Лекарственная форма специфического иммунобиологического лекарственного средства для лечения и профилактики вич инфекции и способ ее получения

Группа изобретений раскрывает лекарственную форму препарата для индукции специфического имунного ответа против поверхностного гликопротеина вируса ВИЧ gp120, содержащую в качестве активного вещества смесь искусственного рекомбинантного полипептида, получаемого в микроорганизме E. coli и имеющего следующую аминокислотную последовательность: MATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKLDPNSSSVDKLAAALEHHHHHH, заключенного вместе с плазмидной ДНК, в липосомы, состоящие из смеси маннозиалированого дипальмитоилфосфатидилэтаноламина, 1,2-дипальмитоил-sn-глицеро-3-фосфатидилхолина, содержащую лактозу в качестве криопротектора и альфа-токоферол в качестве антиокислителя, а также способ ее приготовления. Препарат согласно группе изобретения эффективен в индукции специфического имунного ответа против поверхностного гликопротеина вируса ВИЧ gp120, а также обладает повышенной стабильностью при хранении и после его восстановления в полярном растворителе. 2 н.п. ф-лы, 2 табл., 2 пр.

 

Изобретение относится к медицине и, в частности, к препаратам, препятствующим развитию инфекции, вызванной вирусом иммунодефицита человека.

Одним из главных направлений борьбы с распространением вирусных инфекций является их профилактика и лечение с помощью специфических иммунобиологических препаратов (вакцин), при введении которых в организм формируется иммунный ответ, препятствующий инфицированию и/или дальнейшему распространению вируса. Как правило, действующим (активным) веществом таких препаратов служит специфический белок инактивированного или ослабленного вируса или его синтетическая копия, полученная с помощью рекомбинантных технологий. В отношении таких опасных заболеваний, как оспа или корь подобная проблема в принципе решена. Однако индукция адекватного иммунного ответа против вируса иммунодефицита человека (ВИЧ) не решена до настоящего времени, что связано с высокой изменчивостью белков, против которых вырабатывается иммунный ответ, а также слабой иммуногенностью белков вируса, что приводит к уклонению вирусных частиц и пораженных ими клеток от иммунной атаки. Кроме того, поскольку ВИЧ поражает клетки иммунной системы, специфический вирусный иммунитет является недостаочным для элиминации или сдерживания виремии (Walker B.D. et al. Science. 2008, 320(5877): 760-4).

Основным недостатком существующих вакцин против вируса иммунодефицита человека является то, что антиген, как правило, представлен одним из вариантов гипервариабельных белков вируса, и антитела, вырабатываемые на этот вариант антигена, не реагируют с изменившимся вариантом белка оболочки вируса следующей генерации. Одним из сравнительно новых подходов к созданию вакцины против ВИЧ является использование в качестве антигена искусственных рекомбинантных химерных пептидов, содержащих в своем составе «консервативные» последовательности гликопротеинов оболочки ВИЧ, т.е. участки белка, которые не меняются от гененрации к генерации вируса. Так, было предложено в качестве антигена использовать химерные (искусственные) полипептиды, часть последовательности которых гомологична высококонсервативным участкам гликопротеина gp120 оболочки ВИЧ. Недостатком предложенного антигена является недостаточная способность вызывать высокий уровень антител против gp120.

Однако, как неожиданно было обнаружено авторами настоящего изобретения, способность этого искусственного полипептида индуцировать антительный ответ против гликопротеина (а именно gp120) ВИЧ опосредуется через непосредственный контакт с антигенпредставляющими клетками, и такое взаимодействие приводит к возникновению иммунологической толерантности, при этом продукция антител против ВИЧ может быть недостаточной.

Соответственно, для усиления лечебного эффекта этих олигопептидов авторы настоящего изобретения предлагают адъювантизацию вышеуказанного полипептида с использованием интеграции его в липосомы определенного состава с добавлением других вспомогательных веществ.

Как известно, для снижения эффекта индукции толерантности к тем или иным антигенам применяются так называемые «адъюванты» - различные неорганические и органические вещества, вводимые совместно или в одной лекарственной форме с самим антигеном (см., например Adjuvants for Allergen Immunotherapy: Experimental Results and Clinical Perspectives James N Francis; Stephen R Durham, Curr Opin Allergy Clin Immunol. 2004; 4(6)). К таким адъювантам относятся, в частности, 3-о-дезацил-4′-монофосфорил липид А и алюминия гидроксид.

Известно, что в случае использования липосомальных вакцин иммунный ответ усиливается вследствие того, что антигены, ассоциированные с липосомами, попадают непосредственно в антигенпредставляющие клетки. [Gluck R. (1995) In Vaccine Design: The Submit and Adjuvant Approch (Powell M.F., Newman M.J., eds)., Plenum Press. P. 325-345].

В последние десятилетия для адъюванизации тех или иных вакцин используется метод включения самого антигена в состав липосом специально подобранного состава [Заявка США 20070082043].

Для усиления взаимодействия инкапсулированного антигена с антигенпрезентирующими клетками иммунной системы в состав липосом вводят моно- и полиманнозилированные липидные аналоги [Garcon, Ν; Gregoriadis, G; Taylor, Μ and Summerfield, J, Mannose-mediated targeted immunoadjuvant action of liposomes, Immunology. 1988 August; 64(4): 743-745], [Liposomes: Methods and Protocols, Volume 1: Pharmaceutical Nanocarriers, Series: Methods in Molecular Biology, Volume: 605, 2009 pp. 177-188), в частности, например, мономаннозил-диолеил глицерол конъюгат (ManDOG) или тетраманнозилированный конъюгат Man4DOG3K [Espuelas, S et al., Synthesis of an amphiphilic tetraantennary mannosyl conjugate and incorporation into liposome carriers, Bioorganic & Medicinal Chemistry Letters, Volume 13, Issue 15, 4 August 2003, Pages 2557-2560].

Однако такой подход требует тщательного подбора компонентов липосом и их размеров, при обеспечении достаточной нагрузки липосом антигеном (то есть процента включенного в липосомы белка или пептида) или, в случае ДНК - вакцин, ДНК, а также количества маннозилированного компонента в составе липосом.

Другим подходом к увеличению иммуногенности антигена является введение в состав препарата полипептида-антигена плазмидной ДНК, частично или полностью кодирующей полипептид - антиген [Европейский патент ЕР 1519745]. Собственно, такая плазмидная ДНК самостоятельно может является одним из вариантов активного вещества ДНК - вакцины против соответствующего инфекционного агента [Giri, Μ. et al, DNA Vaccines against Human Immunodeficiency Virus Type 1 in the Past Decade, Clin Microbiol Rev. 2004; 17(2): 370-389]. В случае одновременного присутствия в вакцине полипептида-антигена и плазмидной ДНК, кодирующей данный полипептид, активным веществом вакцины (иммуногенным началом), то есть веществом, обусловливающим специфичность вакцины в отношении индукции иммунного антительного ответа против определенного инфекционного агента, является по существу смесь этих компонентов (полипептида и ДНК).

Вообще, сама по себе «адъювантизация» не предполагает a priory повышения эффективности лечебного или профилактического действия и не является очевидной для этого в отношении того или иного антигена.

Кроме того, недостатком водных растворов (или растворов в физиологически совместимых буферах, таких как фосфатный буфер) препаратов на основе пептидов является их быстрая деградация при введении в организм вследствие воздействия пептидаз.

Как известно, большинство фармацевтических препаратов, содержащих липососомы, представляют собой высушенные лиофилизацией порошки, которые перед применением восстанавливают до суспензии липосом путем добавления водного солевого забуференного раствора, после чего полученную липосомальную суспензию вводят тем или иным путем в организм. Для повышения стабильности лиофильно высушенных порошков липосомальных препаратов, а также в качестве криопротектора при лиофилизации липосомальных препаратов в их состав вводятся стабилизаторы, такие как сахара, а для снижения степени окисления липидов вводятся антиоксиданты, например, альфа-токоферол. Однако введение лактозы или иных Сахаров в состав липосомальных препаратов может привести к уменьшению включения водорастворимых белков в липосомальную часть препарата, что закономерно снизит его лечебную эффективность.

Целью настоящего изобретения является создание инъекционной лекарственной формы на основе указанного химерного рекомбинантного полипептида и кодирующей его плазмидной ДНК с целью повышения эффективности его действия, а также увеличения стабильности препарата при хранении, а также стабильности препарата после его восстановления в полярном растворителе.

Поставленная задача решается тем, что в качестве лекарственной формы специфического иммунобиологического препарата предлагается лекарственная форма, в которой в качестве активного вещества выступает смесь белкового антигенного компонента - рекомбинантного негликозилированный химерного ENV-белка с делецией вариабельных доменов и сохранением иммунодоминантных консервативных доменов поверхностного гликопротеина gp120 ВИЧ со вторым компонентом, а именно генно-инженерной ДНК-конструкцией для экспрессии в клетках высших млекопитающих и человека, несущей ген этого химерного белка под контролем сильного эукариотического промотора pDNA. Химерный белок и ДНК-плазмида, его кодирующая, включены в заявленной лекарственной форме в состав малых однослойных катионных липосом, содержащих таргетный лиганд - маннозилированный фосфатидилэтаноламин (ManDOG). В процессе работы над настоящим изобретением авторами было неожиданно установлено, что при совместном применении (искусственный рекомбинантный полипептид плюс кодирующая этот протеин ДНК в составе таргетированного липосомального носителя) способность индуцировать антитела против гликопротеина gp120 ВИЧ потенцируется. То есть эффект при совместном применении искусственного рекомбинантного полипептида и плазмидной ДНК при инкапсуляции в липосомальный таргетированный носитель, выше суммы эффектов, производимых ими (полипептид и плазмидная ДНК) по отдельности. Возможно, этот эффект обусловлен тем, что такая композиция в наибольшей степени «имитирует» вирусную частицу (вирион), которая, как известно, помимо белка содержит ДНК и компоненты оболочки, что увеличивает выраженность иммунного ответа на чужеродный антиген.

Конкретно, настоящим в настоящем изобретении предложена в качестве средства для лечения и профилактики ВИЧ-инфекции инъекционная лекарственная форма, содержащая в качестве активного вещества смесь искусственного рекомбинантного полипептида, получаемого в микроорганизме E. coli и имеющего следующую аминокислотную последовательность:

и плазмидной ДНК, содержащей нуклеотидную последовательность, кодирующую этот искусственный рекомбинантный полипептид, и имеющей нуклеотидную последовательность,

отличающаяся тем, что указанный искусственный рекомбинантный полипептид и указанная плазмидная ДНК включены в однослойные липосомы размером от 100 до 250 нм, состоящие из 1,2-дипальмитоил-sn-глицеро-3-фосфатидилхолина и маннозиалированого дипальмитоилфосфатидилэтаноламина (ManDOG); лактозы; α-токоферола, при этом количества каждого из компонентов в лекарственной форме имеют следующие значения, мас.%:

Активный ингредиент:

Искусственный рекомбинантный полипептид 0,1±0,05
Плазмидная ДНК 0,2±0,05

Липосомальная оболочка:

2,3-Дипальмитоил-sn-глицеро-1-фосфатидилхолин 20,0±5,0
Липид ManDOG 0,2±0,01

Антиокислитель:

α-Токоферол 0,2±0,01

Криопротектор - стабилизатор:

Лактоза (80,0±5,0).

Общее количество компонентов лекарственной формы составляет 100 мас.%.

В настоящем изобретении, указанные активные и вспомогательные компоненты (криоконсерванты и антиокислители), в составе предложенного лекарственного средства, в указанном соотношении обеспечивают наилучшее включение рекомбинантного полипептида и ДНК в состав липосом, стабильность препарата при хранении, высокую способность индуцировать антитела против вирусного белка gp120 и, соответственно, высокую лечебную эффективность..

Далее согласно изобретению предложен способ приготовления инъекционной лекарственной формы специфического иммунобиологического препарата, содержащей в качестве активного вещества смесь искусственного рекомбинантного полипептида, получаемого в микроорганизме E. coli и имеющего следующую аминокислотную последовательность:

содержащего в своей последовательности «фрагмент gp Ι-ΙΙΙ», то есть последовательность

и плазмидной ДНК, содержащей нуклеотидную последовательность, кодирующую искусственный рекомбинантный полипептид формулы

, содержащего в своей последовательности «фрагмент gp Ι-ΙΙΙ», то есть последовательность

кодирующую этот полипетид, согласно которому механическую смесь указанного рекомбинантного полипептида (I) и указанной плазмидной ДНК (II) растворяют в воде, затем смешивают с водной суспензией однослойных липосом, размером 50-80 нм, предварительно полученных путем регидратации липидной пленки с последующей дезинтеграцией полученных многослойных липосом и добавлением лактозы, полученную смесь полипептида, ДНК и липосом стерильно фильтруют, разливают по флаконам, лиофильно высушивают, флаконы заполняют азотом, укупоривают резиновыми пробками и обкатывают колпачками.

Изобретение иллюстрируется следующими примерами.

Размер липосом в заявляемой инъекционной лекарственной форме определяли при помощи фотокорреляционного спектрометра Zetasizer Nano S. Для этого 100 мг порошка заявляемой лекарственной формы ресуспендировали в 1 мл воды для инъекций. Аликвоту 50 мкл вносили в кювету вместимостью 1 мл, содержащую 950 мкл воды, перемешивали, помещали в прибор и проводили измерения согласно инструкции производителя к прибору.

Фосфолипиды были закуплены в компании Sigma - Aldrich.

В частном случае реализации изобретения, для создания и производства плазмиды, содержащей нуклеодидную последовательность, кодирующую последовательность искусственного рекомбинантного белка возможно использование других векторов и выбор других материнских плазмид.

Также для синтеза рекомбинантного химерного полипептида возможно использование дрожжевой или эукариотичсекой системы экспрессии.

Пример 1. Приготовление заявляемой инъекционной лекарственной формы.

Приготовление плазмидной ДНК,

кодирующую рекомбинантный искусственный полипептид

Последовательность ДНК, соответствующая полипептиду («пептидный фрагмент gp Ι-ΙΙΙ»), была синтезирована методом ПЦР из двух перекрывающихся олигонуклеотидов. Полученный фрагмент ДНК был клонирован в плазмиду pET32b с использованием рестриктаз NotI и XhoI. Для идентификации рекомбинантных белков на всех стадиях экспрессии, выделения и очистки была создана конструкция pET32CHmbp, содержащая последовательность, кодирующую иммунодоминантный эпитоп человеческого белка p62c-myc. Фрагменты ДНК, кодирующей «пептидный фрагмент Ι-ΙΙΙ», были наработаны методом ПЦР с использованием синтетических олигонуклеотидов, с последующей сборкой фрагментов путем «splicing by overlap extensions». В качестве исходной матрицы была использована последовательность гена HXB2-env (клон предоставлен AIDS Research and Reference Reagent Program, Division of AIDS, NIH; HIV Sequence Database (2002), Los Alamos National Laboratory). Конечный продукт реакции - ДНК, кодирующая «пептидный фрагмент Ι-ΙΙΙ», был клонирован в плазмиду BlueScript с последующим переклонированием в плазмиды pET32b, pET32CHmbp с использованием рестриктаз NcoI и BamHI. Фрагменты NcoI-XhoI из этих конструкций были переклонированы в рЕТ28а по соответствующим сайтам рестрикции. Все процедуры проводили по стандартным методикам. Для создания конечной конструкции для экспрессии рекомбинантного полипептида - «пептидный фрагмент Ι-ΙΙI» - фрагмент ДНК, кодирующая «пептидный фрагмент I-III», из конструкции в векторе pET28b был переклонирован в вектор pcDNA3.1Hygro по сайтам XhoI-XbaI, полученная генетическая конструкция была подвергнута модификации, приводящей к введению гена устойчивости к антибиотику канамицину, позиции 5500-6509, с последующим удалением гена устойчивости к гигромицину, позиции 2877-3978. Получали плазмидную ДНК, содержащую нуклеотидную последовательность содержащего в своей последовательности «фрагмент gp Ι-ΙΙΙ», то есть последовательность

Наработку полученной плазмидной ДНК проводили следующим образом.

Сначала бактериальную колонию помещали в 5 мл среды 2×ΥΤ с добавлением селективного антибиотика, наращивали клетки при 37°С и интенсивной аэрации около 12-14 часов. Затем полученную культуру переносили в колбу, содержащую 500 мл среды 2×ΥΤ с добавлением селективного антибиотика, наращивали клетки при 37°С и интенсивной аэрации около 12-14 часов. Затем культуральную среду разносили в 10 колб, содержащих по 500 мл среды 2×ΥΤ, и наращивали клетки при 37°С и интенсивной аэрации около 12-14 часов. После центрифугирования и удаления надосадочной жидкости осадок собирали и замораживали.

Очистку проводили с использованием сорбента Plasmid select (GEHealthCare) согласно методике производителя.

Приготовление искусственного рекомбинантного полипептида

В процессе работы приготовление электрокомпетентных клеток, трансформация клеток в культуре, обработка рестриктазами, ПЦР и электрофорез ДНК проводился по стандартным методикам [Sambrook J., Fritsch E.F., Maniatis Т. // Molecular Cloning: A Laboratory Manual. New York, Cold Spring Harbor Laboratory Press, 1989.].

Для получения полипептида

Т7-лизогенизированные клетки E. coli (используют, например, штамм BL21(DE3)) трансформируют с помощью 0.1 мкг полученной плазмиды, кодирующей полипептид, методом электропорации и высеивают культуру на чашку Петри, содержащую 30 мкг/мл канамицина и глюкозу в концентрации 2%. Бактериальные колонии растят и течение 12-14 ч при 30°С, затем колонии полностью суспендируют в 1 л бактериальной среды 2×YT, содержащей 30 мг/мл канамицина и глюкозу в концентрации 0.1%. Культуру клеток растят при 30°С и хорошей аэрации до плотности 0.6-10D, но не более трех часов, добавляют индуктор изопропил-β-D-1-тиогалактопиранозид (ИПТГ) до 1 мМ и ведут индукцию экспрессии целевого полипептида в течение 3-х часов при 30°С.

Сбор и очистка полипептида: полученную после индукции культуру клеток центрифугируют при комнатной температуре 10 мин при 5000 об/мин, осадок суспендируют в 1/50 исходного объема в 50 мМ Tris-HCl, рН 8.0, добавляют лизоцим до концентрации 0.1 мг/мл, Triton-X100 до концентрации 0,1% и инкубируют 30 минут при температуре 30°С. Лизат охлаждают до 0°С, подвергают обработке ультразвуком до исчезновения вязкости и центрифугируют 40 мин при 20000 об/мин. Осадок тщательно суспендируют в 1/200 исходного объема в буфере, содержащем 50 мМ Tris-HCl, 1 мМ ЭДТА-Na, 1% Nonindent Р-40, рН 8.0, центрифугируют 40 минут при 20000 об/мин, ресуспендируют в хроматографическом буфере А (50 мМ NaH2PO4 - Na2HPO4, 300 мМ NaCl, 6М мочевины, рН 8,0) и центрифугируют при тех же условиях.

Осадок суспендируют в хроматографическом буфере А, инкубируют во льду 1 час и центрифугируют 10 минут на скорости 20000 об/мин.

Супернатант наносят на металлохелатную колонку, уравновешенную буфером А, при скорости 10 объемов колонки в час, колонку промывают буфером Б (50 мМ NaH2PO4 - Na2HPO4, 300 мМ NaCl, 6М мочевины, рН 7.0) при скорости потока 30 объемов колонки в час до прекращения дрейфа базовой линии.

Элюцию проводят буфером В (50 мМ NaH2PO4 - Na2HPO4, 20 мМ MES-NaOH, 300 мМ NaCl, 6 Μ мочевины, рН 5.0) при скорости 30 объемов колонки в час, после чего колонку повторно уравновешивают буфером А и удаляют иммобилизованные ионы металла и неэлюировавшие белки буфером А, содержащим 100 мМ ЭДТА рН 8.0.

Фракции элюата анализируют методом гель-электрофореза, объединяют, и преципитируют рекомбинантный полипептид диализом при комнатной температуре против деионизованной воды. Осадок рекомбинантного полипептида отделяют центрифугированием при 4000 об/мин в течение 10 мин, промывают 70% этиловым спиртом, суспендируют в минимальном объеме 70% этилового спирта, обрабатывают ультразвуком до прекращения седиментации частиц и хранят в форме суспензии при ±4°С в стерильных полипропиленовых пробирках.

Приготовление раствора липидов в хлороформе: В мерный стакан объемом 1,0 л с помощью мерного цилиндра наливают 400 мл хлороформа, добавляют 0,160 г липида ManDOG, 16,0 г 1,2-дипальмитоил-sn-глицеро-3-фосфохолина и 0,160 г α-токоферола. Перемешивают все до полного растворения твердой фазы в хлороформе.

Получение раствора липидов: Температуру бани ротационного испарителя устанавливают на 45°С, задают скорость вращения 100-120 об/мин и при вакууме 0,9-0,95 bar начинают упаривать раствор липидов в хлороформе, полученный на предыдущей стадии, подавая и распыляя полученный раствор через форсунку, расположенную в центре 10-литровой испарительной колбы. Раствор дозируют порциями, для соблюдения равномерности напыления липида на поверхность колбы. Конденсат хлороформа собирают в сборник конденсата. Колбу с липидной пленкой передают на следующую стадию.

Сушка липидной пленки: Сушку начинают после слива конденсата. Производят сушку при температуре 45°С и вакууме 0,9-0,95 bar, при скорости вращения испарительной колбы 100-120 об/мин в течение 2 часов. После этого продувают испарительную систем стерильным азотом в течение 1 часа.

Регидратация липидной пленки: Температуру бани ротационного испарителя устанавливают 45°С, задают скорость вращения 100-120 об/мин. Порциями загружают в колбу испарителя воду для инъекций общим объемом 400,0 мл. При этом первые три порции - по 20,0 мл в первые 15 минут - для набухания липидной пленки, а затем распыляют следующие 140,0 мл воды для инъекций и затем еще оставшиеся 100,0 мл.

По окончании добавления воды реакционную массу перемешивают в колбе ротационного испарителя в токе азота в течение 5 мин, затем передают ее на следующую стадию.

Дезинтеграция липосом: Дезинтеграцию липосом ведут в гомогенизаторе APV-2000 для получения гомогенных малоразмерных липосом под давлением. Устанавливают давление ударного воздействия 600-700 МПа ступенчато, при температуре 20°С.

Перед последней ступенью дезинтеграции к гомогенизату (суспензии липосом) добавляют 0,16 г альфа-токоферола. Количество ступеней определяется моментом достижения требуемого размера липосом (90-100 нм).

Формулирование суспензии с активными веществами: В мерный стакан объемом 100,0 мл добавляют 50,0 мл воды для инъекций и 55,0 г лактозы, перемешивают на магнитной мешалке 5 минут. По окончании перемешивания раствор лактозы смешивают с полученным гомогенизатом с предыдущей стадии и проводят дополнительную дезинтеграцию на гомогенизаторе APV-2000. В мерный стакан емкостью 100,0 мл загружают 50,0 мл воды для инъекций и действующие вещества: 0,071 г полученного рекомбинантного полипептида и 0,166 г полученной плазмидной ДНК; перемешивают на магнитной мешалке 5 минут. По окончании перемешивания полученный гомогенизат и раствор действующих веществ загружают в смесительный модуль и передают на следующую стадию.

Стерилизующее фильтрование: Стерильную емкость для стерилизующего фильтрования под давлением подсоединяют с помощью гибких шлангов к порту подачи стерильного азота и к стерилизующему фильтру с размером пор 0,22 мкм, находящемуся в зоне типа А. Обжимают места соединения со шлангами хомутами.

Для предварительного смачивания фильтра загружают в питающую емкость 2-3 л воды для инъекций. Путем подачи стерильного азота передавливают воду для инъекций через стерилизующий фильтр, собирая ее в стерильную приемную емкость.

Путем подачи стерильного азота в смесительный модуль с находящимся там смесью лиспосомальной суспензии и раствора действующих веществ, полученной на предыдущей стадии, передавливают содержимое смесительного модуля через стерилизующий фильтр, собирая его в стерильную приемную емкость. По окончании фильтрования стерильно переносят полученный фильтрат на магнитную мешалку и перемешивают до начала розлива по флаконам. Отбирают пробу для определения концентрации действующих веществ, полученные данные используются для уточнения объема дозирования во флаконы.

Стерильный розлив и лиофильная сушка: Стерильные флаконы для инъекций объемом 10 мл, в количестве 1000 шт. заносят в передаточный шлюз изолятора, снимают первичную упаковку, закрывают крышку шлюза и обрабатывают флаконы УФ-излучением в течение 15 минут. Тем временем из лиофильной сушилки Epsilon 2-10D, находящейся в изоляторе, достают поддоны и устанавливают на стол изолятора. По окончании обработки флаконов УФ-излучением открывают внутреннюю крышку шлюза, ведущую в изолятор, вскрывают первичную упаковку и устанавливают флаконы в поддоны лиофильной сушилки Epsilon 2-10D, использованную упаковку сбрасывают в контейнер для отходов, предусмотренный в изоляторе. Таким же образом заносятся стерильные крышки и колпачки флаконов в изолятор.

Стерилизованную смесь действующих веществ (рекомбинантного искусственного полипептида и плазмидной ДНК, его кодирующей) и суспензии липосом из приемной емкости при помощи диспенсера eLINE Pro дозируют во флаконы примерно по 2,5 мл с учетом концентрации смеси, таким образом, чтобы концентрация рекомбинантного белка в конечном лиофилизате составляла 0,31±0.03 мг в одном флаконе. По окончании дозирования смеси на каждый флакон легким нажатием устанавливается крышка, таким образом, чтобы оставалось отверстие для испарения жидкости. Неплотно укупоренные флаконы на поддонах устанавливают в лиофильную сушилку Epsilon 2-10D.

Осуществляют процесс лиофильного высушивания: задаются температура полок -(50±2)°С и время замораживания 3 часа. После этого конденсатор сушилки охлаждается до -(75±5)°С и включается вакуумный насос. Остаточное давление в сушилке задают 0,05-0,1 mbar (5-10 Па). Производится сушка препарата в течение 24 часов при указанных параметрах. По истечению указанного времени начинается постепенный нагрев полок и материала со скоростью (2-3)°С в час, задается остаточное давление 0,01 mbar. При достижении температуры (20-25)°С нагрев прекращается и выдерживается материал в этих условиях в течение 4 часов. Об окончании процесса высушивания свидетельствует постоянная температура материала, равная температуре полок, постоянный уровень вакуума (0,01 mbar. По окончании сушки отключается вакуумный насос, камера сушилки заполняется сухим стерильным азотом и в автоматическом режиме происходит заключительное укупоривание флаконов.

Получают 200 флаконов лиофилизированного продукта с составом на 1 флакон:

Действующие вещества:

Рекомбинантный искусственный полипептид

Также применялись различные варианты приготовления лекарственной формы (с вариациями содержания липидов), в том числе подбирали оптимальное количество лактозы, которое определяли по количеству включенного полипептидного компонента и ДНК-компонента после регидратации содержимого флаконов в забуференных солевых растворах.

Пример 2. Иммунизирующая эффективность предложенной инъекционной лекарственной формы.

Эксперименты проводили на самках мышей BALB/c. Мышей иммунизировали путем подкожного ведения либо лекарственной формы согласно настоящему изобретению в дозе 20 мкг (в пересчете на полипептид), либо суспензии искусственного рекомбинантного полипептида (20 мкг); либо раствора плазмидной ДНК (47 мкг), кодирующей полипептид. Контролем служили мыши, которым вводились «пустые» липосомы (плацебо) того же состава, но не содержащие ни пептида, ни плазмидной ДНК. Иммунизация проводилась трижды с интервалом в 14 дней. Все препараты, включая плацебо, вводили в одном и том же объеме 0,9% раствора натрия хлорида для инъекций. Образцы крови для анализа эффективности иммунизации (индукции антител против поверхностного гликопротеина вируса ВИЧ gp120) отбирались на 7 день после последнего введения препаратов из венозного синуса глаза с помощью микропипетки.

Из полученных образцов крови выделялась сыворотка. Для выявления уровня специфических антител класса G против gp120 сначала 96 луночные планшеты (NUNC MaxiSorp) были покрыты рекомбинантным gp120 (Progenies) (0,25 мкг на лунку в 50 мкл 2М раствора мочевины в буфере PBS, рН 7.2) в течение ночи при температуре 4°С. После этого в лунки был прилит блокирующий буфер по 300 мкл на лунку (1% раствор бычьего сывороточного альбумина в фосфатно-буферном растворе); по 50 мкл исследуемой мышиной сыворотки, разведенной от 100 до 100000 раз приливали в лунки и инкубировали в течение 1 часа, для того чтобы антитела сыворотки связались с антигеном (gp120). После этого в лунки добавляли по 50 мкл конъюгированных с пероксидазой хрена антител козы к IgG мыши (Sigma) в разведении 1:4000 и проводили инкубацию в течение 1 часа. Каждый из описанных шагов отделялся от последующего шага 5-кратной промывкой лунок промывочным буфером буфера (ФБР рН 7.2 с 0.1% Твин 20). Наконец, в каждую лунку добавляли 50 мкл свежеприготовленного субстрата ТМВ (3,3′,5,5′ тетраметилбензидин) и проводили инкубацию в течение 10 минут. Реакция останавливалась добавлением 50 мкл 2Ν раствора серной кислоты. Оптическая плотность измерялась в лунках автоматическим ридером при длине волны 450 нм (OD450). Титры антител определялись по точке изгиба на s-образной кривой в координатах "OD450/разведение".

Данные по титрам антител против gp120 различных группах представлены в таблице 2.

Как следует из таблицы 2, заявленная инъекционная лекарственная форма обладает гораздо большей (приблизительно в 100 раз) способностью индуцировать выработку антител против поверхностного гликопротеина вируса ВИЧ (gp120), чем активные компоненты (антигены - полипептид и кодирующая его ДНК) лекарственной формы, используемые по отдельности.

Приведенные выше примеры иллюстрируют один из возможных вариантов способа приготовления лекарственной формы согласно настоящему изобретению. Не предполагается, что приведенные здесь конкретные примеры ограничивают объем настоящего изобретения. Для специалиста могут быть очевидны модификации, которые можно внести в описанные процедуры, позволяющие достичь эквивалентных результатов с использованием доступных материалов и оборудования.

1. Лекарственная форма препарата для индукции специфического иммунного ответа против поверхностного гликопротеина вируса ВИЧ gp120, содержащая в качестве активного вещества смесь искусственного рекомбинантного полипептида, получаемого в микроорганизме E. coli и имеющего следующую аминокислотную последовательность:
MATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKLDPNSSSVDKLAAALEHHHHHH
(I), и плазмидной ДНК, имеющей нуклеотидную последовательность,
GTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTCGACGGATCGGGAGATCTCCCGATCCCCTATGGTCGACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATCTGCTCCCTGCTTGTGTGTTGGAGGTCGCTGAGTAGTGCGCGAGCAAAATTTAAGCTACAACAAGGCAAGGCTTGACCGACAATTGCATGAAGAATCTGCTTAGGGTTAGGCGTTTTGCGCTGCTTCGCGATGTACGGGCCAGATATACGCGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCTGGCTAACTAGAGAACCCACTGCTTACTGGCTTATCGAAATTAATACGACTCACTATAGGGAGACCCAAGCTGGCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACCATGGCTACAGAAAAATTGTGGGTCACAGTCTATTATGGGGTACCTGTGTGGAAGGAAGCAACCACCACTCTATTTTGTGCATCAGATGCTAAAGCATATGATACAGAGGTACATAATGTTTGGGCCACACATGCCTGTGTACCCACAGACCCCAACCCACAAGAAGTAGTATTGAGCTGCAACACCTCTGTCATTACACAGGCCTGTCCAAAGGTATCCTTTGAGCCAATTCCCATACATTATTGTGCCCCGGCTGGTTTTGCGATTCTAAAATGTAATAATAAGACGTTCAATGGAACAGGACCATGTACAAATGTCAGCACAGTACAATGTACACATGGAATTAGGCCAGTAGTATCAACTCAACTGCTGTTAAATGGCAGTCTAGCAGAAGAAGAGGTAGTAATTAGATCTGTCAATTTCACGGACAATGCTAAAACCATAATAGTACAGCTGAACACATCTGTAGAAATTAATTGTACACATTGTAACATTAGTAGAGCAAAATGGAATAACACTTTAAAACAGATAGCTAGCAAATTAAGAGAACAATTTGGAAATAATAAAACAATAATCTTTAAGCAATCCTCAGGAGGGGACCCAGAAATTGTAACGCACAGTTTTAATTGTGGAGGGGAATTTTTCTACTGTAATTCAACACAACTGTTTAATAGTACTTGGTTTAATAGTACTTGGAGTACTGAAGGGTCAAATAACACTGAAGGAAGTGACACAATCACCCTCCCATGCAGAATAAAACAAATTATAAACATGTGGCAGAAAGTAGGAAAAGCAATGTATGCCCCTCCCATCAGTGGACAAATTAGATGTTCATCAAATATTACAGGGCTGCTATTAACAAGAGATGGTGGTAATAGCAACAATGAGTCCGAGATCTTCAGACCTGGAGGAGGAGATATGAGGGACAATTGGAGAAGTGAATTATATAAATATAAAGTAGTAAAAATTGAACCATTAGGAGTAGCACCCACCAAGGCAAAGCTGGATCCGAATTCGAGCTCCGTCGACAAGCTTGCGGCCGCACTCGAGTCTAGAGGGCCCGTTTAAACCCGCTGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTTCTGAGGCGGAAAGAACCAGCTGGGGCTCTAGGGGGTATCCCCACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGCATCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTATAAGGGATTTTGGGGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAAAAATTTAACGCGAATTAATTCTGTGGAATGTGTGTCAGTTAGGGTGTGGAAAGTCCCCAGGCTCCCCAGGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCATCCCGCCCCTAACTCCGCCCAGTTCCGCCCATTCTCCGCCCCATGGCTGACTAATTTTTTTTATTTATGCAGAGGCCGAGGCCGCCTCTGCCTCTGAGCTATTCCAGAAGTAGTGAGGAGGCTTTTTTGGAGGCCTAGGCTTTTGCAAAAAGCTCCCGGGAGCTTGTATATCCATTTTCGGATCTGATCAGCACGTGATGAAAAAGCCTGAACTCACCGCGACGTCTGTCGAGAAGTTTCTGATCGAAAAGTTCGACAGCGTCTCCGACCTGATGCAGCTCTCGGAGGGCGAAGAATCTCGTGCTTTCAGCTTCGATGTAGGAGGGCGTGGATATGTCCTGCGGGTAAATAGCTGCGCCGATGGTTTCTACAAAGATCGTTATGTTTATCGGCACTTTGCATCGGCCGCGCTCCCGATTCCGGAAGTGCTTGACATTGGGGAATTCAGCGAGAGCCTGACCTATTGCATCTCCCGCCGTGCACAGGGTGTCACGTTGCAAGACCTGCCTGAAACCGAACTGCCCGCTGTTCTGCAGCCGGTCGCGGAGGCCATGGATGCGATCGCTGCGGCCGATCTTAGCCAGACGAGCGGGTTCGGCCCATTCGGACCGCAAGGAATCGGTCAATACACTACATGGCGTGATTTCATATGCGCGATTGCTGATCCCCATGTGTATCACTGGCAAACTGTGATGGACGACACCGTCAGTGCGTCCGTCGCGCAGGCTCTCGATGAGCTGATGCTTTGGGCCGAGGACTGCCCCGAAGTCCGGCACCTCGTGCACGCGGATTTCGGCTCCAACAATGTCCTGACGGACAATGGCCGCATAACAGCGGTCATTGACTGGAGCGAGGCGATGTTCGGGGATTCCCAATACGAGGTCGCCAACATCTTCTTCTGGAGGCCGTGGTTGGCTTGTATGGAGCAGCAGACGCGCTACTTCGAGCGGAGGCATCCGGAGCTTGCAGGATCGCCGCGGCTCCGGGCGTATATGCTCCGCATTGGTCTTGACCAACTCTATCAGAGCTTGGTTGACGGCAATTTCGATGATGCAGCTTGGGCGCAGGGTCGATGCGACGCAATCGTCCGATCCGGAGCCGGGACTGTCGGGCGTACACAAATCGCCCGCAGAAGCGCGGCCGTCTGGACCGATGGCTGTGTAGAAGTACTCGCCGATAGTGGAAACCGACGCCCCAGCACTCGTCCGAGGGCAAAGGAATAGCACGTGCTACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAGTTCTTCGCCCACCCCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGTATACCGTCGACCTCTAGCTAGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCAATGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGGACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGCAGGGGGGGGGGGGGAAAGCCACGTTGTGTCTCAAAATCTCTGATGTTACATTGCACAAGATAAAAATATATCATCATGAACAATAAAACTGTCTGCTTACATAAACAGTAATACAAGGGGTGTTATGAGCCATATTCAACGGGAAACGTCTTGCTCGAGGCCGCGATTAAATTCCAACATGGATGCTGATTTATATGGGTATAAATGGGCTCGCGATAATGTCGGGCAATCAGGTGCGACAATCTATCGATTGTATGGGAAGCCCGATGCGCCAGAGTTGTTTCTGAAACATGGCAAAGGTAGCGTTGCCAATGATGTTACAGATGAGATGGTCAGACTAAACTGGCTGACGGAATTTATGCCTCTTCCGACCATCAAGCATTTTATCCGTACTCCTGATGATGCATGGTTACTCACCACTGCGATCCCCGGGAAAACAGCATTCCAGGTATTAGAAGAATATCCTGATTCAGGTGAAAATATTGTTGATGCGCTGGCAGTGTTCCTGCGCCGGTTGCATTCGATTCCTGTTTGTAATTGTCCTTTTAACAGCGATCGCGTATTTCGTCTCGCTCAGGCGCAATCACGAATGAATAACGGTTTGGTTGATGCGAGTGATTTTGATGACGAGCGTAATGGCTGGCCTGTTGAACAAGTCTGGAAAGAAATGCATAAGCTTTTGCCATTCTCACCGGATTCAGTCGTCACTCATGGTGATTTCTCACTTGATAACCTTATTTTTGACGAGGGGAAATTAATAGGTTGTATTGATGTTGGACGAGTCGGAATCGCAGACCGATACCAGGATCTTGCCATCCTATGGAACTGCCTCGGTGAGTTTTCTCCTTCATTACAGAAACGGCTTTTTCAAAAATATGGTATTGATAATCCTGATATGAATAAATTGCAGTTTCATTTGATGCTCGATGAGTTTTTCTAATCAGAATTGGTTAATTGGTTGTAACACTGGCAGAGCATTACGCTGACTTGACGGGACGGCGGCTTTGTTGAATAAATCGAACTTTTGCTGAGTTGAAGGATCAGATCACGCATCTTCCCGACAACGCAGACCGTTCCGTGGCAAAGCAAAAGTTCAAAATCACCAACTGGTCGATCCCCGGGGCG (II)
отличающаяся тем, что указанный искусственный рекомбинантный полипептид и указанная плазмидная ДНК включены в однослойные липосомы размером от 100 до 250 нм, состоящие из 1,2-Дипальмитоил-sn-глицеро-3-фосфатидилхолина и маннозиалированого дипальмитоилфосфатидилэтаноламина (ManDOG), лактозы и α-токоферола, при этом количества каждого из компонентов в указанной лекарственной форме имеют следующие значения, мас. %:
Активный ингредиент:

Искусственный рекомбинантный полипептид (0,1±0,05)
Плазмидная ДНК (0,2±0,05)

Липосомальная оболочка:
1,2-Дипальмитоил-sn-глицеро-3-фосфатидилхолин (20,0±5,0)
Липид ManDOG (0,2±0,01)

Антиокислитель:
α-Токоферол (0,2±0,01)

Криопротектор-стабилизатор:
Лактоза (80,0±5,0),

при условии, что общее количество компонентов лекарственной формы составляет 100 мас. %.

2. Способ приготовления инъекционной лекарственной формы по п. 1, отличающийся тем, что механическую смесь указанного искусственного рекомбинантного полипептида, имеющего аминокислотную последовательность (I), и указанной плазмидной ДНК, имеющей нуклеотидную последовательность (II), растворяют в воде, затем смешивают с водной суспензией однослойных липосом размером 50-80 нм, предварительно полученных путем регидратации липидной пленки с последующей дезинтеграцией получившихся многослойных липосом и добавлением лактозы, полученную смесь олигопептидов и липосом стерильно фильтруют, разливают по флаконам, лиофильно высушивают, флаконы заполняют азотом, укупоривают резиновыми пробками и обкатывают колпачками.



 

Похожие патенты:

Изобретение относится к области ветеринарии и предназначено для лечения гепатоза молочных коров в условиях техногенных провинций. Способ включает внутримышечное двукратное введение препарата Габивит-Se в дозе 15-20 мл с интервалом 6-8 суток.

Представленные изобретения касаются применения средства, стимулирующего регенерацию тканей, и способа стимуляции регенерации мезенхимальных, эпителиальных или неврологических тканей путем введения такого средства.
Изобретение относится к области медицины, а именно к онкологии, и может быть использовано для лечения опухолей мозга и меланомы. Для этого пациенту интратуморально вводят раствор белка теплового шока 70 человека, полученного по технологии с использованием штамма-продуцента Escherichia coli BB 1553, трансформированного векторной плазмидой pMSHsp70 в дозе 0,5 мг белка.

Изобретение относится к области биотехнологии, конкретно к антагонистам Wnt, и может быть использовано в медицине. С использованием сигнальной последовательности получают Wnt-связывающие полипептиды на основе домена Fri из FZD8 человека и Fc-фрагмента.

Изобретение относится к области биотехнологии, конкретно к получению нетоксичной мутантной формы гена Cholix (ntCholix) Vibrio cholera, и может быть использовано в медицине. Получают вариант Cholix, усеченный по аминокислоте A386 (Cholix386) или с удаленным остатком Glu581.

Группа изобретений относится к медицине и касается способа активации теломеразы, удлинения теломер и увеличения потенциала клеточного деления, включающего введение композиции, содержащей соединение, такое как циклоастрагенол, и, по меньшей мере, один пептид тимуса, выбранный из группы дипептида, трипептида, тетрапептида или пентапептида, и/или пептид эпифиза, выбранный из группы дипептида, трипептида, тетрапептида или пентапептида.

Изобретение относится к области биотехнологии и медицины. Предложен способ увеличения уровней эритроцитов или лечения анемии пациента.

Изобретение относится к биотехнологии и представляет собой пептид, который имеет аминокислотную последовательность, состоящую из смежных аминокислот, полученных из белка WT1, и индуцирует WT1-специфические хелперные Т-клетки связыванием с молекулой МНС класса II.

Изобретение относится к фармацевтической промышленности и представляет собой композицию, включающую, по меньшей мере, один N-ацетиллактозамин, выбранный из группы, включающей лакто-N-тетраозу и лакто-N-неотетраозу, по меньшей мере, один сиалилированный олигосахарид и, по меньшей мере, один фукозилированный олигосахарид и гидролизат, включающий частично и/или сильно гидролизованные белки, у которых предпочтительно от 10% до 100% и предпочтительнее от 15% до 95%, популяции белков/пептидов имеют молекулярную массу менее 1000 дальтон, для применения при предупреждении и/или лечении атопического дерматита и экземы.
Описана неводная масляная инъекционная композиция многодозового типа, включающая активный ингредиент, масло, содержащее активный ингредиент, гидрофильное вспомогательное вещество, не отделяемое по фазе от масла, и липофильный консервант, комбинируемый с гидрофильным вспомогательным веществом.
Группа изобретений относится к медицине. Описано состоящее из частиц вещество, содержащее: частицы керамической матрицы, несущие функциональную группу, способную стимулировать проникновение частиц в клетки; и биомолекулу, находящуюся в порах частиц, где указанная биомолекула может высвобождаться из частиц при растворении керамической матрицы. Вещество обеспечивает хорошую пенетрацию активного вещества в клетки-мишени. 3 н. и 53 з.п. ф-лы, 22 ил.
Настоящее изобретение относится к биохимии, в частности к применению композиции, содержащей агент, ингибирующий MASP-2, в количестве, эффективном для ингибирования или предупреждения образования бляшек в сосудистой системе пациента, для приготовления лекарственного средства для лечения указанного пациента, страдающего или подверженного риску развития комплемент-опосредованного нарушения свертывания крови, такого как диссеминированное внутрисосудистое свертывание крови (ДВС). Настоящее изобретение также раскрывает применение указанной композиции в производстве лекарственного средства для лечения или профилактики инфекции менингококка Neisseria meningitidis у пациента. Настоящее изобретение также раскрывает способ лечения комплемент-опосредованного нарушения свертывания крови и способ лечения или профилактики инфекции менингококка Neisseria meningitidis у пациента. Настоящее изобретение раскрывает новые применения агента, ингибирующего MASP-2, и позволяет расширить арсенал средств для лечения ДВС и инфекции Neisseria meningitidis. 5 н. и 34 з.п. ф-лы, 40 ил., 7 табл., 40 пр.
Заявленная группа изобретений относится к области иммунологии. Штаммы вида Streptococcus pneumoniae депонированы в Государственной коллекции патогенных микроорганизмов III-IV групп патогенности ФГБУ «Научный центр экспертизы средств медицинского применения» Минздрава России под регистрационными номерами 296, 297, 298. Данные штаммы обладают внутривидовой перекрестной протективной активностью и могут быть использованы для получения белоксодержащих фракций. Предложен способ получения белоксодержащих фракций из указанных штаммов для разработки пневмококковых вакцин. Для этого штамм культивируют, микробные клетки отделяют микрофильтрацией, инактивируют диметилкетоном с последующей водной экстракцией и ультрафильтрацией до получения белоксодержащей фракции с молекулярной массой 30-100 кДа и лиофильным высушиванием. Получают эффективные препараты с внутривидовой иммуногенной активностью в отношении соответствующих серотипов S. pneumoniae, которые могут быть использованы в качестве противопневмококковой вакцины широкого спектра действия. 4 н.п. ф-лы, 1 ил., 4 табл., 1 пр.
Наверх