(3S)-3-метилпиперидин-1-ил]пропокси}фенил)пиридо[4,3-d]пиримидин-4(3Н)-он, 3-{4-[(1-циклобутил-4-пиперидинил)окси]фенил}-2,5-диметил-4(3Н)-хиназолинон, 3-{4-[(1-циклобутил-4-пиперидинил)окси]фенил}-2-метил-5-трифторметил-4(3Н)-хиназолинон, 3-{4-[(1-циклобутил-4-пиперидинил)окси]фенил}-5-метокси-2-метил-4(3Н)-хиназолинон, 3-{4-[(1-циклобутилпиперидин-4-ил)окси]фенил}-5-фтор-2-метил-4(3Н)-хиназолинон, 3-{4-[(1-циклобутилпиперидин-4-ил)окси]фенил}-7-фтор-2-метил-4(3Н)-хиназолинон, 3-{4-[(1-циклобутилпиперидин-4-ил)окси]фенил}-6-метокси-2-метил-4(3Н)-хиназолинон, 3-{4-[(1-циклобутилпиперидин-4-ил)окси]фенил}-6-фтор-2-метил-4(3Н)-хиназолинон, 3-{4-[(1-циклобутилпиперидин-4-ил)окси]фенил}-8-фтор-2-метил-4(3Н)-хиназолинон, 3-{4-[(1-циклопентил-4-пиперидинил)окси]фенил}-2-метилпиридо[4,3-d]пиримидин-4(3Н)-он, 3-{4-[(1-циклобутилпиперидин-4-ил)окси]фенил}-6-фтор-2-метилпиридо[3,4-d]пиримидин-4(3H)-он, 3-{4-[(1-циклобутил-4-пиперидинил)окси]фенил}-2-этилпиридо[4,3-d]пиримидин-4(3Н)-он, 6-метокси-2-метил-3-{4-[3-(1-пиперидинил)пропокси]фенил}пиридо[3,4-d]пиримидин-4(3Н)-он, 6-метокси-2-метил-3-{4-[3-(1-пирролидинил)пропокси]фенил}пиридо[3,4-d]пиримидин-4(3Н)-он, 2,5-диметил-3-{4-[3-(1-пирролидинил)пропокси]фенил}-4(3Н)-хиназолинон, 2-метил-3-{4-[3-(1-пирролидинил)пропокси]фенил}-5-трифторметил-4(3Н)-хиназолинон, 5-фтор-2-метил-3-{4-[3-(1-пиперидинил)пропокси]фенил}-4(3Н)-хиназолинон, 6-метокси-2-метил-3-{4-[3-(1-пиперидинил)пропокси]фенил}-4(3Н)-хиназолинон, 5-метокси-2-метил-3-(4-{3-[(3S)-3-метилпиперидин-1-ил]пропокси}фенил)-4(3Н)-хиназолинон, 7-метокси-2-метил-3-(4-{3-[(3S)-3-метилпиперидин-1-ил]пропокси}фенил)-4(3Н)-хиназолинон, 2-метил-3-(4-{3-[(3S)-3-метилпиперидин-1-ил]пропокси}фенил)пиридо[2,3-d]пиримидин-4(3Н)-он, 5-фтор-2-метил-3-(4-{3-[(2R)-2-метилпирролидин-1-ил]пропокси}фенил)-4(3Н)-хиназолинон, 2-метил-3-(4-{3-[(2R)-2-метилпирролидин-1-ил]пропокси}фенил)пиридо[4,3-d]пиримидин-4(3Н)-он, 6-метокси-2-метил-3-(4-{3-[(2R)-2-метилпирролидин-1-ил]пропокси}фенил)-4(3Н)-хиназолинон, 6-метокси-2-метил-3-(4-{3-[(2R)-2-метилпирролидин-1-ил]пропокси}фенил)-4(3Н)-хиназолинон и их фармацевтически приемлемые соли.

Конкретные агонисты CCK1R использования в сочетании с описанными здесь аналогами ОХМ включают в себя: 3-(4-{[1-(3-этоксифенил)-2-(4-метилфенил)-1H-имидазол-4-ил]карбонил}-1-пиперазинил)-1-нафтойная кислота; 3-(4-{[1-(3-этоксифенил)-2-(2-фтор-4-метилфенил)-1Н-имидазол-4-ил]карбонил}-1-пиперазинил)-1-нафтойная кислота; 3-(4-{[1-(3-этоксифенил)-2-(4-фторфенил)-1Н-имидазол-4-ил]карбонил}-1-пиперазинил)-1-нафтойная кислота; 3-(4-{[1-(3-этоксифенил)-2-(2,4-дифторфенил)-1H-имидазол-4-ил]карбонил}-1-пиперазинил)-1-нафтойная кислота и 3-(4-{[1-(2,3-дигидро-1,4-бензодиоксин-6-ил)-2-(4-фторфенил)-1Н-имидазол-4-ил]карбонил}-1-пиперазинил)-1-нафтойная кислота и их фармацевтически приемлемые соли.

Конкретные агонисты MC4R использования в сочетании с описанными здесь аналогами ОХМ включают в себя: 1) (5S)-1'-{[(3R,4R)-1-терт-бутил-3-(2,3,4-трифторфенил)пиперидин-4-ил]карбонил}-3-хлор-2-метил-5-[1-метил-1-(1-метил-1H-1,2,4-триазол-5-ил)этил]-5Н-спиро[фуро[3,4-b]пиридин-7,4'-пиперидин]; 2) (5R)-1'-{[(3R,4R)-1-терт-бутил-3-(2,3,4-трифторфенил)-пиперидин-4-ил]карбонил}-3-хлор-2-метил-5-[1-метил-1-(1-метил-1Н-1,2,4-триазол-5-ил)этил]-5H-спиро[фуро[3,4-b]пиридин-7,4'-пиперидин]; 3) 2-(1'-{[(3S,4R)-1-терт-бутил-4-(2,4-дифторфенил)пирролидин-3-ил]карбонил}-3-хлор-2-метил-5Н-спиро[фуро[3,4-6]пиридин-7,4'-пиперидин]-5-ил)-2-метилпропаннитрил; 4) 1'-{[(3S,4R)-1-терт-бутил-4-(2,4-дифторфенил)пирролидин-3-ил]карбонил}-3-хлор-2-метил-5-[1-метил-1-(1-метил-1H-1,2,4-триазол-5-ил)этил]-5Н-спиро[фуро[3,4-b]пиридин-7,4'-пиперидин]; 5) N-[(3R,4R)-3-({3-хлор-2-метил-5-[1-метил-1-(1-метил-1H-1,2,4-триазол-5-ил)этил]-1'H,5H-спиро[фуро-[3,4-b]пиридин-7,4'-пиперидин]-1'-ил}карбонил)-4-(2,4-дифторфенил)-циклопентил]-N-метилтетрагидро-2Н-пиран-4-амин; 6) 2-[3-хлор-1'-({(1R,2R)-2-(2,4-дифторфенил)-4-[метил(тетрагидро-2H-пиран-4-ил)амино]-циклопентил}-карбонил)-2-метил-5N-спиро[фуро[3,4-b]пиридин-7,4'-пиперидин]-5-ил]-2-метил-пропаннитрил и их фармацевтически приемлемые соли.

Кроме того, другие пептидные аналоги и миметики глюкагоноподобного пептида 1 гормона инкретина (GLP-1) также могут быть использованы в сочетании с описанными здесь аналогами ОХМ.

Способы введения фармацевтических композиций, содержащих один или несколько описанных здесь аналогов ОХМ индивидууму, включают в себя, но не ограничиваются ими, внутрикожный, внутримышечный, интраперитонеальный, внутривенный, подкожный, интраназальный, эпидуральный и пероральный способы введения. Композиции могут быть введены любым удобным подходящим способом, например инфузией или болюсным введением, абсорбцией через эпидермальные или кожно-слизистые оболочки (например, слизистую оболочку полости рта, слизистую оболочку прямой кишки и кишечника и т.п.), глаза и т.п., и могут быть введены вместе с другими биологически активными агентами. Введение может быть системным или местным. Кроме того, может быть выгодным введение композиции в центральную нервную систему любым подходящим способом, в том числе внутрижелудочковой и интратекальной инъекцией. Внутрижелудочковая инъекция может быть облегчена внутрижелудочковым катетером, соединенным с резервуаром (например, резервуаром Оммайя). Ингаляционное введение также может быть использовано применением ингалятора или распылителя и приготовлением композиции с аэрозольным агентом. Также может быть желательным введение одного или нескольких описанных здесь аналогов ОХМ локально в область, которая нуждается в лечении; введение может быть достигнуто, например, но без ограничения, местной инфузией во время операции, местным применением, инъекцией, посредством катетера, посредством суппозитория или посредством имплантата.

Различные системы доставки известны и могут быть использованы для введения описанных здесь аналогов ОХМ, в том числе, но не ограничиваются ими, инкапсулирование в липосомы, микрочастицы, микрокапсулы; мини-клетки; полимеры; капсулы; таблетки и т.п. В одном варианте осуществления, описанные здесь аналоги ОХМ, могут быть доставлены в везикуле, в частности липосоме. В липосоме, описанные здесь аналоги ОХМ, комбинируют, в дополнение к другим фармацевтически приемлемым носителям, с амфипатическими агентами, такими как липиды, которые существуют в агрегированной форме в виде мицелл, нерастворимых монослоев, жидких кристаллов или ламеллярных слоев в водном растворе. Подходящие липиды для липосомальной композиции включают в себя, без ограничения, моноглицериды, диглицериды, сульфатиды, лизолецитин, фосфолипиды, сапонин, желчные кислоты и т.п. Получение таких липосомальных композиций находится в пределах уровня специалиста в данной области, как описано, например, в патенте США №4837028 и патенте США №4737323. Еще в другом варианте осуществления описанные здесь аналоги ОХМ могут быть доставлены в системе с контролируемым высвобождением, в том числе, но не ограничивается ими: с насосом для доставки {см., например, Saudek, et al., New Engl. J. Med. 321: 574 (1989) и полупроницаемым полимерным материалом (см., например, Howard, et al., J. Neurosurg. 71: 105 (1989)). Кроме того, система с контролируемым высвобождением может быть помещена в непосредственной близости от терапевтической мишени (например, мозга), таким образом требуя только части общей дозы. См., например, Goodson, In: Medical Applications of Controlled Release, 1984 (CRC Press, Bocca Raton, Fla.).

Количество композиций, содержащих один или несколько описанных здесь аналогов ОХМ, которые будут эффективны в лечении конкретного нарушения или состояния, будет зависеть от характера нарушения или состояния, и может быть определено стандартными клиническими способами, способами для среднего специалиста в данной области. Кроме того, анализы in vitro могут быть при желании применены для облегчения установления оптимальных диапазонов доз. Точная доза, которая должна быть использована в композиции, также будет зависеть от способа введения и общей серьезности заболевания или нарушения, и должна быть определена в соответствии с решением практикующего врача и состоянием каждого пациента. В конечном счете, лечащий врач определит количество композиции, которое необходимо для лечения каждого отдельного пациента. С самого начала лечащий врач введет низкие дозы композиции и проведет наблюдение за ответом пациента. Более высокие дозы композиции могут быть введены до достижения оптимального для пациента терапевтического эффекта, и на этом этапе дозировку далее не увеличивают. В целом, суточный диапазон доз находится в пределах от приблизительно 0,001 мг до приблизительно 100 мг на килограмм массы тела млекопитающего, предпочтительно от 0,01 мг до приблизительно 50 мг на кг и наиболее предпочтительно от 0,1 до 10 мг на кг, в разовой или разделенной общей дозах. С другой стороны, в некоторых случаях может быть необходимо применение доз, выходящих за эти пределы. Однако подходящие диапазоны доз для внутривенного введения композиций, содержащих один или несколько описанных здесь аналогов ОХМ, обычно содержат приблизительно 5-500 микрограмм (мкг) активного соединения на килограмм (кг) массы тела. Подходящие диапазоны доз для интраназального введения составляют обычно приблизительно от 0,01 пг/кг массы тела до 1 мг/кг массы тела. Эффективные дозы могут быть экстраполированы из кривых зависимости доза - эффект, полученных из тест-систем in vitro или подходящей модели животного. Суппозитории обычно содержат активный ингредиент в диапазоне от 0,5% до 10% масс.; пероральные композиции предпочтительно содержат от 10% до 95% активного ингредиента. В конечном счете, лечащий врач примет решение о соответствующей длительности лечения с использованием композиций, содержащих один или несколько описанных здесь аналогов ОХМ данного изобретения. Дозировка также будет варьировать в зависимости от возраста, веса и ответа отдельного пациента.

Дополнительно обеспечивают фармацевтическую упаковку или набор, содержащий один или несколько контейнеров, заполненных одним или несколькими ингредиентами фармацевтических композиций и описанных здесь аналогов ОХМ. Необязательно вместе с таким контейнером (контейнерами) может быть информация в форме, предписанной государственным органом, регулирующим производство, применение или продажу лекарственных препаратов или биологических продуктов, информация, которая отражает разрешение органа по производству, применению или продажи для введения людям.

Все описанные здесь ссылки включены в изобретение полностью. Нижеследующие примеры предназначены для обеспечения более полного понимания настоящего изобретения.

ПРИМЕР 1

Синтез аналогов оксинтомодулина (ОХМ), по существу, был следующим. Показанные в таблице 2 ниже, аналоги ОХМ синтезировали в твердой фазе с использованием стратегии Fmoc/t-Bu на пептидном синтезаторе APEX 396 (Advanced Chemtech) с использованием 40-луночного реакционного блока. Каждый пептид синтезировали в отдельной лунке. Для амидов пептидов использовали 0,1 г смолы аминометилированного полистирола LL (100-200 меш, 0,41 ммоль/г) (Novabiochem), дериватизованного модифицированным линкером Ринка р-[(R,S)-α-[9Н-флуорен-9-ил-метоксиформамидо]-2,4-диметоксибензил)]-феноксиуксусная кислота (Rink, H., 1987, Tetrahedron Lett. 28:3787-3789; Bernatowicz, M. S. et al., 1989, Tetrahedron Lett. 30:4645-4667). Все аминокислоты растворяли в 0,5 М концентрации в растворе 0,5М HOBt (гидроксибензотриазол) в DMF (пер., ДМФ диметилформамид). Реакции ацилирования выполняли в течение 45 минут с шестикратным избытком активированной аминокислоты относительно свободных аминогрупп смолы. Аминокислоты активировали эквимолярными количествами HBTU (2-(1Н-бензотриазол-1-ил)-1,1,3,3-тетраметилурония гексафторфосфат) и двукратным молярным избытком DIPEA (N,N-диизопропилэтиламин).

Альтернативно, пептиды синтезировали в твердой фазе с использованием стратегии Fmoc/t-Bu на синтезаторе Pioneer Peptide Synthesizer (Applied Biosystems). В этом случае использовали 0,1 г смолы Fmoc-линкер AM-Champion, с 1% поперечными связями (Biosearch Technologies, Inc.), и смолы на основе PEG-PS, дериватизованные модифицированным линкером Ринка р-[(R,S)-α-[9Н-флуорен-9-ил-метоксиформамидо]-2,4-диметоксибензил)]-феноксиуксусной кислотой (Rink, H., 1987, Tetrahedron Lett. 28:3787-3789; Bernatowicz, M.S. et al., 1989, Tetrahedron Lett. 30:4645-4667). Все реакции ацилирования выполняли в течение 60 минут с четырехкратным избытком активированной аминокислоты относительно свободных аминогрупп смолы исходя из окончания сборки пептида на синтезаторе; двойные связи выполняли для N-концевого Aib и His.

Защитными группами боковой цепи были: ОМре (0-3-метил-пент-3-ил) для Asp; терт-бутил для Glu, Ser, D-Ser, Thr и Tyr; тритил для Asn, Cys, Gln и His; и терт-бутокси-карбонил для Lys, Trp; и 2,2,4,6,7-пентаметилдигидробензофуран-5-сульфонил для Arg.

Для ОХМ110 и ОХМ177 лизин-пальмитоил ацилировали вручную реакцией с эквимолярными количествами HBTU (2-(1Н-бензотриазол-1-ил)-1,1,3,3-тетраметилурония гексафторфосфата) и 2-кратным молярным избытком DIPEA (N,N-диизопропилэтиламина). Реакцию ацилирования выполняли в течение 120 минут с трехкратным избытком активированной аминокислоты (acylant) относительно свободных аминогрупп смолы.

В конце синтеза сухие смолы, содержащие пептиды (смола-пептид), по отдельности обрабатывали 20 мл смеси для отщепления (пептида от смолы): 88% трифторуксусной кислоты (TFA), 5% фенола, 2% триизопропилсилана и 5% воды (Sole, N.A. and G.Barany, 1992, J. Org. Chem. 57:5399-5403) в течение 1,5 часов при комнатной температуре. Каждую смолу отфильтровывали и раствор добавляли в холодный метил-т-бутиловый эфир для осаждения пептида. После центрифугирования осадки пептидов промывали свежим холодным метил-т-бутиловым эфиром для удаления органических ловушек. Процесс повторяли дважды. Окончательные осадки высушивали, ресуспендировали в H2O, 20% ацетонитриле и лиофилизировали.

Неочищенные пептиды очищали высокоэффективной жидкостной хроматографией (ВЭЖХ) с обращенными фазами с использованием препаративных картриджей Waters RCM Delta-PakTM C-4 (40×200 мм, 15 мкм) и с использованием в качестве элюентов (А) 0,1% TFA в воде и (В) 0,1% TFA в ацетонитриле. Использовали следующий градиент элюента В: 20%-20% в течение пяти минут и 20%-35% в течение 20 минут для ОХМ229 (тиолированного пептида-предшественника ОХМ36 и ОХМ115), ОХМ29 (тиолированного предшественника ОХМ70 и ОХМ216), ОХМ208 (тиолированного пептида-предшественника ОХМ212) и ОХМ209 (тиолированного пептида-предшественника ОХМ213).

Для пептидов ОХМ110 и 177 использовали следующий градиент элюента В: 32%-32% в течение пяти минут и 32%-42% в течение 20 минут, скорость потока 80 мл/мин. Аналитическую ВЭЖХ выполняли на хроматографе Alliance Waters Chromatograph, с колонкой АСЕ C-4 (300 А), 3 мкм, 150×4,6 мм, (CPS analitica p/n ACE-213-1546), при 45°С, с использованием Н2О, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей и следующего линейного градиента: 20%-20% В (на протяжении пяти минут) - 35% В (в течение 20 минут) - 80% В (в течение двух минут), поток 1 мл/мин. Характеристики очищенного пептида получали масс-спектрометрией с электрораспылением на платформе Micromass LCZ.

ПРИМЕР 2

Синтез связанных с холестерином аналогов оксинтомодулина (ОХМ) ОХМ36, ОХМ70, ОХМ115, ОХМ212, ОХМ213 и ОХМ216 был следующим.

Взаимодействия проводили в условиях, которые обеспечивают образование тиоэфирной связи. Затем пептиды ОХМ, связанные с холестерином, выделяли с использованием ВЭЖХ с обращенными фазами и получали характеристики на платформе Micromass LCZ. Аналоги ОХМ36, 70, 212 и 213 синтезировали из тиолсодержащего пептидного предшественника ОХМ ОХМ229, ОХМ208 и 209, соответственно, взаимодействием с бромпроизводным холест-5-ен-3-ил бромацетат, имеющим структуру,

для получения конъюгатов, прикрепленных с использованием тиоэфирной связи. Вкратце, 30 мг пептидного предшественника растворяли в одном мл DMSO (концентрация 30 мг/мл) и добавляли одномолярный избыток холест-5-ен-3-ил бромацетата, растворенного в THF (концентрация 20 мг/мл). Затем в смесь добавляли 1% по объему DIPEA (N,N-диизопропилэтиламин); после 30 минут инкубации пептидный раствор очищали RP-HPLC и характеризовали на Micromass LCZ platform.

Пептиды ОХМ115 и 216 синтезировали из тиолсодержащего предшественника пептида ОХМ ОХМ229 и ОХМ29 для получения аналогов взаимодействием с бромпроизводным, холест-5-ен-3-ил 1-бром-2-оксо-6,9,12,15-тетраокса-3-азаоктадекан-18-оат

для получения конъюгатов, прикрепленных с использованием тиоэфирной связи. Вкратце, 30 мг пептидного предшественника растворяли в 1 мл DMSO (концентрация 30 мг/мл) и добавляли одномолярный избыток холест-5-ен-3-ил 1-бром-2-оксо-6,9,12,15-тетраокса-3-азаоктадекан-18-оат, растворенный в THF (концентрация 20 мг/мл). Затем в смесь добавляли 3% по объему DIPEA (N,N-диизопропилэтиламин); после 30 минут инкубации пептидный раствор очищали RP-HPLC и характеризовали на Micromass LCZ platform.

ПРИМЕР 3

Реакции ПЭГилирования проводили в условиях, обеспечивающих образование тиоэфирной связи. Затем ПЭГилированный пептид ОХМ выделяли с использованием ВЭЖХ с обращенными фазами или ионообменной хроматографии и гель-хроматографии (SEC). ПЭГилированные аналоги ОХМ характеризовали с использованием RP-HPLC, HPLC-SEC и масс-спектрометрии MALDI-Tof.

Пептиды ОХМ33, 34, 35, 36 и 54 синтезировали из тиолсодержащего предшественника пептида ОХМ ОХМ229 для получения аналогов с ковалентно прикрепленным ПЭГ с использованием тиоэфирной связи.

Синтез ОХМ33

10 мг предшественника пептида (2,2 мкмоль) растворяли в 0,2 мл HEPES 0,1М рН 7,3, гуанидинхлориде 6М, 2 мМ EDTA. В этот раствор добавляли 22 мг MPEG-MAL-5000 (NEKTAR 2F2MOH01) (4,4 мкмоль), растворенного в 0,4 мл HEPES 0,1М, рН 7,3 (отношение пептида к ПЭГ 1:2 моль/моль). Через 1 час инкубации ПЭГилированный пептид очищали RP-HPLC и характеризовали MALDI-TOF.

Синтез ОХМ34

10 мг предшественника пептида (2,2 мкмоль) растворяли в 0,2 мл HEPES 0,1М рН 7,3, гуанидинхлориде 6М, 2 мМ EDTA. В этот раствор добавляли 80 мг MPEG-MAL-20K (NEKTAR 2F2MOP01) (4,4 мкмоль), растворенного в 0,5 мл HEPES 0,1М, рН 7,3 (отношение пептида к ПЭГ 1:1,8 моль/моль). Через 1 час инкубации ПЭГилированный пептид очищали RP-HPLC и характеризовали MALDI-TOF.

Синтез ОХМ35

10 мг предшественника пептида (0,92 мкмоль) растворяли в 0,4 мл HEPES 0,1М рН 7,3, гуанидинхлориде 6М, 2 мМ EDTA. В этот раствор добавляли 70 мг MPEG2-MAL-40К (NEKTAR 2D3YOT01) (1,7 мкмоль), растворенного в 0,8 мл HEPES 0,1М, рН 7,3 в соотношении пептида к ПЭГ 1:1,8 моль/моль. Через 1 час инкубации ПЭГилированный пептид очищали RP-HPLC и характеризовали MALDI-TOF.

Контрольный пептид ОХМ54 готовили инкубированием тиолсодержащего предшественника пептида с 10 экв. иодацетамида в 0,1 М TrisHCI рН 7,5, 6М гуанидинхлориде. Через 30 инкубации пептид очищали RP-HPLC и характеризовали масс-спектрометрией с электрораспылением.

Синтез ОХМ103, ОХМ105, ОХМ107, ОХМ113

10 мг соответствующих предшественников пептидов (2,26 мкмоль) растворяли в 2 мл мочевины 8М, HEPES 0,1М рН 7,3, 2 мМ EDTA. 109 мг MPEG2-MAL-40K (NEKTAR 2D3YOT01) (2,71 мкмоль) растворяли в Н2О (соотношение пептида к ПЭГ 1:1,2 моль/моль) добавляли в этот раствор. Через 1 час инкубации раствор ПЭГилированного пептида подкисляли до 1% уксусной кислоты и очищали катионообменной хроматографией (IXC) на TSK CM-650S линейным градиентом NaCl в уксуснокислом натрии 50 мМ рН 4,8. ПЭГилированный пептид, очищенный IXC, дополнительно очищали гель-хроматографией. (SEC) и характеризовали (с использованием) MALDI-TOF.

Синтез ОХМ109

10 мг соответствующих предшественников пептидов (2,25 мкмоль) растворяли в 2 мл мочевины 8М, HEPES 0,1М рН 7,3, 2 мМ EDTA. 108 мг MPEG2-MAL-40K (NEKTAR 2D3YOT01) (2,7 мкмоль) растворяли в 2 мл H2O (соотношение пептида к ПЭГ 1:1,2 моль/моль) добавляли в этот раствор. Через 1 час инкубации раствор ПЭГилированного пептида подкисляли до 1% уксусной кислоты и очищали катионообменной хроматографией (IXC) на TSK CM-650S линейным градиентом NaCl в уксуснокислом натрии 50 мМ рН 4,8. ПЭГилированный пептид, очищенный IXC, дополнительно очищали гель-хроматографией (SEC) и характеризовали (с использованием) MALDI-TOF.

ПРИМЕР 4

Пептидные аналоги ОХМ, которые проявляют полную агонистическую активность в отношении рецепторов GLP-1 и глюкагона и показанные в таблице 2, синтезировали следующим образом.

Пептиды ОХМ290, 291, 292, 293 и 294, которые являются предшественниками ОХМ301, ОХМ302, ОХМ303, ОХМ304 и ОХМ305 (см., таблицу 2), синтезировали в твердой фазе с использованием стратегии Fmoc/t-Bu на пептидном мультисинтезаторе Simphony Protein Technologies Inc. Для амидов пептидов использовали 0,5 г смолы аминометилированного полистирола LL (100-200 меш, 0,41 ммоль/г) (Novabiochem), смола дериватизованная модифицированным линкером Ринка р-[(R,S)-α-[9Н-флуорен-9-ил-метоксиформамидо]-2,4-диметоксибензил)]-феноксиуксусная кислота (Rink, Tetrahedron Lett. 28:3787-3789 (1987); Bernatowicz et al., Tetrahedron Lett. 30:4645-4667 (1989)). Все аминокислоты растворяли в концентрации 0,5 М в растворе 0,5 М HOBt (гидроксибензотриазол) в DMF. Реакции ацилирования выполняли в течение 60 минут с 8-кратным избытком активированной аминокислоты относительно свободных аминогрупп смолы. Аминокислоты активировали эквимолярными количествами HBTU (2-(1Н-бензотриазол-1-ил)-1,1,3,3-тетраметилурония гексафторфосфат), раствор 0,5 М в DMF, и двукратным молярным избытком DIPEA (N,N-диизопропилэтиламин), раствор 2 М в NMP.

Защитными группами боковой цепи были: ОМре (O-3-метил-пент-3-ил) для Asp; терт-бутил для Glu, Ser, D-Ser, Thr и Tyr; тритил для Asn, Cys, Gln и His; и терт-бутокси-карбонил для Lys, Trp; и 2,2,4,6,7-пентаметилдигидробензофуран-5-сульфонил для Arg; в синтезе использовали Boc-His(Trt)-OH.

В конце синтеза сухие смолы, содержащие пептиды (смола-пептид), по отдельности обрабатывали 25 мл смеси для отщепления (пептида от смолы): 82,5% трифторуксусной кислоты (TFA), 5% фенола, 5% тиоанизола, 2,5% этандитиола и 5% воды в течение 1,5 часов при комнатной температуре. Каждую смолу отфильтровывали, и объем раствора уменьшали, затем добавляли в холодный метил-т-бутиловый эфир для осаждения пептида. После центрифугирования осадки пептидов промывали свежим холодным метил-т-бутиловым эфиром для удаления органических ловушек. Процесс повторяли дважды. Окончательные осадки высушивали, ресуспендировали в Н2О, 20% ацетонитриле и лиофилизировали.

Неочищенные пептиды очищали высокоэффективной жидкостной хроматографией (ВЭЖХ) с обращенными фазами с использованием препаративных картриджей Waters RCM Delta-PakTM C-4 (40×200 мм, 15 мкм) и с использованием в качестве элюентов (А) 0,1% TFA в воде и (В) 0,1% TFA в ацетонитриле. Использовали следующий градиент элюента В: 22%-22% в течение пяти минут и 22%-32% в течение 20 минут для предшественника ОХМ301, 22%-22% в течение 5 минут и 22%-35% в течение 20 минут для предшественника ОХМ302, 25%-25% в течение 5 минут и 25%-40% в течение 20 минут для предшественника ОХМ303, 25%-25% в течение 5 минут и 25%-35% в течение 20 минут для предшественника ОХМ304 и предшественника ОХМ305, скорость потока 80 мл/мин, длина волны 214 нм. Аналитическую ВЭЖХ выполняли на хроматографе Alliance Waters Chromatograph, с колонкой АСЕ C-4 (300 А), 3 мкм, 150×4,6 мм, (CPS analitica p/n АСЕ-213-1546), при 45°С, с использованием H2O, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей и следующего линейного градиента: 25%-25% В (на протяжении 5 минут) - 40% В (в течение 20 минут) - 80% В (в течение 2 минут), поток 1 мл/мин. Характеристики очищенного пептида получали масс-спектрометрией с электрораспылением на платформе Micromass LCZ.

Синтез С7 конъюгатов был следующим. Пептиды ОХМ301, ОХМ302, ОХМ303, ОХМ304 и ОХМ305 синтезировали из тиолсодержащего пептидного предшественника ОХМ ОХМ290-294 соответственно для получения производных с С7 группой, ковалентно прикрепленной через тиоэфирную группу цистеинового остатка на С-конце. В качестве примера дериватизации предшественника: 40 мг пептидного предшественника растворяли в 1,33 мл DMSO (концентрация 30 мг/мл) и добавляли 2,1 молярный избыток холест-5-ен-3-ил 1-бром-2-оксо-6,9,12,15-тетраокса-3-азаоктадекан-18-оат, растворенный в THF (концентрация 30 мг/мл). Затем в смесь добавляли 5% по объему DIPEA (N,N-диизопропилэтиламин); после 30 минут инкубации, реакцию останавливали добавлением по каплям уксуснокислого аммония (раствор 1 М в воде) до появления мути в растворе.

Затем раствор наносили непосредственно на картриджи Waters RCM Delta-Pak™ C-4 (20×200 мм, 15 мкм, 300 А) с использованием в качестве элюента 0,5 М уксуснокислого аммония, 20% MetOH, 25% ацетонитрила в воде, рН 7,8, при 5 мл/мин. Изократическую элюцию проводили в течение 15 минут этим буфером при 30 мл/мин. Затем элюенты изменяли на: (А) 0,2% уксусную кислоту, 20% MetOH в воде (В) 0,2% уксусную кислоту, 20% MetOH в ацетонитриле и затем пропускали следующий градиент: 25% (В) - 35% (В) в течение 5' - 70% (В) в течение 20' - 80% (В) в течение 2' - 80% (В), в течение 3', поток 30 мл/мин, длина волны 230 нм.

Окончательные пептиды характеризовали на хроматографе Alliance Waters Chromatograph, с использованием колонки АСЕ C-4 (300 А), 3 мкм, 150×4,6 мм (CPS analitica, N в каталоге АСЕ-213-1546), при 45°С, с использованием Н2О, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей и следующего линейного градиента: 40% - 40% В (в течение 5 минут) - 70% В (в течение 20 минут) - 80% В (в течение 2 минут), поток 1 мл/мин. Пептиды характеризовали масс-спектрометрией с электрораспылением на Micromass LCZ platform.

ПРИМЕР 5

Пептиды ОХМ237-ОХМ308 и ОХМ345-ОХМ414 синтезировали в твердой фазе с использованием стратегии Fmoc/t-Bu на пептидном мультисинтезаторе Simphony Protein Technologies Inc. Для амидов пептидов использовали 0,5 г смолы аминометилированного тиоэфира LL (100-200 меш, 0,41 ммоль/г) (Novabiochem), смола дериватизованная модифицированным линкером Ринка р-[(R,S)-α-[9Н-флуорен-9-ил-метоксиформамидо]-2,4-диметоксибензил)]-феноксиуксусная кислота (Rink, H., 1987, Tetrahedron Lett. 28:3787-3789; Bernatowicz, M.S. et al., 1989, Tetrahedron Lett. 30:4645-4667). Для кислых пептидов 0,5 г смолы аминометилированного тиоэфира LL (100-200 меш, 0,41 ммоль/г) (Novabiochem), дериватизованной 4-гидроксиметилфеноксиуксусной кислотой. Все аминокислоты растворяли в концентрации 0,5 М в растворе 0,5 M HOBt (гидроксибензотриазол) в DMF. Реакции ацилирования выполняли в течение 60 минут с 8-кратным избытком активированной аминокислоты относительно свободных аминогрупп смолы. Аминокислоты активировали эквимолярными количествами HBTU (2-(1Н-бензотриазол-1-ил)-1,1,3,3-тетраметилурония гексафторфосфат), раствор 0,5 М в DMF, и двукратным молярным избытком DIPEA (N,N-диизопропилэтиламин), раствор 2 М в NMP.

Защитными группами боковой цепи были: ОМре (O-3-метил-пент-3-ил) для Asp; терт-бутил для Glu, Ser, D-Ser, Thr и Tyr; тритил для Asn, Cys, Gln и His; и терт-бутокси-карбонил для Lys, Trp; и 2,2,4,6,7-пентаметилдигидробензофуран-5-сульфонил для Arg; в синтезе использовали Boc-His(Trt)-OH.

Для пептидов ОХМ392, 395 и 398 встраивали Glu16 и Lys20 в виде Glu(Oall) и Lys(Alloc). В конце сборки смолы высушивали, защитные группы Glu(Oall) и Lys(Alloc) удаляли и лактамный мостик образовывали инкубированием смолы с 5-молярным избытком HBTU и 10-молярным избытком DIPEA.

Для липидизированных пептидов, таких как ОХМ404, 407, 408, 410, 411, 414, 415, 416, 417, 418, 419, 420, лизин, который должен быть модифицирован по боковой цепи, встраивали в виде Lys(Alloc). В конце сборки защитную группу Аlloс удаляли и синтез завершали конденсацией остатков D-карбоксиглутаминовой кислоты и пальмитиновой кислоты с использованием HBTU и DIPEA в качестве активаторов.

В конце синтеза сухие смолы, содержащие пептиды (смола-пептид), по отдельности обрабатывали 25 мл смеси для отщепления (пептида от смолы): 82,5% трифторуксусной кислоты (TFA), 5% фенола, 5% тиоанизола, 2,5% этандитиола и 5% воды в течение 1,5 часов при комнатной температуре. Каждую смолу отфильтровывали, и объем раствора уменьшали, затем добавляли в холодный метил-т-бутиловый эфир для осаждения пептида. После центрифугирования осадки пептидов промывали свежим холодным метил-т-бутиловым эфиром для удаления органических ловушек. Процесс повторяли дважды. Окончательные осадки высушивали, ресуспендировали в H2O, 20% ацетонитриле и лиофилизировали.

Неочищенные пептиды очищали высокоэффективной жидкостной хроматографией (ВЭЖХ) с обращенными фазами с использованием препаративных картриджей Waters RCM Delta-PakTM C-4 (40×200 мм, 15 мкм) и с использованием в качестве элюентов (А) 0,1% TFA в воде и (В) 0,1% TFA в ацетонитриле. Аналитическую ВЭЖХ выполняли на хроматографе Alliance Waters, с АСЕ C-4 (300 А), колонкой 3 мкм, 150×4,6 мм (CPS analitica, N в каталоге АСЕ-213-1546), при 45°С, с использованием H2O, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей. Очищенные пептиды характеризовали масс-спектрометрией с электрораспылением на Micromass LCZ platform.

Синтез С5-конъюгатов был следующим. Пептид ОХМ238 синтезировали из тиолсодержащего пептидного предшественника ОХМ для получения производных с ацетамидом, ковалентно прикрепленным через тиоэфирную группу цистеинового остатка на С-конце. В качестве примера дериватизации предшественника: 50 мг пептидного предшественника растворяли в буфере Tris HCl 0,25 М, EDTA 2 мМ, Urea 6M рН 8,3 (концентрация 30 мг/мл) и добавляли 10 молярный избыток иодацетамида, растворенного в DMSO (концентрация 30 мг/мл). Через 30 минут реакция заканчивается. Раствор подкисляют уксусной кислотой и очищают на препаративной ВЭЖХ.

Синтез С4-конъюгатов был следующим. Пептиды ОХМ345, ОХМ355, ОХМ357, ОХМ373 синтезировали из тиолсодержащих пептидных предшественников ОХМ соответственно для получения производных с холестериновой группой, ковалентно прикрепленной через тиоэфирную группу цистеинового остатка на С-конце. В качестве примера дериватизации предшественника: 40 мг пептидного предшественника растворяли в DMSO (концентрация 30 мг/мл) и добавляли 2,1 молярный избыток холест-5-ен-3-ил 1-бром-2-оксо-6,9,12,15-тетраокса-3-азаоктадекан-18-оат, растворенный в THF (концентрация 30 мг/мл). Затем в смесь добавляли 5% по объему DIPEA (N,N-диизопропилэтиламина); через 30 минут инкубации (реакцию) останавливали добавлением по каплям уксуснокислого аммония (раствор 1 М в воде) до появления мути в растворе.

Затем раствор наносили непосредственно на картриджи Waters RCM Delta-Pak™ C-4 (20×200 мм, 15 мкм, 300 А) с использованием в качестве элюента 0,5 М уксуснокислого аммония, 20% MetOH, 25% ацетонитрила в воде, рН 7,8, при 5 мл/мин. Изократическую элюцию проводили в течение 15 минут этим буфером при 30 мл/мин. Затем элюенты изменяли на: (А) 0,2% уксусную кислоту, 20% MetOH в воде (В) 0,2% уксусную кислоту, 20% MetOH в ацетонитриле.

Окончательные пептиды характеризовали на хроматографе Alliance Waters Chromatograph, с АСЕ C-4 (300 А), 3 мкм колонкой, 150×4,6 мм (CPS, N в каталоге АСЕ-213-1546), при 45°С, с использованием H2O, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей. Пептиды характеризовали масс-спектрометрией с электрораспылением на Micromass.

Синтез С7-конъюгатов был следующим. Пептиды ОХМ359, ОХМ361, ОХМ374, ОХМ380, ОХМ383 и синтезировали ОХМ388 из тиолсодержащих пептидного предшественника ОХМ для получения производных с Оха4-холестерином, ковалентно прикрепленным через тиоэфирную связь цистеинового остатка на С-конце. В качестве примера дериватизации предшественника: 25 мг пептидного предшественника растворяли в 1,33 мл DMSO (концентрация 30 мг/мл) и добавляли 1,1 молярный избыток холест-5-ен-3-ил 1-бром-2-оксо-6,9,12,15-тетраокса-3-азаокстадекан-18-оат, растворенный в THF (концентрация 30 мг/мл). Затем в смесь добавляли 5% по объему DIPEA (N,N-диизопропилэтиламин); через 30 минут инкубации (реакцию) останавливали добавлением по каплям уксуснокислого аммония (раствор 1 М в воде) до появления мути в растворе.

Затем раствор наносили непосредственно на картриджи Waters RCM Delta-Pak™ С-4 (20×200 мм, 15 мкм, 300 А) с использованием в качестве элюента 0,5 М уксуснокислого аммония, 20% MetOH, 25% ацетонитрила в воде, рН 7,8, при 5 мл/мин. Изократическую элюцию проводили в течение 15 минут этим буфером при 30 мл/мин. Затем элюенты изменяли на: (А) 0,2% уксусную кислоту, 20% MetOH в воде (В) 0,2% уксусную кислоту, 20% MetOH в ацетонитриле и затем прогоняли следующий градиент: 25% (В) - 35% (В) в течение 5' - 70% (В) в течение 20' - 80% (В) в течение 2' - 80% (В), в течение 3', поток 30 мл/мин, длина волны 230 нм.

Окончательные пептиды характеризовали на хроматографе Alliance Waters Chromatograph, с колонкой АСЕ С-4 (300 А), 3 мкм, 150×4,6 мм (CPS analitica, N в каталоге АСЕ-213-1546), при 45°С, с использованием H2О, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей. Пептиды характеризовали масс-спектрометрией с электрораспылением на Micromass LCZ platform.

Синтез С9-конъюгатов был следующим. Пептид ОХМ381 синтезировали из тиолсодержащего предшественника пептида ОХМ для получения производных с окса12-холестерином, ковалентно прикрепленным через тиоэфирную связь малеимида с цистеиновым остатком на С-конце. В качестве примера дериватизации предшественника:

25 мг пептидного предшественника растворяли в DMSO (концентрация 30 мг/мл) и добавляли 1,5 молярный избыток холест-5-ен-3-ил N-[43-(2,5-диоксо-2,5-дигидро-1Н-пиррол-1-ил)-41-оксо-4,7,10,13,16,19,22,25,28,31,34,37-додекаокса-40-азатритетраконтан-1-оил]глицинат, растворенный в THF (концентрация 20 мг/мл). Затем в смесь добавляли 2% по объему DIPEA (N,N- диизопропилэтиламин); после 4-6 часов инкубации реакцию останавливали ледяной уксусной кислотой и прямо подвергали ВЭЖХ с обращенными фазами и очищали. Окончательные пептиды характеризовали на хроматографе Alliance Waters Chromatograph, с колонкой АСЕ С-4 (300 А), 3 мкм, 150×4,6 мм (CPS, N в каталоге АСЕ-213-1546), при 45°С, с использованием H2O, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей. Пептиды характеризовали масс-спектрометрией с электрораспылением на Micromass LCZ platform.

Синтез С10-конъюгатов был следующим. Пептиды ОХМ392, 395, 398, 399, 400, и 401 синтезировали из тиолсодержащих предшественников пептида ОХМ для получения производных с окса12-холестерином, ковалентно прикрепленным через тиоэфирную связь цистеинового остатка на С-конце. В качестве примера дериватизации предшественника: 25 мг пептидного предшественника растворяли в DMSO (концентрация 30 мг/мл) и добавляли 1,5 молярный избыток холест-5-ен-3-ил 1-бром-2-оксо-6,9,12,15,18,21,24,27,30,33,36,39-додекаокса-3-азадотетраконтан-42-оат в THF (концентрация 20 мг/мл). Затем в смесь добавляли 2% по объему DIPEA (N,N-диизопропилэтиламин); после 4-6 часов инкубации реакцию останавливали ледяной уксусной кислотой и прямо подвергали ВЭЖХ с обращенными фазами и очищали. Окончательные пептиды характеризовали на хроматографе Alliance Waters Chromatograph, с колонкой АСЕ С-4 (300 А), 3 мкм, 150×4,6 мм (CPS, N в каталоге АСЕ-213-1546), при 45°С, с использованием H2O, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей. Пептиды характеризовали масс-спектрометрией с электрораспылением на Micromass LCZ platform.

Синтез С11-конъюгатов был следующим. Пептиды ОХМ412 синтезировали из тиолсодержащего пептидного предшественника ОХМ для получения производных с окса24-холестерином, ковалентно прикрепленным через тиоэфирную связь к цистеиновому остатку на С-конце. В качестве примера дериватизации предшественника: 25 мг пептидного предшественника растворяли в DMSO (концентрация 30 мг/мл) и добавляли 1,5 молярный избыток холест-5-ен-3-ил 1-бром-2-оксо-6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51,54,57,60,63,66,69,72,75-тетракозаокса-3-азаоктагептаконтан-78-оат в THF (концентрация 20 мг/мл). Затем в смесь добавляли 2% по объему DIPEA (N,N-диизопропилэтиламин); после 4-6 часов инкубации реакцию останавливали ледяной уксусной кислотой и прямо подвергали ВЭЖХ с обращенными фазами и очищали.

Окончательный пептид характеризовали на хроматографе Alliance Waters Chromatograph, с колонкой АСЕ С-4 (300 А), 3 мкм, 150×4,6 мм (CPS, N в каталоге АСЕ-213-1546), при 45°С, с использованием H2О, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей. Пептиды характеризовали масс-спектрометрией с электрораспылением на Micromass LCZ platform.

Синтез С12-конъюгатов был следующим. Пептиды ОХМ421 синтезировали из тиолсодержащего пептидного предшественника ОХМ для получения производных с окса12-O-холестерином, ковалентно прикрепленным через тиоэфирную связь к цистеиновому остатку на С-конце. В качестве примера дериватизации предшественника: 25 мг пептидного предшественника растворяли в DMSO (концентрация 30 мг/мл) и добавляли 1,5 молярный избыток холест-5-ен-3-ил 1-бром-2-оксо-6,9,12,15,18,21,24,27,30,33,36-андекаокса-3-азаоктатриаконт-78-оат в THF (концентрация 20 мг/мл). Затем в смесь добавляли 2% по объему DIPEA (N,N-диизопропилэтиламин); после 4-6 часов инкубации реакцию останавливали ледяной уксусной кислотой и прямо подвергали ВЭЖХ с обращенными фазами и очищали.

Окончательный пептид характеризовали на хроматографе Alliance Waters Chromatograph, с колонкой АСЕ С-4 (300 А), 3 мкм, 150×4,6 мм (CPS, N в каталоге АСЕ-213-1546), при 45°С, с использованием H2O, 0,1% TFA (А) и CH3CN, 0,1% TFA (В) в качестве растворителей. Пептиды характеризовали масс-спектрометрией с электрораспылением на Micromass LCZ platform.

ПРИМЕР 6

Таблица 3 показывает описанные здесь структуры для природного ОХМ и аналогов ОХМ.

Таблица 3
Пептидные аналоги ОХМ
SEQ ID NO. Наименование Структура
1 ОХМ (природный) HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
2 ОХМ8 (Q3E) HSEGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
3 ОХМ9 (Q3D) HSDGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
4 ОХМ29 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC-CONH2
5 ОХМ33 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC1-CONH2
6 ОХМ34 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC2-CONH2
7 ОХМ35 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC3-CONH2
8 ОХМ36 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2
9 ОХМ67 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC1-CONH2
10 ОХМ68 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC2-CONH2
11 ОХМ69 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC3-CONH2
12 ОХМ70 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2
13 ОХМ99 HαQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIAC3-CONH2
14 ОХМ100 HαQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIAC6-CONH2
15 ОХМ103 HαQGTFTSDYSKYLDSRRACsDFVQWLMNTKRNRNNIA-CONH2
16 ОХМ105 HαQGTFTSDYSKYLDSRRAQCsFVQWLMNTKRNRNNIA-CONH2
17 ОХМ107 HαQGTFTSDYSKYLDSRRAQDFVCaWLmNTKRNRNNIA-CONH2
18 ОХМ109 HαQGTFTSDYSKYLDSRRAQDFVQWLMCsTKRNRNNIA-CONH2
19 ОХМ110 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK(пальмитоил)-CONH2
20 ОХМ113 H2αQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIAC3-CONH2
21 ОХМ115 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC7-CONH2
22 ОХМ121 HαQGTFTSDYCsKYLDSRRAQDFVQWLmNTKRNRNNIA-CONH2
23 ОХМ124 HαQGTFTSDYSCaYLDSRRAQDFVQWLmNTKRNRNNIA-CONH2
24 ОХМ177 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK(пальмитоил)-CONH2
25 ОХМ208 HαQGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC-CONH2
26 ОХМ209 HαQGTFTSDYSKYLDSRRAQDFVQWLoNTKRNRNNIAC-CONH2
27 ОХМ212 HαQGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC4-CONH2
28 ОХМ213 HαQGTFTSDYSKYLDSRRAQDFVQWLoNTKRNRNNIAC4-CONH2
29 ОХМ216 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC7-CONH2
30 ОХМ229 (предшественник ОХМЗ3-36) HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC-CONH2
31 ОХМ237 HsQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIA-C7-CONH2
32 ОХМ238 HsQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIA-C5-CONH2
33 ОХМ259 H-Acx-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
34 ОХМ260 H-Abu-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
35 ОХМ261 H-(D-Abu)-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
36 ОХМ262 H-Nva-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
37 ОХМ263 H-Cpa-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
38 ОХМ264 H-Prg-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
39 ОХМ265 H-Alg-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
40 ОХМ266 H-(2-Cha)-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
41 ОХМ267 H-(Dtbg)-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
42 ОХМ268 H-Vg-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
43 ОХМ306 H-Acp-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
44 ОХМ307 H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
45 ОХМ308 H-Acpe-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-CONH2
46 ОХМ290 HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC-CONH2
47 ОХМ291 HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKC-CONH2
48 ОХМ292 HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKC-CONH2
49 ОХМ293 HsQGTFTSDYSKYLDSERAQDFVQWLMNTKC-CONH2
50 ОХМ294 HsQGTFTSDYSKYLDSRAAQDFVQWLMNTKC-CONH2
51 ОХМ301 HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC7-CONH2
52 ОХМ302 HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKC7-CONH2
53 ОХМ303 HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKC7-CONH2
54 ОХМ304 HsQGTFTSDYSKYLDSERAQDFVQWLMNTKC7-CONH2
55 ОХМ305 HsQGTFTSDYSKYLDSRAAQDFVQWLMNTKC7-CONH2
56 ОХМ311 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKK(пальмитоил)-CONH2
57 ОХМ312 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKK(пальмитоил)-CONH2
58 ОХМ314 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-Ttds-K(пальмитоил)-CONH2
59 ОХМ313 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-Ttds-K(пальмитоил)-CONH2
60 ОХМ317 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-C4-CONH2
61 ОХМ318 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-γE-C4-CONH2
62 ОХМ319 HαQGTFTSDYSKYLDSEAAQDFVQWLMNTKC7-CONH2
63 ОХМ321 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA-γE-C4-CONH2
64 ОХМ323 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKR-C7-CONH2
65 ОХМ325 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC7-COOH
66 ОХМ327 HαQGTFTSDYSKYLDSERAQDFVQWLMNTKC7-CONH2
67 ОХМ329 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-C4-COOH
68 ОХМ330 HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA-γE-K(пальмитоил)-CONH2
69 ОХМ345 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C4-COOH
70 ОХМ355 HSQGTFTSDYSSYLDSRRAQDFVQWLMNTK-γE-C4-COOH
71 ОХМ357 HSQGTFTSDYSKYLDSRAAQDFVQWLMNTK-γE-C4-COOH
72 ОХМ359 HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK-γE-C7-COOH
73 ОХМ361 HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK-γE-C7-COOH
74 ОХМ373 HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-C4-COOH
75 ОХМ374 HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-C7-COOH
76 ОХМ380 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C7-COOH
77 ОХМ381 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C9-COOH
78 ОХМ383 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C7-COOH
79 ОХМ388 H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C7-COOH
80 ОХМ392 HsQGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE-С10-СООН (лактамный мостик между Е и K)
81 ОХМ395 HαQGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE-C10-COOH (лактамный мостик между Е и K)
82 ОХМ398 H-Acb-QGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE-C10-COOH (лактамный мостик между Е и K)
83 ОХМ399 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C10-COOH
84 ОХМ400 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C10-COOH
85 ОХМ401 H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C10-COOH
86 ОХМ404 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-K(γE-пальмитоил)-CONH2
87 ОХМ406 HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-γE-Cio-CONH2
88 ОХМ407 HsQGTFTSDYSKYLDSRRAK(γE-пальмитоил)DFVQWLMNTK-γEγE-CONH2
89 ОХМ408 HsQGTFTSDYSKYLDSRRAK(γE-γE-пальмитоил)DFVQWLMNTK-γE-CONH2
90 ОХМ409 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDSRRAQDFVQWLMNTK-CONH2
91 ОХМ410 HsQGTFTSDYSKYLDERRAK(γE-γE-пальмитоил)DFVQWLMNTK-CONH2
92 ОХМ411 HsQGTFTSDK(YE-γE-nanbMHTOnn)SKYLDERRAQDFVQWLMNTK-CONH2
93 ОХМ412 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-С11-СООН
94 ОХМ413 HaDGTFTSDYSKYLDSRRAQDFVK(DOTA)WLmNTK-γE-γE-C10-CONH2
95 ОХМ414 HsQGTFTSDK(γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-γE-CONH2
96 ОХМ415 HsQGTFTSDK(пальмитоил)SKYLDERRAQDFVQWLMNTK-γE-γE-CONH2
97 ОХМ416 HαQGTFTSDK(γE-γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-CONH2
98 ОХМ417 H-Acb-QGTFTSDK(γYE-γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-CONH2
99 ОХМ418 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDaRRAQDFVQWLMNTK-γE-CONH2
100 ОХМ419 HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-K(γE-пальмитоил)-CONH2
101 ОХМ420 H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-K(YE-пальмитоил)-СОМН2
102 ОХМ421 HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-C12-COOH
111 MM 102 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDaRRAQDFVQWLMNTE-γE-CONH2
112 MM103 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDaRRAQDFVQWLMNTk-γE-CONH2
113 MM111 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDERRAQDFVQWLMNTK-γE-CONH2
114 MM113 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDaRRAQDFVQWLMNTE-γE-CONH2
115 MM114 HsQGTFTSDK(E-E-пальмитоил)SKYLDERRAQDFVQWLMNTK-γE-CONH2
116 MM115 HsQGTFTSDK(R-R-пальмитоил)SKYLDERRAQDFVQWLMNTK-γE-CONH2
117 MM116 HsQGTFTSDK(X-X-пальмитоил)SKYLDERRAQDFVQWLMNTK-γE-CONH2
118 MM117 HsQGTFTSDK(e-e-пальмитоил)SKYLDERRAQDFVQWLMNTK-γE-CONH2
119 MM121 HsQGTFTSDK(γE-γE-миристоил)SKYLDaRRAQDFVQWLMNTK-γE-CONH2
120 MM127 HsQGTFTSDK(γE-γE-пальмитоил)SKYLDaRAAQDFVQWLMDTK-γE-CONH2
121 ММ132 HsQGTFTSDK(γE-γE-стеароил)SKYLDaRRAQDFVQWLMNTK-γE-CONH2
α = α-аминоизомасляная кислота (Aib); s = D-Ser; n =L-норлейцин (Nle), о = O-метилгомосерин; m = метионинсульфоксид; H2 = дезамино-His (ΔNH2-Н); Асх = 1-амино-1-циклогексан-карбоновая кислота; Abu = α-аминомасляная кислота; D-Abu = D-α-аминомасляная кислота; Nva = аминовалериановая кислота; Сра = β-циклопропилаланин; Prg = пропаргилглицин; Alg = аллилглицин; 2-Cha = 2-амино-2-циклогексил-пропионовая кислота; D-tbg = D-терт-бутилглицин; Vg = винилглицин; Аср = 1-амино-1-циклопропан-карбоновая кислота; Acb = 1-амино-1-циклобутан-карбоновая кислота; Асре = 1-амино-1-циклопентан-карбоновая кислота; k = D-lys; e = D-Glu; X = гомоцистеиновая кислота; γе=D-гамма-глутаминовая кислота;
C1=Cys(mPEG) 5 кДа;
С2=Cys(mPEG) 20 кДа;
С3=Cys(mPEG) 240 кДа, каждый соответствует цистеиновому остатку, ПЭГилированному с использованием тиола боковой цепи с линейным метоксиПЭГ (mPEG) или разветвленным mPEG [(mPEG)2] указанной молекулярной массы (MW);
С4=Cys(холест-5-ен-3-ил{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}ацетат);
C5=Cys(CH2CONH2), соответствует цистеиновому остатку, в котором тиол боковой цепи подвергали взаимодействию с иодацетамидом;
С6=Cys(mPEG) 260 kDa, каждый соответствует цистеиновому остатку, ПЭГилированному с использованием тиола боковой цепи с линейным метоксиПЭГ (mPEG) или разветвленным mPEG2mPEG [(mPEG)2] указанной молекулярной массы (MW);
С7=Cys(холест-5-ен-3-ил 1-{[(2R)-3-амино-2-(амино)-3-оксопропил]тио}-2-оксо-6,9,12,15-тетраокса-3-аза-октадекан-18-оат) или Cys(Oxa4-холестерин)
С8=Cys(N-этилмалеимидил).
С9=S-{1-[46-(холест-5-ен-3-илокси)-3,43,46-триоксо-7,10,13,16,19,22,25,28,31,34,37,40-додекаокса-4,44-диазагексатетраконт-1-ил]-2,5-диоксопирролидин-3-ил}-L-цистеин или Cys(мал-окса12-холестерин)
С10=5-[42-(холест-5-ен-3-илокси)-2,42-диоксо-6,9,12,15,18,21,24,27,30,33,36,39-додекаокса-3-азадотетраконт-1-ил]-L-цистеин или Cys(окса12-холестерин)
С11=5-[78-(холест-5-ен-3-илокси)-2,78-диоксо-6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51,54,57,60,63,66,69,72,75-тетракосаокса-3-азаоктагептаконт-1-ил]-L-цистеин или Cys(окса24-холестерин)
С12=S-[38-(холест-5-ен-3-илокси)-2-оксо-6,9,12,15,18,21,24,27,30,33,36-ундекаокса-3-азаоктатриаконт-1-ил]-L-цистеин или Cys(окса12-О-холестерин)
Ttds = 1-амино-4,7,10-тиокса-13-тридеканамин янтарная кислота
γЕ = гамма-глутаминовая кислота
пальмитоил = С14 остаток жирной кислоты
миристоил = С14 остаток жирной кислоты
стеароил = С18 остаток жирной кислоты

ПРИМЕР 7

Демонстрируют способность коагонистов GLP-1R/GCGR снижать массу тела и поглощение пищи и улучшать гликемический контроль.

Авторы изобретения с самого начала произвели скрининг пептидов в анализах, основанных на флуоресценции клеток, которые измеряют образование циклического АМФ (цАМФ), с использованием клеточный линий СНО (пер., яичника китайского хомячка), стабильно экспрессирующих или рекомбинантный человеческий GLP-1R, или человеческий GCGR. Определение агонистической активности мышиного и человеческого GLP-1R и GCGR было, по существу, следующим. Клетки СНО, стабильно экспрессирующие мышиный или человеческий GLP-1R или GCGR выращивали в среде Дульбекко, модифицированной по способу Исков (Iscove's Modified Dulbecco's Medium) (IMDM), 10% FBS (пер., фетальная телячья сыворотка), 1 мМ L-глутамин, пенициллин-стрептомицин (100 мкг/мл) и 750 мкг С418/мл в течение трех-четырех дней до сбора с использованием среды для диссоциации, не содержащей ферментов Enzymefree Dissociation Media (EFDM, Specialty Media). Для определения активности GLP-1R и GCGR ОХМ и OXM-Q3E разбавляли в буфере для анализа и инкубировали с клетками в отсутствие или в присутствии 10% мышиной плазмы, соответственно, в течение 30 мин при комнатной температуре. Анализ останавливали добавлением буфера для детектирования LANCE kit Detection buffer в соответствии с инструкциями производителя. Планшеты выдерживали дополнительный час при комнатной температуре, затем детектировали возрастающие уровни цАМФ снижением сигнала в TR-FRET (пер., анализе резонансного переноса энергии флюоресценции с разрешением во времени), как измерено в счетчике EnVision counter (PerkinElmer) по сравнению с калибровочной кривой цАМФ в соответствии с инструкциями производителя. Данные анализировали с использованием программного обеспечения для анализа линейной и нелинейной регрессии GraphPad Prism.

Оценка полезности двойных коагонистов GLP-1R/GCGR (миметика ОХМ) в сравнении с селективным агонистом GLP-1R (миметиком GLP-1) была следующей. Первым, для оценки терапевтической ценности двойного агониста GLP-1R/GCGR (миметика ОХМ), идентифицировали совместимый пептид, который был селективным только для рецептора GLP-1 (миметик GLP-1), но отличался от природного ОХМ только одной аминокислотой. Этот пептид отличался от природного ОХМ наличием остатка глутаминовой кислоты (Е) в положении 3 вместо глутамина (Q). Вторым идентифицировали миметик GLP-1, который имел остаток аспарагиновой кислоты (D) вместо Q. Сравнивали эффективность миметика GLP-1 и миметика ОХМ в улучшении метаболического контроля у грызунов. Эти пептиды и человеческий ОХМ синтезировали и очищали в GL Biochem (Shanghai) Ltd.

В таблице 4, активности in vitro аффинности связывания с рецептором природного ОХМ и пептидов OXM-Q3E и OXM-Q3D. Мутация третьего остатка из нейтрального Q в кислый остаток, например D или Е, существенно снижает активность природного оксинтомодулина связываться с глюкагоновым рецептором, при наличии минимального эффекта на активность рецептора GLP-1.

Таблица 4
Пептид GLP-1R IC50 (нМ) GLP-1R ЕС50 (нМ) GCGR IC50 (нМ) GCGR ЕС50 (нМ) % активаци и GCGR Селективность
ОХМ 93 9.2 7.7 0.6 87 +/+
OXM-Q3E 237 12.4 ND 1635 17 +/0
OXM-Q3D Не тестировали 2.3 He тестировали 3398 1 +/0

Авторы изобретения дополнительно оценивали способность природного ОХМ и OXM-Q3E (GLP-1-миметика) взаимодействовать с GCGR in vivo, как в анализе гликогенолиза ех vivo, так в анализе занятости рецептора GCGR in vivo. Поскольку обнаружение эффективности in vivo пептидов часто ставило в тупик от несоответствующих фармакокинетических свойств, анализ на перфузированной печени предлагает альтернативный способ оценки ех vivo анализируемых пептидов на активность в представляющем интерес функционирующем органе.

Животные для анализов in vivo:

Мужские особи мышей C57BL/6 10-12-недельного возраста худые или с вызванным режимом питания ожирением приобретали у Taconic Farms (Germantown, NY) и содержали в отдельных клетках Tecniplast в традиционном сооружении, свободном от специфической патогенной микрофлоры. Мышей поддерживали или на правильном рационе питания ((питание) Teklad 7012: 13,4% ккал, исходя из жира; Harlan Teklad), или рационе с высоким содержанием жиров (D12492: 60% ккал, исходя из жира; Research Diets, Inc.) с неограниченным {ad libitum) доступом к воде в 12-часовой световой/12-часовой темновой период, если не оговорено иное.

Интраперитонеальный тест на толерантность к глюкозе. Мужские особи мышей C57BL/6N распределяли по весу на лечебные группы (n=6/группу). На утро исследования еду исключали и мышам вводили подкожно (s.c.) носитель (стерильную воду) ОХМ или OXM-Q3E из расчета 0,01, 0,03, 0,1, 0,3, 1 или 3 мг/кг, 10 мин перед сахарной нагрузкой. Концентрации глюкозы в крови определяли в Т=-10 минут и Т=0 минут (исходный уровень). Затем мышей немедленно нагружали, внутрибрюшинно, D-глюкозой (2 г/кг). Одну группу мышей, леченных носителем, нагружали 0,9% физиологическим раствором в качестве отрицательного контроля. Уровни глюкозы в крови определяли путем кровопускания из хвостовой части, взятого через 20, 40 и 60 мин после нагрузки D-глюкозой. Профиль колебания уровня глюкозы в крови - от Т=0 до Т=60 минут использовали для интегрирования площади под кривой (AUC) для каждого лечения. Значения процента ингибирования для каждого лечения получали из данных AUC, нормализованных по отношению к контролям, нагруженным физиологическим раствором. Площади под кривой (AUC) для глюкозы (AUC глюкоза) вычисляли с использованием трапецеидального метода. Статистические данные. Статистический анализ делали с использованием двустороннего непарного t-критерия Стьюдента. Значения Р<0,05 считали статистически достоверными.

Анализ гликозенолиза в печени.

Гуманизированных мышей GCGR (C57B/6N) анестезировали (нембутал, IP (внутрибрюшинно), 50 мг/кг) в середине темнового периода. Затем в воротную вену вводили катетер, и печень отсекали и перфузировали предварительно оксигенированным бикарбонатным буферным раствором Кребса-Хенселейта в течение 5-10 минут, который сначала не подвергали рециркуляции, для отмывки любых эндогенных субстратов. Затем печень помещали в 20 мм ампулу для ЯМР-спектроскопии и исходный раствор Кребса заменяли на перфузируемую жидкость (перфузат) Кребс-БСА (пер., содержащую бычий сывороточный альбумин) (приблизительно 72 мл, 2,5% БСА), которую подвергали рециркуляции. 31 Р ЯМР-спектроскопию сначала выполняли для изучения уровней АТФ и неорганического фосфата (Pi) для оценки жизнеспособности печени. Затем создавали видимый в 13С-ЯМР пул гликогена добавлением в перфузат глюконеогенного субстрата [2-13С]-пирувата и хлорида аммония (~7 мМ и 1 мМ, соответственно), и проводили мониторинг в режиме реального времени количества 13С-гликогена, содержащегося в печени с использованием С1-резонанса глюкозильных единиц гликогена. Через 45 минут перфузировали ОХМ, OXM-Q3E, глюкагон или носитель и последующий ответ уровней гиликогена использовали для оценки активации GCGR (пер., рецептора глюкагона) (Bergans et al., NMR Biomed. 16:36-46, (2003)). Глюкозозависимая секреция инсулина (GDIS). Для измерения GDIS выделяли панкреатические островки мыши коллагеназным методом с использованием процедуры катетеризации протока поджелудочной железы и очистки в градиенте плотности (Mu et al., Diabetes 55:1695-704, (2006)) и инкубировали с 2 или 16 ммоль/л глюкозы. Инсулин измеряли в аликвотах буфера для инкубации твердофазным иммуноферментным анализом; с использованием коммерческого набора (ALPCO diagnostics, Windham, NH). Протоколы исследования животных анализировали и утверждали научно-исследовательскими лабораториями Институционального комитета по уходу за животными и их использованию, Merck, Rahway, NJ.

13С ЯМР-спектроскопию использовали для неинвазивного контроля в режиме реального времени уровней гликогена и глюкозы в ответ на неотложное лечение новыми аналогами окисинтомодулина. Мышей, экспрессирующих человеческий GCGR (рецептор глюкагона), анестезировали (нембутал, IP, 50 мг/кг) приблизительно в середине темнового периода. Затем воротную вену канюлировали и перевязывали и печень отсекали. Затем печень помещали в 20 мм ампулу для ЯМР-спектроскопии и исходный раствор Кребса заменяли на перфузируемую жидкость (перфузат) Кребс-БСА (пер., содержащую бычий сывороточный альбумин), которая рециркулировала. 31Р ЯМР-спектроскопию сначала выполняли для изучения уровней АТФ и неорганического фосфата (Pi) в печени, которые могут быть использованы для оценки жизнеспособности печени. Затем создавали видимый в 13С-ЯМР пул гликогена добавлением (в перфузат) глюконеогенного субстрата [2-13С]-пирувата+NH4Cl, и проводили мониторинг в режиме реального времени количества гликогена, содержащегося в печени с использованием С1-резонанса глюкозильных единиц гликогена. Приблизительно через 45 минут инфузировали ОХМ или пептидные аналоги ОХМ и последующий ответ уровней гликогена использовали для оценки активации человеческого GCGR. Область С1-резонанса глюкозильных единиц гликогена изображена графически за период времени на фигуре 1 для (вариантов) печени, которые получали или пептидные аналоги ОХМ, 50 пМ глюкагона, или среду. Как можно видеть ниже, природный ОХМ индуцирует гликогенолиз в зависимости от дозы и индуцирует полный гликогенолиз при 1,5 нМ и имеет приблизительно ЕС50 (пер., эффективная концентрация вещества, воздействие которой соответствует 50% максимальной реакции) 0,5 нМ, для сравнения, OXM-Q3E индуцировал только приблизительно 58% при 300 нМ, сопоставимую с его низкой активностью (в виде) агониста GCGR.

Учитывая способность ОХМ стимулировать устойчивый ответ гликогенолиза, авторы изобретения дополнительно изучили оккупацию ОХМ (оксинтомодулином) и OXM-Q3E рецептора GCGR in vivo в конкурентном анализе на мышах дикого типа. Трем группам мышей вводили подкожно определенными дозами или носитель (суммарное количество), носитель и холодный глюкагон (неспецифическое связывание), или OXM-Q3E. Приблизительно через 15 минут после введения дозы вводили внутривенно 1251-глюкагон и приблизительно через 15 минут получали печень и анализировали суммарную радиоактивность. Как показано на фиг.2, глюкагон (GCG) при 1,5 мг/кг давал 84% оккупации GCGR, 3 мг/кг ОХМ давало 31% оккупации GCGR и OXM-Q3E давал 0% оккупации GCGR.

С использованием совместимых пептидов, ОХМ, OXM-Q3E, авторы изобретения исследовали как острые, так и хроническое фармакологическое действие коагонизма обоих рецепторов в хроническом гипергликемическом клэмп-тесте и в изучении хронического поглощения пищи (FI) и массы тела (BW) (таблица 5), и в остром тесте на толерантность к внутрибрюшинно (IP) вводимой глюкозе (IPGTT, фигура 3). Тогда как оба пептида эффективно улучшали толерантность к глюкозе, OXM-Q3E превосходил природный ОХМ в снижении амплитуды колебаний уровня глюкозы как у худых мышиных моделях, так и с вызванным режимом питания ожирением (DIO). Однако природный пептид доказал свое превосходство в снижении потребления пищи и массы тела (ΔBW: -6% для ОХМ против -2.4% для OXM-Q3E при 5 мг/кг) у мышей DIO, эффект приписанный коагонизму GCGR. Как в остром, так и в хроническом примерах природный ОХМ не вызывал повышенной амплитуды колебаний уровня глюкозы.

Таблица 5
Фармакодинамические ожидаемые результаты после 14 дней хронической инфузии ОХМ и OXM-Q3E для оценки эффектов на поглощение пищи и массу тела.
Измерение Носитель ОХМ 0.5 мг/кг ОХМ 1.5 мг/кг ОХМ 5 мг/кг OXM-Q3E 0.5 мг/кг OXM-Q3E 1.5 мг/кг OXM-Q3E 5 мг/кг
Суммарное изменение веса (г) 1,07 0,54 -3,5 -5,32 -0,21 -1,27 -0,21
Суммарное изменение поглощения пищи (ккал) 228 223 206 199 215 213 207

Гипергликемический клэмп-тест.

Мышей DIO (16 недель на рационе с высоким содержанием жиров) анестезировали ксилазином и кетамином и (мышам) вводили катетер в правую яремную внутреннюю вену за 3 дня до исследований in vivo. Инфузировали 25% глюкозу и корректировали с продолжительностью эксперимента для поддержания гипергликемии. Вследствие короткого времени полужизни пептидов (так как быстро инактивируются дипептидилпептидазй IV и выводится почками (Zhu et al., J. Biol. Chem. 278: 22418-23, (2003)), носитель, ОХМ (~16 мкг/кг/мин) и OXM-Q3E (~16 мкг/кг/мин) инфузировали внутривенно в течение последних 60 минут исследования. Для инфузии использовали венозный катетер и пробы крови собирали через хвостовую вену. Для каждого животного проводили мониторинг в отношении поглощения пищи и увеличения массы тела после оперативного вмешательства для уверенности в полном восстановлении. Гипергликемические клэмп-методы выполняли на бодрствующих в условиях свободного поведения мышах с введенными катетерами, как описано ранее (Pocai et al., Nature. 43:1026-31, (2005)). Вкратце, глюкозу в плазме измеряли глюкометром «в одно касание» каждые 10 минут в течение 2 часового периода. Двадцати пяти процентную глюкозу (D-глюкоза, Sigma) инфузировали i.v. (внутривенно) и уровень доводили периодически до уровней глюкозы в плазме клэмп-метода (~20 мМ). Через один час после начала инфузии и до конца периода вводили ОХМ (~16 мкг/кг/мин), OXM-Q3E (16 мкг/кг/мин) и носитель (стерильный физиологический раствор). Скорость инфузии глюкозы (GIR) адаптировали к массе тела.

Результаты гипергликемического клэмп-теста показаны на фиг.3А и 3В. Уровни глюкозы в крови поддерживали на уровне приблизительно 20 ммоль/л во время клэмп-метода. У животных, обработанных OXM-Q3E, быстрый и надежный рост инфузии глюкозы (GIR, скорость инфузии глюкозы) был необходим для поддержания гипергликемии по сравнению с мышами, обработанными носителем (GIRO-60 55±4 по сравнению с 6±2 мг/кг/мин; OXM-Q3E по сравнению с носителем; р<0,05). ОХМ также повышал скорость инфузии глюкозы, необходимой для поддержания гипергликемии (GIRO-60=40±4 по сравнению с 6±2 мг/кг/мин; ОХМ по сравнению с носителем, р<0,05), но повышение GIR (повышение скорости инфузии глюкозы) было приблизительно на 30% ниже, чем в группе OXM-Q3E (GIRO-60=40±4 по сравнению с 55±4 мг/кг/мин; ОХМ по сравнению с OXM-Q3E соответственно, р<0,05), и эффект снижения уровня глюкозы был замедленным (приблизительно на 10 минут) по сравнению с мышами, обработанными OXM-Q3E, *р<0,05 по сравнению с носителем.

Сравнивали эффект ОХМ или OXM-Q3E на амплитуду колебаний уровня глюкозы у тощих мышей C57BL/6N. Фигура 4 показывает, что как природный ОХМ, так и пептидные аналоги ОХМ снижают амплитуду колебаний уровня глюкозы. Подкожное введение любого пептида, перед нагрузкой декстрозой (Стах в плазме) в тесте на толерантность к внутрибрюшинно (i.p.) вводимой глюкозе (IPGTT), существенно снижало амплитуду колебаний уровня глюкозы в зависимости от дозы. Сравнение минимальной эффективной дозы указывает на то, что OXM-Q3E является приблизительно в 10 раз более эффективным в снижении глюкозы, чем природный пептид (ЕС50 in vivo 0,055 нМ и 0,38 нМ соответственно).

ПРИМЕР 8

Природный ОХМ имеет период полураспада (tS) in vivo приблизительно от 8 до 12 минут у человека, неподходящий для лечения лекарственными средствами. Таким образом, авторы изобретения исследовали добавление объемных заместителей в пептид для снижения почечного клиренса.

Молекулы PEG (ПЭГ) различной молекулярной массы или М-этилмалеиимид конъюгировали с пептидом ОХМ в различных положениях на всем протяжении молекулы конъюгированием с боковой цепью введенного цистеинового остатка. Положения, которые были исследованы для конъюгации или с Cys-N- этилмалеимид, или с молекулой Cys-ПЭГ, подчеркнуты в нижеприведенной аминокислотной последовательности для ОХМ (SEQ ID NO:1), или помещены на С-конце ОХМ.

HSQGT FTSDY SKYLD SRRAQ DFVQW LMNTK RNRNN IA

Неожиданно, но, по-видимому, ПЭГилирование (от 5 до 80 кДа) существенно снижает способность пептидного аналога активировать или GCGR, или как GLP-1R, так и GCGR. В некоторых случаях введение цистеинового остатка, покрытого N-этилмалеимидом, было достаточным для существенного снижения активности. Результаты показаны в таблице 6.

Таблица 6
Пептидный аналог Конъюгат/Положение GLP-1R ЕС50 (нМ) GCGR ЕС50 (нМ) Активация GCGR, % GCGR+10% сыворотка (нМ), кратность сдвига Избирательность рецептора
ОХМ33 5K-PEG/C38 115 75.3 78 - 0/0
ОХМ34 20K-PEG/C38 195 616 61 - 0/0
ОХМ35 40K-PEG/C38 716 142 71 - 0/0
ОХМ67 5K-PEG/C38 5,8 138 73 - +/0
ОХМ68 20K-PEG/C38 8,3 601 58 - +/0
ОХМ69 40K-PEG/C38 6 >1000 46 - +/0
ОХМ99 40K-PEG/C38 7,4 >1000 66 - +/0
ОХМ100 60K-PEG/C38 22,5 >1000 22 - ~/0
ОХМ103 40K-PEG/C20 6,2 203 75 - +/0
ОХМ105 40K-PEG/C21 28,5 648 21 - ~/0
ОХМ107 40K-PEG/C24 29,7 >1000 30 - ~/0
ОХМ109 40K-PEG/C28 7,6 >1000 65 - +/0
ОХМ113 40K-PEG/C38 93,3 >1000 58 - 0/0
ОХМ121 40K-PEG/C11 >125 ND - - 0/0
ОХМ124 40K-PEG/C12 >100 ND - - 0/0

ПРИМЕР 9

В качестве альтернативы ПЭГилированию авторы изобретения оценивали несколько липидизированных пептидных аналогов ОХМ для улучшения фармакокинетического профиля.

Сначала авторы изобретения конъюгировали пептиды с холестериновой группой с использованием боковой цепи цистеина и снова измеряли способность пептидов стимулировать продуцирование цАМФ в клеточных линиях, трансфицированных GLP-1R и GCGR. Конъюигироване по С-концу было наиболее предпочтительным расположением для конъюгирования и были идентифицированы аналоги ОХМ с низкими наномолярными активностями рецептора. Неожиданно, анализ этих пептидов в анализе гликогенолиза на перфузируемой печени ex vivo показал, что активность агониста GCGR in vitro не было правильно отражающей активацию GCGR в печени (см., ОХМ70 на фиг.5). Измерение активности агониста в 10-20% плазме, добавленной в клеточный анализ in vitro, выявило существенный "сдвиг (смещение) сыворотки", который эффективно снижал активность более чем в >40 раз (см., табл. 7), давая возможность предположить, что молекулы, содержащие холестерин, связываются с липидом и/или белком в плазме, снижая эффективную концентрацию.

Таблица 7
Активности in vitro отобранных липидизированных пептидных аналогов ОХМ
Пептид Конъюгат/Положение GLP-1R ЕС50 (нМ) GCGR ЕС50 (нМ) %
Активация GCGR
GCGR+10% плазма (нМ), (кратность сдвига) Избирательность смещения плазмы
ОХМ36 Холестерин/С38 0,1 12,1 107 ?? +/+
ОХМ70 Холестерин/С38 0,15 2,4 104 169 (70х) +/0
ОХМ212 Холестерин/С38 0,6 11,3 115 1034 (92х) +/0
ОХМ213 Холестерин/С38 0,3 27,6 107 1209 (44х) +/0
ОХМ110 Пальмитоил/К38 0,7 0,31 104 6.9 (23х) +/+
ОХМ115 Oxa4-Chol/C38 0,08 0,33 100 0.64 (2х) +/+
ОХМ177 Пальмитоил/К38 0,1 0,59 93 3 (5х) +/+
ОХМ216 Oxa4-Chol/C38 3,1 0,63 93 12 (19х) +/+
ОХМ229 Предшественник С38 ? ? ? Не анализировали ?
ОХМ208 Предшественник С38 ? ? ? Не анализировали ?
ОХМ209 Предшественник С38 ? ? ? Не анализировали ?

Фигура 5А показывает измерение ex vivo гликогенолиза в перфузируемой печени в присутствии ОХМ70, ОХМ110, ОХМ177, ОХМ115 и ОХМ216. Фигура 5В показывает занятость GGCR после подкожного (s.c.) или внутривенного (i.v.) введения ОХМ70, ОХМ110, ОХМ177, ОХМ115 и ОХМ216 в сравнении с природным ОХМ в конкурентном анализе у мышей дикого типа.

ПРИМЕР 10

Для того чтобы смягчить эффекты связывания с плазмой на механизмы вовлечения рецепторов, авторы изобретения использовали модифицированную стратегию для улучшения фармакокинетики путем включения гидрофильного линкера между пептидом и холестериновой группой. Добавление тетраэтокси линкера (Оха4) между молекулой холестерина и пептидом существенно снижало наблюдаемый выше эффект при добавлении плазмы в клеточный анализ, т.е. снижало "сдвиг (смещение) сыворотки" всего в 2 раза, как показано в таблице 8. Кроме того, замена или аминоизомасляной кислотой (Aib), или D-серином (D-Ser) во втором положении аминокислоты дополнительно улучшала аффинность как с GLP-1R, так и с GCGR. Авторы изобретения подтвердили это в наблюдениях in vitro, как в анализе гликогенолиза ех vivo, так и в анализе связывания рецептора (к глюкагону) GCG (см., табл. 8), получением результатов, которые подтвердили, что конъюгирование с гидрофильно связанной холестериновой группой или ацильной цепью приводило к идентификации молекул, которые эффективно оккупировали рецептор и активировали GCGR.

Таблица 8
Краткое изложение измерений взаимодействия с GGCR различных липидизированных пептидов
Аналог Замещение по второму положению Конъюгирование Гликогенолиз, % Гликогенолиз, 100% % RO при 3 мг/кг подкожно
Oxm-70 Aib Холестерин ~0% при 10 нМ 100% при 100 нМ ~0
Oxm-110 D-Ser Пальмитоил 100% при 1 нМ 100% при 10 нМ Не анализировали
Oxm-177 Aib Пальмитоил 21% при 1 нМ 100% при 4 нМ 30 (±3)
Oxm-115 D-Ser Оха4-холестерин 55% при 0,3 нМ 100% при 3 нМ 36 (±12)
Oxm-216 Aib Oxa4-Chol 0%@ 10 nM 88% @ 100 пМ 10(±3)

Фармакодинамический анализ отобранных аналогов. Авторы изобретения оценивали эффективность различных липидизированных пептидов на снижение массы тела, поглощение пищи (мыши DIO) и улучшение гликемического контроля (тощие мыши) как после экстренного, так и хронического введения. Как показано на фигурах с 6 по 9, после однократной подкожной дозы липидизированные молекулы существенно снижают поглощение пищи и массу тела, как с резкой, так и с продолжительной эффективностью. Как предсказывали из анализов in vitro, аналоги, содержащие или ацильные группы, или гидрофильный линкер, были, по существу, более эффективны в снижении поглощения пищи и массы тела в этой модели, чем другие сайт-специфичные липидизированные аналоги ОХМ.

Фигура 6 суммирует резкую эффективность in vivo OXM70 на снижение поглощения пищи и массы тела у устойчивых мышей DIO. Фигура 7 суммирует резкую эффективность in vivo OXM110 и ОХМ177 на снижение поглощения пищи и массы тела у устойчивых мышей DIO. Фигура 8 суммирует резкую эффективность in vivo OXM216, ОХМ115 и ОХМ177 на снижение поглощения пищи и массы тела у устойчивых мышей DIO. Во всех трех экспериментах Ad libitum (вволю) упитанных самцов мышей DIO C57BL/6 (приблизительно 51 г каждый) взвешивали и вводили определенную дозу внутрибрюшинно или носитель (воду), или аналог ОХМ OXM70, OXM110, ОХМ177, OXM216 или ОХМ115 приблизительно за 30 минут до начала темновой фазы. Поглощение пищи измеряли приблизительно через 2 часа и через 18 часов. Также измеряли изменения массы после 18 часов (в течение всей ночи) (*Р<0,05 против носителя, n=5-6 на группу).

Постоянные эффекты на поглощение пищи и массу тела

Для определения постоянных эффектов аналогов на энергетический обмен и метаболизм глюкозы выполняли изучение на устойчивой мышиной модели с вызванным режимом питания ожирением (DIO). Ad libitum (вволю) упитанным самцам мышей дикого типа C57BL/6N (n=6 на группу, средняя масса тела ~50 г) вводили определенную дозу носителя, ОХМ115, ОХМ177, ОХМ110 из расчета 3 или 10 мг/кг через день (Q2D) (по четным дням) в течение курса 14 последующих дней исследования. Массу тела, поглощение пищи и уровни базальной глюкозы измеряли ежедневно. Как показано на фигурах 9А и 9В, продолжительная обработка липидизированными аналогами существенно снижала массу тела и поглощение пищи в зависимости от дозы на всем протяжении изучения. Фигура 9С показывает базальную глюкозу на протяжении периода времени исследования в ответ на различные пептиды.

Все проанализированные липидизированные пептиды существенно снижали базальную глюкозу в зависимости от дозы на всем протяжении изучения по сравнению с днем 0 продолжительного изучения и с животными, обработанными носителем в тот же самый день (р<0,05). IPGTT, выполненный на 13 день, показал, что толерантность к глюкозе была улучшена после постоянного введения липидизированных аналогов в зависимости от дозы (фиг.9D).

Улучшенная толерантность к глюкозе

Как показано на фигурах 10-13, у тощих мышей IPGTT C57BL/6N подкожное введение пептидных аналогов ОХМ перед провокацией декстрозой, синхронизированное соответствующим образом с Стах в плазме, существенно снижало амплитуду колебаний уровня глюкозы в крови в зависимости от дозы для всех проанализированных липидизированных аналогов.

Эффекты интенсивности метаболизма

Для установления обеспечивает ли введение аналога ОХМ115, содержащего холестерин, связанный через тетра-этокси связь, интенсивность обмена веществ, проводили длительное изучение с разовой инъекцией ОХМ115. Мужские особи В6 мышей DIO (средняя начальная масса тела 55 г) акклиматизировали к камерам для (изучения) скорости метаболизма без еды при нейтральной температуре (Т 29°С). Трехчасовой период от 6:00 до 9:00 утра использовали для расчета интенсивности обмена веществ в стадии покоя. На 3-й час световой фазы (9:00 утра) вводили подкожно носитель (dH20), ОХМ115 из расчета 3 или 10 мг/кг. Общее время цикла устанавливали в течение 20 минут, состоящее из референсного снятия показании с 70-секундным временем установления и 10-секундным периодом измерения, а также 60-секундным временем установления и 10-секундным периодом измерения для каждой из 16 клеток. Результаты, показанные на фигурах 14А и В показывают, что введение ОХМ115 дозозависимо повышало острый уровень метаболизма у мышей DIO.

Фигура 15 суммирует резкую эффективность in vivo ОХМ303, ОХМ304 и ОХМ305 на снижение поглощения пищи и массы тела у устойчивых мышей DIO и причем показывает, что ОХМ305 является, в частности, эффективным в снижении поглощения пищи и снижении массы тела. Ad libitum (вволю) упитанных мужских особей C57BL/6 мышей DIO (приблизительно 50 г каждая) взвешивали и вводили (им) подкожно определенную дозу или носителя (воду), или аналоги ОХМ за 30 минут до начала темновой фазы. Поглощение пищи измеряли через два, 18 и 42 часа. Также измеряли изменения массы тела в 18 и 42 часа (в течение ночи) (*Р<0,05 против носителя, n=5-6 на группу).

Фигура 16 суммирует резкую эффективность in vivo OXM395, ОХМ399, ОХМ400 и ОХМ401 на снижение поглощения пищи и массы тела у устойчивых мышей DIO. OXM401 означает 0/+контрольный пептид, имеющий последовательность

HAibEGTFTSDYSKYLDSRRAQDFVQWLmNTK-γEγE-C(Oxa12Chol) (SEQ ID NO:99).

Устойчивым мышам DIO (~52 г каждая) вводили подкожно определенную дозу носителя (30% НВС) или пептида 1 мг/кг приблизительно за 30 минут до начала темновой фазы. Изменения поглощения пищи и массы тела измеряли в течение четырехдневного периода времени (*Р<0,05 против носителя, n=5 на группу).

ПРИМЕР 11

Этот пример показывает, что липидизированные пептиды с pI выше 7 на основе последовательности ОХМ стимулируют дегрануляцию тучных клеток, тогда как липидизированные пептиды с pI приблизительно 5, по-видимому, не стимулируют дегрануляцию тучных клеток.

Для оценки гистамин-освобождающего фактора (гистамин-рилизинг фактора) оксинтомодулина авторы данного изобретения внедрили анализ селективности и специфичности (соединений) in vitro с использованием клеточной линии тучных клеток человека LAD2. Клетки LAD2 (50000 клеток/лунку, 96-луночный планшет) инкубировали с соединениями в течение 30 минут. Дегрануляцию клеток LAD2 определяли количественным определением (3-гексозаминидазы, высвобожденной в супернатанты и в клеточные лизаты после гидролиза 4-метилумбеллиферил-N-ацетил-β-D-глюкозаминида. Результаты выражают в виде процента высвобождения β- гексозаминидазы, вычисленного в виде процента от общего содержания. Таблица 1 суммирует активность аналогов ОХМ на активность дегрануляции (ЕС50) в клетках LAD2. Результаты дают основание предполагать, что для снижения возможности стимуляции дегрануляции тучных клеток (значение) pI (значение изоэлектрической точки) липидизированных аналогов должно быть приблизительно 5.

Таблица 9
Активность природного ОХМ и аналогов ОХМ на дегрануляцию
Пептид ЕС50 (мкМ)
ОХМ >10
ОХМ115 0,01-0,04
ОХМ238 1,5
ОХМ303 0,1
ОХМ305 0,1
ОХМ392 0,3
ОХМ399 0,3
ОХМ400 >10
ОХМ401 >10
ОХМ404 >10
ОХМ408 >10
ОХМ409 >10
ОХМ410 >10
ОХМ411 >10

ПРИМЕР 12

Этот пример представляет таблицы, показывающие активности in vitro различных пептидных аналогов в отношении рецептора GLP-1 человека (hGLP-1R) и рецептора к глюкагону человека (DGCGR). Активности in vitro, показанные в таблице 10 или таблице 11, определяли из результатов анализов, которые были сходными или с клеточными анализами цАМФ, описанными здесь выше (таблица 10), или с клеточными анализами цАМФ, описанными в Международной опубликованной заявке WO №2008101017, которая включена в изобретение полностью, в частности, с клеточными анализами цАМФ, описанными здесь (Таблица 11).

Таблица 10
Активности in vitro отобранных пептидных аналогов
Пептид Pi hGLP-1R ЕС50 (нМ) hGLP-1R+20% Плазма ЕС50 (нМ) hGCGR ЕС50 (нМ) hGCGR+20% плазма ЕС50 (нМ)
ОХМ345 5,4 5,1 >1000 0,1 >1000
ОХМ380 5,4 0,3 30,7 0,1 3,4
ОХМ381 5,2 0,002; 0,02 1,9:1,9 0,0002; 0,006 0,8; 0,9
ОХМ389 - 0,03 - 0,02 -
ОХМ392 5,4 0,03 3,0 0,03 0,3
ОХМ395 5,4 0,7 3,3 10 119
ОХМ399 5,4 0,05 5,7 0,01 0,4
ОХМ400 5,4 0,07 1,9 0,01 0,8
ОХМ401 5,4 0,23 2,9 0,09 0,3
ОХМ409 5,5 - 0,7 - 0,1
ОХМ411 5,4 - 0,1 - 0,2
ОХМ414 5,4 - 0,07 - 0,15
ОХМ416 5,5 - 0,09 - 1,40
ОХМ417 5,5 - 0,15 - 0,40
ОХМ418 5,5 - 0,30 - 0,30
Таблица 11
Активности in vitro отобранных пептидных аналогов
Пептид hGLP-1R ЕС50 (нМ) hGCGR ЕС50 (нМ)
ММ111 0,007 0,005
ММ102 0,034 0,003
ММ103 0,026 0,005
ММ113 0,023 0,006
ОХМ414 0,007 0,005
ММ114 0,036 0,019
ММ115 1,083 1,313
ММ116 0,132 0,85
ММ117 0,93 0,25
ММ121 0,131 0,006
ММ127 0,004 0,004
ММ132 0,024 0,004
ОХМ418 0,026 0,002

Наряду с данным изобретением, описанным здесь со ссылкой на проиллюстрированные варианты осуществления изобретения, должно быть понятно, что изобретение не ограничивается этим. Специалисты с обычной квалификацией в данной области и с доступом к идеям данного изобретения узнают дополнительные модификации и варианты осуществления в объеме данного изобретения. Таким образом, данное изобретение ограничено только формулой изобретения, прикрепленной к нему.

1. Пептидный аналог, содержащий структуру
Z1-P-M-Z2,
где Р представляет собой пептид, имеющий аминокислотную последовательность
HX1QGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTKX9X10 (SEQ ID NO:110),
где X1 представляет собой D-серин, α-аминоизомасляную кислоту (aib), остаток 1-амино-1-циклобутанкарбоновой кислоты (Acb), 1-амино-1-циклогексан-карбоновую кислоту (Асх); альфа-аминомасляную кислоту (Abu); D-альфа-аминомасляную кислоту (D-Abu); аминовалериановую кислоту (Nva); бета-циклопропилаланин (Сра); пропаргилглицин (Prg); аллилглицин (Alg); 2-амино-2-циклогексилпропионовую кислоту (2-Cha); D-терт-бутилглицин (D-tbg); винилглицин (Vg); 1-амино-1-циклопропанкарбоновую кислоту (Аср); или остаток 1-амино-1-циклопентан-карбоновой кислоты (Асре);
Х2 представляет собой остаток тирозина (Y) или лизина (К);
Х3 представляет собой остаток серина (S) или лизина (К);
Х4 представляет собой остаток серина (S), α-аминоизомасляной кислоты (aib), или глутаминовой кислоты (Е);
Х5 представляет собой остаток аргинина (R) или глутаминовой кислоты (Е);
X6 представляет собой остаток аргинина (R) или аланина (А);
Х7 представляет собой остаток глутамина (Q) или лизина (К);
X8 представляет собой остаток метионина (М), норлейцина (Nle), метионинсульфоксида (m) или О-метил-L-гомосерина (о);
Х9 представляет собой остаток гамма-глутаминовой кислоты (γGlu);
Х10 представляет собой остаток гамма-глутаминовой кислоты (γGlu) или отсутствует;
Z1 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, представляет собой -С1-10алкил, -C1-10 замещенный алкил, -С2-10алкенил, -C2-10 замещенный алкенил, арил, -С1-6алкиларил, -С(O)-(СН2)1-6-COOH, -C(O)-C1-6алкил, -С(O)-арил, -C(O)-O-C1-6алкил или -С(O)-O-арил, присоединенный к N-группе N-концевой аминогруппы,
М представляет собой (i) цистеиновый остаток, ковалентно связанный с молекулой холестерина гидрофильным линкером, (ii) остаток лизина, ковалентно связанный с липидной молекулой спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты, или (iii) липидную молекулу, причем М ковалентно связан с С-концевой или расположенной внутри аминокислотой Р (пептида) спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты; при этом гидрофильный линкер представляет собой этоксиполимер, содержащий от одного до двадцати четырех этокси-звеньев и липидный остаток представляет собой жирную кислоту;
Z2 представляет собой необязательно присутствующую защитную группу, которая, если присутствует, представляет собой C1-6 эфир или амид формулы NRR2, где R и R2 каждый независимо представляет собой Н или C1-6алкил, или R и R2 образуют гетероциклическое кольцо, на месте С-концевой карбоксильной группы; и его фармацевтически приемлемые соли,
причем пептидный аналог или его соль имеет pI менее 6,0 и представляет собой двойной агонист рецептора GLP-1 и агонист глюкагонового рецептора.

2. Пептидный аналог по п. 1, где липидный остаток является остатком жирной кислоты, такой как пальмитоил, миристоил или стеароил.

3. Пептидный аналог по п. 1, где М представляет собой (I) цистеиновый остаток, ковалентно связанный с остатком холестерина гидрофильным линкером и цистеиновый остаток связан с С-концом Р; (II) остаток лизина, ковалентно связанный с липидным остатком спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты, и остаток лизина связан с С-концом Р; или (III) остаток лизина, ковалентно связанный с липидным остатком спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты, и остаток лизина находится в положении Х2 или Х7 Р.

4. Пептидный аналог по п. 1, где гидрофильный линкер представляет собой этоксиполимер, который включает в себя от одного до двадцати четырех этокси-звеньев, или этоксиполимер, который включает в себя четыре этокси-звена.

5. Пептидный аналог по п. 1, где липидный остаток представляет собой пальмитоильную группу.

6. Пептидный аналог по п. 1, в котором пептидный аналог выбран из ОХМ317 (SEQ ID NO:60); ОХМ318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62) или OXM329 (SEQ ID NO:67) или выбран из ОХМ345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM407 (SEQ ID NO:88); OXM408 (SEQ ID NO:89); OXM412 (SEQ ID NO:93); OXM414 (SEQ ID NO:95); OXM415 (SEQ ID NO:96); OXM418 (SEQ ID NO:99; OXM419 (SEQ ID NO:100; OXM420 (SEQ ID NO:101) или OXM421 (SEQ ID NO:102).

7. Пептидный аналог, содержащий аминокислотную последовательность
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO:109), в которой
(A) вторую аминокислоту с N-конца пептида замещают аминокислотой, которая придает пептиду устойчивость к расщеплению и инактивации дипептидилпептидазой IV;
(B) пептид включает в себя остаток липида или остаток холестерина, ковалентно связанный с пептидом спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты;
(C) пептид необязательно включает в себя от одной до трех аминокислотных замен в дополнение к замене в положении 2; и
(D) пептид необязательно включает в себя защитную группу, которая, если присутствует, представляет собой C1-6 эфир или амид формулы NRR2, где R и R2 каждый независимо представляет собой Н или C1-6алкил, или R и R2 образуют гетероциклическое кольцо, на месте С-концевой карбоксильной группы;
причем пептидный аналог имеет (значение) pI менее 6,0 и является двойным агонистом рецептора GLP-1 и агонистом глюкагонового рецептора и его фармацевтически приемлемых солей.

8. Пептидный аналог по п. 6, где (I) аминокислота для замены второй аминокислоты с N-конца выбрана из группы, состоящей из D-серина, α-аминоизомасляной кислоты и 1-амино-1-циклобутанкарбоновой кислоты; (II) пептидный аналог включает в себя остаток холестерина, ковалентно связанный с тиольной группой цистеинового остатка, который ковалентно связан с ε-аминогруппой остатка лизина на С-конце пептидного аналога спейсером, содержащим один или несколько остатков гамма-глутаминовой кислоты; (III), где пептидный аналог включает в себя липидную молекулу, ковалентно связанную с ε-аминогруппой остатка лизина; или (IV) пептидный аналог дополнительно включает в себя одну или несколько аминокислотных замен, выбранных из группы, состоящей из лизина для тирозина в положении 10, серина для лизина в положении 12, глутаминовой кислоты или α-аминоизомасляной кислоты для серина в положении 16, глутаминовой кислоты для аргинина в положении 17, аланина для аргинина в положении 18, лизина для глутамина в положении 20 и норлейцина или O-метил-L-гомосерина для метионина в положении 27.

9. Пептидный аналог по п. 8, где остаток холестерина во (II) ковалентно связан с тиольной группой гидрофильным линкером.

10. Пептидный аналог по 8, где (I) гидрофильный линкер представляет собой этокси-полимер, который включает в себя от одного до двенадцати этокси-звеньев или (II) гидрофильный линкер представляет собой этокси-полимер, который включает в себя четыре этокси-звена.

11. Пептидный аналог по п. 8, где в (III) липидный остаток представляет собой пальмитоильную группу.

12. Пептидный аналог по п 8, где липидный остаток в (III) (I) ковалентно связан с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты; (II) липидный остаток ковалентно связан с ε-аминогруппой остатка лизина на С-конце одним или несколькими остатками гамма-глутаминовой кислоты; (III) липидный остаток ковалентно связан с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты и остаток лизина связан с остатком лизина на С-конце одним или несколькими остатками гамма-глутаминовой кислоты.

13. Пептидный аналог по п. 8, где в (IV) тирозин в положении 10 заменен лизином и липидный остаток ковалентно связан с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты, необязательно, где пептидный аналог дополнительно включает в себя один или несколько остатков гамма-глутаминовой кислоты, ковалентно связанных с С-концом.

14. Пептидный аналог по п. 8, где в (IV) глутамин в положении 20 заменен лизином и липидный остаток ковалентно связан с ε-аминогруппой остатка лизина одним или несколькими остатками гамма-глутаминовой кислоты.

15. Пептидный аналог по п. 13, где пептидный аналог дополнительно включает в себя один или несколько остатков гамма-глутаминовой кислоты, ковалентно связанных с С-концом.

16. Применение одного или нескольких пептидных аналогов по пп. 1-14 в изготовлении лекарственного средства для лечения метаболических заболеваний.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к пептиду GLP-1 с присоединенной олигосахаридной цепью, и может быть использовано в медицине. Указанный пептид GLP-1, обладающий активностью GLP-1, имеет (а1) одну аминокислоту, дополнительно присоединенную к С-концу (позиция 37), в котором указанная присоединенная аминокислота заменена аминокислотой с присоединенной олигосахаридной цепью; или (а2) одну или две аминокислоты, замененные аминокислотой с присоединенной олигосахаридной цепью, где сайт замены выбирают из позиций 18, 20, 22, 30 и 36, а также может дополнительно включать от 1 до 5 делеций, замен или вставок аминокислот, где указанная олигосахаридная цепь содержит пять или более сахаров и представлена Формулой 1.

Настоящее изобретение относится к аналогам глюкагоноподобного пепдтида-1 (ГПП-1), представленным следующей формулой I, где X представляет собой глицин или глицинамид.

Настоящее изобретение предоставляет способ регулирования условий для сайт-специфического связывания полипептида и непептидильного полимера посредством регулирования рН и содержания спирта реакционной среды.

Изобретение относится к новым пептидным аналогам оксинтомодулина, их фармацевтическим композициям и их применению для лечения и/или профилактики избыточной массы тела, а также нарушений и заболеваний, сопутствующих ожирению.

Изобретение относится к области биотехнологии, конкретно к получению аналогов глюкагона, и может быть использовано в медицине. .

Изобретение относится к способу очистки циклического или нециклического пептида, выбранного из группы пептидов, включающей эптифибатид, эксенатид, атозибан и незиритид или их комбинацию, из смеси, содержащей по меньшей мере одну примесь, включающему контактирование указанной смеси с матрицей для ОФ-ВЭЖХ и матрицей для ионообменной хроматографии и получение очищенного пептидного продукта с чистотой по меньшей мере 96% и, предпочтительно, составляет, по меньшей мере, около 99%.

Изобретение относится к области медицины и химической технологии. .

Изобретение относится к получению инсулинотропных пептидов, которые синтезируют с использованием подхода, основанного на применении твердофазного и жидкофазного («гибридного») синтеза.

Изобретение относится к новым соединения GLP-1 пролонгированного действия и их терапевтическому применению. .

Изобретение относится к соединениям формулы (I): где А представляет собой CRaRb или -CH2-CH2-; R1 представляет собой водород или алкил; R2 представляет собой водород или алкил; R3 представляет собой алкил, циклоалкил, циклоалкилалкил, арил, замещенный арил, 1H-пиразолил или замещенный 1Н-пиразолил, где замещенный арил представляет собой арил, замещенный 1-3 заместителями, независимо выбранными из алкила, галогена и галогеналкила, и где замещенный 1Н-пиразолил представляет собой 1Н-пиразолил, замещенный 1-3 заместителями, независимо выбранными из алкила и арила; Ra представляет собой водород или метил; Rb представляет собой водород или метил; или Ra и Rb вместе с атомом углерода, к которому они присоединены, образуют циклопропил, циклобутил или циклопентил; при условии, что когда Ra и Rb оба представляют собой водород или оба представляют собой метил одновременно, тогда R3 представляет собой (1-метилциклопропил)метил, которые обладают ингибирующим действием в отношении 11b-HSD1.

Изобретение относится к способу лечения состояния или заболевания, при котором введение инсулина принесет пользу, включающему введение пациенту, нуждающемуся в этом, эффективных доз производного инсулина, представляющего собой инсулин NεB29-(Nα-(HOOC(CH2)14CO)-y-L-GIu) дез(В30), где указанное производное инсулина имеет пролонгированный профиль действия, и указанные дозы вводятся с интервалом от 24 часов до 336 часов.

Группа изобретений относится к области фармацевтики, а именно к водной фармацевтической композиции, содержащей инсулин, аналог инсулина или производное инсулина и метионин; а также к способу ее получения, применению для лечения сахарного диабета и к лекарственному средству для лечения сахарного диабета.

Изобретение относится к соединению формулы (I) или его фармацевтически приемлемой соли, где G представляет собой группу формулы (II) или (III), R1 представляет собой изопропил или трет-бутил; R2 представляет собой нафтил, хинолинил или изохинолинил, R2 возможно замещен независимо одной-двумя группами метил, метокси или хлоро; R3 представляет собой водород.

Изобретение относится к области биотехнологии, конкретно к пептиду GLP-1 с присоединенной олигосахаридной цепью, и может быть использовано в медицине. Указанный пептид GLP-1, обладающий активностью GLP-1, имеет (а1) одну аминокислоту, дополнительно присоединенную к С-концу (позиция 37), в котором указанная присоединенная аминокислота заменена аминокислотой с присоединенной олигосахаридной цепью; или (а2) одну или две аминокислоты, замененные аминокислотой с присоединенной олигосахаридной цепью, где сайт замены выбирают из позиций 18, 20, 22, 30 и 36, а также может дополнительно включать от 1 до 5 делеций, замен или вставок аминокислот, где указанная олигосахаридная цепь содержит пять или более сахаров и представлена Формулой 1.

Изобретение относится к новым безводным кристаллическим формам саксаглиптина гидрохлорида формулы, приведенной ниже. Описаны способы получения кристаллических форм саксаглиптина гидрохлорида.

Изобретение относится к соединениям формулы (I) где R1 представляет собой гидроксиадамантил, метоксикарбониладамантил, карбоксиадамантил, аминокарбониладамантил или аминокарбонилбицикло[2.2.2]октанил и где A представляет собой CR5R6; или фенил, хлорбензил, бензил, хлорфенилэтил, фенилэтил, дифторбензил, дихлорфенил, трифторметилфенил или дифторфенилэтил и где A представляет собой CR5R6; R2 и R3 вместе с атомом азота N* и атомом углерода С*, к которому они присоединены, образуют группу или ; R4 представляет собой водород, алкил, циклоалкил, циклоалкилалкил, алкоксиалкил, арилалкил, арилалкоксигруппу, арилалкоксиалкил, гидроксиалкил, арил, гетероарилалкил, гетероарилоксиалкил, замещенный арил, замещенный гетероарилалкил или замещенный гетероарилоксиалкил, где замещенный арил, замещенный гетероарилалкил и замещенный гетероарилоксиалкил замещены 1-3 заместителями, независимо выбранными из алкила, циклоалкила, цианогруппы, галогена, галогеналкила, гидроксигруппы и алкоксигруппы; R5 представляет собой водород; R6 представляет собой водород;, а также их фармацевтически приемлемым солям и сложным эфирам, которые могут быть использованы в качестве ингибиторов 11b-HSD1.

Изобретение относится к области органической химии, а именно к гетероциклическому соединению формулы (I) или к его фармацевтически приемлемой соли, где Alk представляет собой линейную C1-6 алкиленовую группу, разветвленную C1-6 алкиленовую группу или C1-6 алкиленовую группу, имеющую кольцевую структуру, где часть атомов углерода, составляющих кольцевую структуру, необязательно может быть замещена атомом кислорода, в кольце X, X1 представляет собой N или CRX1, X2 представляет собой N или CRX2, X3 представляет собой CRX3, X4 представляет собой N или CRX4, где RX1, RX2, RX3 и RX4 каждый независимо представляет собой атом водорода; линейную или разветвленную C1-6 алкильную группу; линейную или разветвленную C1-6 алкоксигруппу; или атом галогена, в кольце Y, Y1 представляет собой CRY1, Y2 представляет собой N или CRY2, Y3 представляет собой N или CRY3, Y4 представляет собой N или CRY4, RY1, RY2, RY3 и RY4 каждый независимо представляет собой атом водорода; линейную или разветвленную C1-6 алкильную группу, которая может быть замещена атомом (атомами) галогена; C3-7 алкильную группу, имеющую кольцевую структуру; линейную или разветвленную C1-6 алкоксигруппу; атом галогена или цианогруппу, в кольце Z, RZ представляет собой линейную или разветвленную C1-6 алкильную группу, которая может быть замещена атомом (атомами) галогена, или C3-7 алкильную группу, имеющую кольцевую структуру, которая может быть замещена атомом (атомами) галогена.
Изобретение относится к медицине, а именно к эндокринологии и хирургии, и касается лечения заболеваний, осложненных гипотонией и атонией органа при сахарном диабете.
Изобретение относится к медицине, а именно к эндокринологии, и касается лечения сахарного диабета, осложненного сопутствующими заболеваниями, в частности, паразитарными инвазиями.

Изобретение относится к пищевой промышленности, а именно к применению источника белков в составе питательной композиции. Количество белка составляет от 2,4 г до 2,8 г на 100 ккал потребляемой композиции.

Изобретение относится к пептидным аналогам оксинтомодулина, которые были модифицированы для придания устойчивости к расщеплению и инактивации дипептидилпептидазой IV и для увеличения времени полужизни in vivo пептидного аналога наряду с предоставлением возможности пептидному аналогу действовать в виде двойного агониста GLP-1глюкагонового рецептора. Пептидные аналоги применимы для лечения метаболических нарушений, таких как диабет и ожирение. 3 н. и 13 з.п. ф-лы, 16 ил., 11 табл., 12 пр.

Наверх