Способы получения конъюгатов

Изобретение относится к способу получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие модифицированного цитотоксического соединения с модифицированным СВА при pH от приблизительно 4 до приблизительно 9, причем модифицированный СВА включает остаток бифункционального сшивающего агента, связанный с СВА, а указанный остаток включает связывающую группу и группу, способную взаимодействовать с тиолом, где СВА представляет собой антитело, и модифицированный СВА представлен формулами, указанными в формуле изобретения, модифицированное цитотоксическое соединение включает тиоловую группу и его получают взаимодействием имин-содержащего цитотоксического соединения, несущего тиоловую группу, с реагентом, способным взаимодействовать с иминами, и где имин-содержащее цитотоксическое соединение представлено формулой:

в которой X' представляет собой –Н, Y' представляет собой -Н или оксогруппу, W' представляет собой -N(Re)-, Re представляет собой -(CH2-CH2-O)n-Rk, где Rk является -H, линейным, разветвленным или циклическим алкилом, имеющим от 1 до 6 атомов углерода, n является целым числом от 1 до 24, Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода, А и А' являются -О-, R6 является -OR, R, в каждом случае, представляет собой линейный или разветвленный алкил, имеющий от 1 до 6 атомов углерода, G представляет собой -CH-, и реагент, способный взаимодействовать с иминами, выбран из группы, состоящей из сульфита, метабисульфита и дитионита. Изобретение также относится к иным способам получения конъюгата. Технический результат: предложены новые способы получения конъюгата с использованием реагента, способного взаимодействовать и иминами, для модификации имин-содержащих цитотоксических соединений. 6 н. и 48 з.п. ф-лы, 28 ил., 16 табл., 16 пр.



[01] Настоящая заявка, согласно 35 USC §119 (е), испрашивает приоритет даты подачи предварительной заявки США №61/443062, поданной 15 февраля 2011 г., предварительной заявки США №61/483499, поданной 6 мая 2011 г., и предварительной заявки США №61/443092, поданной 15 февраля 2011 г., полное содержание которых, включая все чертежи, формулы, описания и формулы изобретения, включено сюда посредством ссылки.


[02] Настоящее изобретение описывает использование реагентов, способных взаимодействовать с иминами, для получения конъюгатов агентов, связывающихся с клетками, с ДНК-связывающими цитотоксическими лекарственными веществами, содержащими одну или более иминовых функциональных групп.


[03] В качестве терапевтических средств против рака все чаще тестируются моноклональные антитела. Несколько моноклональных антител против антигенов поверхности раковых клеток уже одобрено для лечения рака, например ритуксимаб - для неходжкинской лимфомы, трастузумаб - для рака молочной железы, цетуксимаб - для рака головы и шеи и рака толстой кишки, цетуксимаб, панитимумаб и бевацизумаб - для рака толстой кишки, и алемтузумаб для хронического лимфолейкоза (Strome, S.Е., Sausville, Е.A., and Mann, D., 2007, The Oncologist, 12, 1084-1095). Тем не менее, цитотоксическая активность "оголенного" антитела может быть ограничена механизмами ингибирования рецепторной функции, комплемент-зависимой цитотоксичностью (CDC) и антитело-зависимой клеточноопосредованной цитотоксичностью (ADCC).

[04] Подход к усилению цитотоксической активности антител к раковым клеткам-мишеням заключается в связывании антитела с цитотоксическими эффекторами (А.D. Ricart, and A.W. Tolcher, 2007, Nat. din. Pract. Oncol. 4, 245-255; Lambert, J., 2010, Drugs of the Future 35, 471-480). Конъюгат антитело/цитотоксическое лекарственное вещество (АЦК) специфически связывается с раковыми клетками, затем происходит интернализация и разрушение конъюгата, что приводит к внутриклеточному высвобождению токсичного лекарственного вещества и, в конечном итоге, к гибели раковых клеток. Цитотоксические лекарственные вещества, используемые в соединении с антителами, включают антитубулиновые лекарственные вещества, например майтанзиноиды и ауристатины, ДНК-связывающие лекарственные вещества, например калихеамицин, вызывающий сайт-специфическое расщепление двухцепочечной ДНК. Еще один класс ДНК-связывающих цитотоксических лекарственных веществ включает имин-содержащие пирролбензодиазепины (PBD), например N-2-имидазолилалкил-замещенный 1,2,5-бензотиадиазепин-1,1-диоксид, патент США №6156746), бензо-пиридо- или -дипиридотиадиазепин (WO 2004/069843), пиррол[1,2-b][1,2,5]бензотиадиазепины и производные пиррол[1,2-b][1,2,5]бензодиазепина (WO 2007/015280), производные томаймицина (например, пиррол[1,4]бензодиазепины), например, описанные в WO 00/12508, WO 2005/085260, WO 2007/085930, ЕР 2019104 и патенте США №6156746). Другие ДНК-связывающие бензодиазепиновые лекарственные вещества описаны в патентной публикации США №2010/0203007 А1. Указанные бензодиазепиновые лекарственные вещества, содержащие иминовые связи, связываются с малой бороздкой ДНК и вносят помехи в функционирование ДНК, что приводит к гибели клеток.

[05] Существует потребность в новых способах получения конъюгатов агента, связывающего клетки, и цитотоксических лекарственных веществ, несущих иминовую группу.


[06] Настоящее изобретение описывает использование реагентов, способных взаимодействовать с иминами, для обработки имин-содержащего лекарственного вещества, приводящей к неожиданному улучшению реакции его конъюгирования с агентами, связывающимися с клетками (СВА), например антителами. Указанные реагенты являются таковыми, что не ослабляется свойство лекарственных веществ уничтожать клетки и полностью сохраняется целостность СВА (антитела).

[07] В одном варианте воплощения настоящее изобретение относится к способу получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие цитотоксического соединения с модифицированным СВА при рН приблизительно от 4 до 9, причем:

а) модифицированный СВА включает остаток бифункционального сшивающего агента, связанный с СВА, а указанный остаток включает связывающую группу и группу, способную взаимодействовать с тиолом; и

б) цитотоксическое соединение включает тиоловую группу и группу, представленную формулой:


Y является уходящей группой и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом.

[08] В некоторых вариантах воплощения цитотоксическое соединение получают взаимодействием имин-содержащего цитотоксического соединения, несущего тиоловую группу, с реагентом, способным взаимодействовать с иминами.

[09] В еще одном варианте воплощения настоящее изобретение относится к способу получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, способу, включающему взаимодействие СВА с имин-содержащим цитотоксическим соединением, реагентом, способным взаимодействовать с иминами, и бифункциональным сшивающим агентом, включающим связывающую группу, с образованием конъюгата.

[10] В еще одном варианте воплощения настоящее изобретение относится к способу получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, способу, включающему:

а) взаимодействие цитотоксического соединения с бифункциональным сшивающим агентом, включающим связывающую группу, группу, реагирующую с СВА (например, тиоловую группу, малеимидную группу, галоацетамидную группу или аминогруппу), и группу, реагирующую с цитотоксическим соединением, с образованием модифицированного цитотоксического соединения, ковалентно связанного с остатком бифункционального сшивающего агента, причем указанный остаток включает связывающую группу и группу, реагирующую с СВА;

причем цитотоксическое соединение представлено одной из следующих формул или ее фармацевтически приемлемой солью:



Y является уходящей группой и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, PiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом;

X' выбран из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Y' выбран из -Н, оксогруппы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов;

Rc является -Н или замещенным или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-Rc, галогена, гуанидиния [-NH(ONH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+, сульфата -OSO3-M+, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

каждая из R' и Rʺ, независимо, выбрана из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

n является целым числом от 1 до 24;

W выбрана из С=O, C=S, CH2, ВН, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2 или галогеном;

Z и Z', независимо, выбраны из -(CH2)n'-, -(CH2)n'-CR7R8-(CH2)na'-, -(СН2)n'-NR9-(CH2)na'-, -(CH2)n'-O-(CH2)na'- и -(CH2)n'-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0, 1, 2 и 3;

R7 и R8 являются одинаковыми или различными, и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-;

А и А' являются одинаковыми или различными и независимо выбраны из -O-, оксо (-С(=O)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- и -CRR'N(R5)-,

R5, в каждом случае независимо, является -Н или, необязательно, замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и независимо отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-ОСН2СН2)n-;

L отсутствует или, если присутствует, включает тиоловую группу, или является мономером полиэтиленгликоля (-ОСН2СН2)n-, линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил, алкенил, фенил или гетероциклическое или гетероарильное кольцо является необязательно замещенным; и

б) взаимодействие модифицированного цитотоксического соединения с СВА посредством группы, реагирующей с СВА, при рН от приблизительно 4 до приблизительно 9, с образованием конъюгата.

[11] В любом из вышеописанных вариантов воплощения имин-содержащее цитотоксическое соединение может быть представлено любой из следующих формул или ее фармацевтически приемлемой солью:


X' выбрана из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Y' выбрана из -Н, оксогруппы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов;

Rc является -Н или замещенным или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-Rc, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+, сульфата -OSO3-M+, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ и связывающей группы;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

каждая из R' и Rʺ, независимо, выбрана из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

n является целым числом от 1 до 24;

W выбрана из С=O, C=S, CH2, ВН, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2 или галогеном;

Z и Z', независимо, выбраны из -(СН2)n'-, -(CH2)n'-CR7R8-(CH2)na'-, -(CH2)n'-NR9-(CH2)na'-, -(СН2)n'-O-(СН2)na'- и -(CH2)n'-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0, 1, 2 и 3;

R7 и R8 являются одинаковыми или различными, и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-;

А и А' являются одинаковыми или различными и, независимо, выбраны из -O-, оксо(-С(=O)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- и -CRR'N(R5)-,

R5, в каждом случае независимо, является -Н или необязательно замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и, независимо, отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-ОСН2СН2)n-;

L отсутствует или, если присутствует, включает тиоловую группу и является мономером полиэтиленгликоля (-ОСН2СН2)n-, линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил, алкенил, фенил или гетероциклическое или гетероарильное кольцо является, необязательно, замещенным.

[12] В еще одном варианте воплощения настоящее изобретение относится к способу получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие модифицированного цитотоксического соединения с СВА при рН приблизительно от 4 до 9, причем модифицированное цитотоксическое соединение включает:

а) остаток бифункционального сшивающего агента, связанный с цитотоксическим соединением и включающий связывающую группу и реакционно-способную группу, выбранную из реакционно-способного сложного эфира, и группы, реагирующей с тиолами, и

б) группу, представленную:


Y является уходящей группой и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5s или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS3- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S1O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещена заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом.

[13] В некоторых вариантах воплощения модифицированное цитотоксическое соединение получают путем взаимодействия реагента, способного взаимодействовать с иминами, с имин-содержащим цитотоксическим соединением, несущим связывающую группу и реакционно-способную группу.

[14] В любом из вышеописанных вариантов воплощения модифицированное цитотоксическое соединение представлено любой из следующих формул:

или ее фармацевтически приемлемой солью, где:

Y является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где R1 является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом;

X' выбрана из -Н, амин-блокирующей группы, связывающей группы с присоединенной к ней реакционно-способной группой, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Y' выбрана из -Н, оксогруппы, связывающей группы с присоединенной к ней реакционно-способной группой, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов;

Rc является -Н или замещенным или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, или связывающей группой с присоединенной к ней реакционно-способной группой;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-Rc, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+, сульфата -OSO3-M+, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ и связывающей группы с присоединенной к ней реакционно-способной группой;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

каждая из R' и Rʺ, независимо, выбрана из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

n является целым числом от 1 до 24;

W выбрана из С=O, C=S, CH2, ВН, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2, галогеном или связывающей группой с присоединенной к ней реакционно-способной группой;

Z и Z', независимо, выбраны из -(CH2)n'-, -(CH2)n'-CR7R8-(CH2)na'-, -(СН2)n'-NR9-(CH2)na'-, -(СН2)n'-O-(СН2)na'- и -(CH2)n'-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0, 1, 2 и 3;

R7 и R8 являются одинаковыми или различными, и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-;

А и А' являются одинаковыми или различными и, независимо, выбраны из -O-, оксо (-С(=О)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -NR5 и -CRR'N(R5)-;

R5, в каждом случае независимо, является -Н или необязательно замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и, независимо, отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-ОСН2СН2)n-;

L отсутствует, является связывающей группой с присоединенной к ней реакционно-способной группой, мономером полиэтиленгликоля (-ОСН2СН2)n-, линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил или алкенил, необязательно, замещены связывающей группой с присоединенной к ней реакционно-способной группой; фенил или гетероциклическое или гетероарильное кольцо могут быть, необязательно, замещены, причем заместитель может являться связывающей группой с присоединенной к ней реакционно-способной группой.

[15] В любом из вышеописанных вариантов воплощения цитотоксическое соединение и связывающая группа конъюгата представлены любой из следующих формул:

или ее фармацевтически приемлемой солью, где:

Y является уходящей группой и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)]NOH или солью, образованной катионом), формальдегидсульфокеилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом;

X' выбрана из -Н, амин-блокирующей группы, связывающей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Y' выбрана из -Н, оксогруппы, связывающей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов;

Rc является -Н или замещенным или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, или связывающей группой;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-Rc, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+ сульфата -OSO3-M+ сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ и связывающей группы;

М является -Н или фармацевтически приемлемым катионом, например Na+;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

каждая из R' и Rʺ, независимо, выбрана из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

n является целым числом от 1 до 24;

W выбрана из С=O, OS, CH2, BH, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2, галогеном или связывающей группой;

Z и Z', независимо, выбраны из -(CH2)n'-, -(CH2)n'-CR7R8-(CH2)na', -(CH2)n'-NR9-(CH2)na'-, -(CH2)n'-O-(CH2)na'- и -(CH2)n-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0, 1, 2 и 3;

R7 и R8 являются одинаковыми или различными, и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-;

А и А' являются одинаковыми или различными и, независимо, выбраны из -O-, оксо (-С(=O)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- и -CRR'N(R5)-,

R5, в каждом случае независимо, является -Н или необязательно замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и, независимо, отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-OCH2CH2)n-;

L отсутствует, является связывающей группой, мономером полиэтиленгликоля (-ОСН2СН2)n-, необязательно замещенным линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил или алкенил, необязательно, замещены связывающей группой, фенил или гетероциклическое или гетероарильное кольцо могут быть, необязательно, замещены, причем заместитель может включать связывающую группу.

[16] Некоторые предпочтительные конъюгаты, которые можно получить в соответствии с любым из способов согласно изобретению, включают:


где СВА является агентом, связывающимся с клетками, например,

антителом, а r является целым числом между 1-20, предпочтительно - между 1-10 или 1-5.

[17] Как используется здесь, по отношению к группе (например, Rc, L, X' и т.д.), "является/являться" (или "не является") связывающей группой или связывающей группой с присоединенной к ней реакционно-способной группой означает, что группа "включает" (или "не включает") связывающую группу или связывающую группу с присоединенной к ней реакционно-способной группой.


[18] На Фиг.1 показаны масс-спектры дегликозилированных конъюгатов huMy9-6-2, изготовленных без и с использованием бисульфита, включающих 1,4 DAR (А) и 3,1 DAR (Б), соответственно. DAR; соотношение лекарственное вещество - антитело.

[19] На Фиг.2 показана аналогичная цитотоксичность in vitro конъюгатов huMy9-6/лекарственное вещество 2, полученных без и с использованием бисульфита натрия, против клеток HL60, экспрессирующих антиген CD33.

[20] На Фиг.3 показана аналогичная цитотоксичность in vitro конъюгатов антитело против CD22/лекарственное вещество 2, полученных без и с использованием бисульфита натрия, против клеток BJAB, экспрессирующих антиген CD22.

[21] На Фиг.4 показан обращенно-фазный ВЭЖХ-анализ лекарственного вещества 2 и лекарственного вещества 2, обработанного бисульфитом натрия.

[22] На Фиг.5 показан МС-анализ дегликозилированного huMy9-6-SPDB - лекарственного вещества 1, полученного с и без использования бисульфита натрия, с использованием 7 молярных эквивалентов 1 на антитело. А) Конъюгат получали без использования бисульфита натрия со средним соотношением лекарственное вещество 1/антитело, равным 1,4; а антитело с до конъюгат был получен без содержания до трех присоединенных молекул лекарственного вещества 1 на антитело. Б) Конъюгат получали с использованием бисульфита натрия со средним соотношением лекарственное вещество 1/антитело, равным 2,5; а антитело с до конъюгат был получен с содержанием до семи присоединенных молекул лекарственного вещества 1 на антитело.

[23] На Фиг.6 показано, что добавление бисульфита натрия к реакционной смеси при конъюгировании лекарственного вещества 1 не приводит к фрагментации антитела (невосстанавливающем ДСН-ПААГ; анализ геля на чипе).

[24] На Фиг.7-11 показаны типичные способы по настоящему изобретению для получения конъюгата связывающийся с клетками агент/лекарственное вещество.

[25] На Фиг.12 показан масс-спектрометрический (МС) анализ дегликозилированного MY9-6-SPDB-1, полученного путем конъюгирования соединения 1, содержащего NHS-эфир (одноэтапный реагентный способ), непосредственно с остатками лизина антитела, или конъюгирования соединения 1d с антителом, модифицированным дитиопиридином (двухэтапный способ).

[26] На Фиг.13 показаны данные МС для My9-6-сульфо-SPDB-1, полученного при использовании двухэтапного способа при различных рН. Повышенное время реакции, по-видимому, коррелирует с повышенной CD33-антиген-независимой цитотоксичностью in vitro, измеренной на клетках HL60-QC, предварительно обработанных 1 мкМ неконъюгированного huMy9-6. Антиген-зависимая цитотоксичность для всех конъюгатов была так же высока (IC50~4 пМ). Короткое время реакции (1-3 ч) является предпочтительным для сведения к минимуму фрагментации антитела и неспецифического уничтожения клеток для Му9-6-сульфо-SPDB-1 in vitro.

[27] На Фиг.14 показаны данные МС для chKT1-сульфо-SPDB-1, полученного при использовании двухэтапного способа с различными соотношениями соединение 1d/линкер.

[28] На Фиг.15 показано использование ковалентных иминовых реагентов для улучшения характеристик конъюгата антитело/лекарственное вещество (% мономера и лекарственной нагрузки).

[29] На Фиг.16 показана схема двухэтапного синтеза типичных конъюгатов антитело/лекарственное вещество.

[30] На Фиг.17 показана цитотоксичность и специфичность in vitro конъюгатов huMy9-6-SPDB-1f против различных клеточных линий. Следует отметить, что к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[31] На Фиг.18 показано, что конъюгирование димера не снижает сродство связывания антитела. Следует отметить, что к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[32] На Фиг.19 показана антиопухолевая активность in vivo конъюгата huMy9-6. Следует отметить, что к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[33] На Фиг.20 показана цитотоксичность in vitro конъюгата huMy9-6-SPDB-1f против антиген-положительных клеток. Следует отметить, что к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[34] На Фиг.21 показана цитотоксичность in vitro для huMy9-6-SPDB-1f (A), huMy9-6-cульфoSPDB-1f (Б) и huMy9-6-BMPS-1f (В) против клеток HL60/QC (Ag+) с и без блокирования антиген-связывающих сайтов. Следует отметить, что во всех трех экспериментах (34А, 34Б и 34В) к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[35] На Фиг.22 показана цитотоксичность in vitro для chB38.1-SPDB-1f (А) и chB38.1-сульфоSРDВ-1f (Б) против клеток COL0205 (Ag+). Следует отметить, что в обоих экспериментах к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[36] На Фиг.23 показана эффективность in vivo huMy9-6-SPDB-1f у мышей, несущих HL60/QC. Следует отметить, что к реакционной среде для конъюгирования добавляли бисульфит натрия.

[37] На Фиг.24 показана антипролиферативная активность путем сравнения (A) huMy9-6-SPDB-1f, (Б) huMy9-6-сульфоSPDВ-1f и (В) huMy9-6-BMPS-1f против клеток OCI-AML3 (Ag+) с и без блокировки антиген-связывающих сайтов. Следует отметить, что во всех трех экспериментах к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[38] На Фиг.25 показана эффективность in vivo huMy9-6-BMPS-1f у мышей, несущих опухоль MOLM-13. Следует отметить, что к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[39] На Фиг.26 показана типичная схема синтеза конъюгата сульфированный фолат/цитотоксическое соединение. Следует отметить, что к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[40] На Фиг.27 показана эффективность in vivo nuMy9-6-лекарственное вещество 2 у мышей, несущих опухоль MOLM-13. Следует отметить, что к реакционной среде для изготовления конъюгата добавляли бисульфит натрия.

[41] На Фиг.28 показано получение huMy9-6-сульфо-SPDB-1d с использованием линкера 4-нитроРy-сульфо-8РОВ, обладающего высокой реакционной способностью.


[42] В данном разделе приведено подробное описание со ссылками на конкретные варианты воплощения изобретения, примеры которых нашли отражение в прилагаемых структурах и формулах. Хотя настоящее изобретение описано применительно к конкретным приведенным вариантам воплощения, следует понимать, что настоящее изобретение не ограничено указанными вариантами воплощения. Напротив, подразумевается, что изобретение охватывает все альтернативы, модификации и эквиваленты, которые могут быть включены в объем настоящего изобретения, как определено формулой изобретения. Для специалиста в данной области техники очевидны многочисленные способы и материалы, аналогичные или эквивалентные описанным здесь, которые можно использовать для осуществления настоящего изобретения.

[43] Следует понимать, что любой из описанных здесь вариантов воплощения, включая варианты, описанные в различных аспектах настоящего изобретения (например, соединения, молекулы соединение-линкер, конъюгаты, композиции, способы их получения и применения), и различные части описания (включая варианты воплощения, описанные только в Примерах) можно объединять с одним или более других вариантов воплощения изобретения, если они не отрицаются или не являются несоответствующими явным образом. Комбинация вариантов воплощения изобретения не ограничивается указанными специфическими комбинациями, заявленными в нескольких зависимых пунктах формулы изобретения.


[44] "Линейный или разветвленный алкил", как используется здесь, относится к насыщенному линейному или разветвленному одновалентному углеводородному радикалу из от одного до двадцати атомов углерода. Примеры алкилов включают метил, этил, 1-пропил, 2-пропил, 1-бутил, 2-метил-1-пропил, -СН2СН(СН3)2), 2-бутил, 2-метил-2-пропил, 1-пентил, 2-пентил, 3-пентил, 2-метил-2-бутил, 3-метил-2-бутил, 3-метил-1-бутил, 2-метил-1-бутил, 1-гексил, 2-гексил, 3-гексил, 2-метил-2-пентил, 3-метил-2-пентил, 4-метил-2-пентил, 3-метил-3-пентил, 2-метил-3-пентил, 2,3-диметил-2-бутил, 3,3-диметил-2-бутил, 1-гептил, 1-октил и т.п., но не ограничиваются ими. Предпочтительно алкил имеет от одного до десяти атомов углерода. Более предпочтительно алкил имеет от одного до четырех атомов углерода.

[45] "Линейный или разветвленный алкенил" относится к линейному или разветвленному одновалентному углеводородному радикалу из от двух до двадцати атомов углерода с по меньшей мере одним ненасыщенным сайтом, т.е. двойной связью углерод-углерод, причем алкенил-радикал включает радикалы с "цис-" и "транс-" ориентацией или, в качестве альтернативы, в ориентациях "Е" и "Z". Примеры включают этиленил или винил (-СН=СН2), аллил (-СН2СН=СН2) и т.п., но не ограничиваются ими. Предпочтительно алкенил имеет от двух до десяти атомов углерода. Более предпочтительно алкенил содержит от двух до четырех атомов углерода.

[46] "Линейный или разветвленный алкинил" относится к линейному или разветвленному одновалентному углеводородному радикалу из от двух до двадцати атомов углерода с по меньшей мере одним ненасыщенным сайтом, т.е. тройной связью углерод-углерод. Примеры включают этинил, пропинил, 1-бутинил, 2-бутинил, 1-пентинил, 2-пентинил, 3-пентинил, гексинил и т.п., но не ограничиваются ими. Предпочтительно алкинил имеет от двух до десяти атомов углерода. Более предпочтительно алкинил имеет от двух до четырех атомов углерода.

[47] Термин "карбоцикл", "карбоциклил" и "карбоциклическое кольцо" относятся к одновалентному неароматическому, насыщенному или частично ненасыщенному кольцу, имеющему от 3 до 12 атомов углерода - в случае моноциклического кольца, или от 7 до 12 атомов углерода - в случае бициклического кольца. Бициклические карбоциклы, имеющие от 7 до 12 атомов, могут быть организованы, например, в виде бицикло [4,5], [5,5], [5,6] или [6,6], а бициклические карбоциклы, имеющие 9 или 10 атомов в кольце, могут быть организованы в виде системы бицикло [5,6] или [6,6], или в виде мостиковых систем, например, бицикло[2.2.1]гептана, бицикло[2.2.2]октана и бицикло[3.2.2]нонана. Примеры моноциклических карбоциклов включают циклопропил, циклобутил, циклопентил, 1-циклопент-1-енил, 1-циклопент-2-енил, 1-циклопент-3-енил, циклогексил, 1-циклогекс-1-енил, 1-циклогекс-2-енил, 1-циклогекс-3-енил, циклогексадиенил, циклогептил, циклооктил, циклононил, циклодецил, циклоундецил, циклододецил и т.п., но не ограничиваются ими.

[48] Термины "циклический алкил" и "циклоалкил" можно использовать на равных основаниях. Они относятся к одновалентному насыщенному карбоциклическому кольцевому радикалу. Предпочтительно циклический алкил является 3-7-членным моноциклическим кольцевым радикалом. Более предпочтительно циклический алкил является циклогексилом.

[49] Термин "циклический алкенил" относится к карбоциклическому кольцевому радикалу, имеющему по меньшей мере одну двойную связь в составе кольцевой структуры.

[50] Термин "циклический алкинил" относится к карбоциклическому кольцевому радикалу, имеющему по меньшей мере одну тройную связь в составе кольцевой структуры.

[51] "Арил" означает одновалентный ароматический углеводородный радикал из 6-18 атомов углерода, полученный удалением одного атома водорода от одного атома углерода исходной ароматической кольцевой системы. Некоторые арильные группы представлены в типичных структурах как "ARʺ. Арил включает бициклические радикалы, включающие ароматическое кольцо, конденсированные с насыщенным, частично ненасыщенным кольцом или ароматическим карбоциклическим, или гетероциклическим кольцом. Типичные арильные группы включают радикалы, происходящие от бензола (фенил), замещенные бензолы, нафталин, антрацен, инденил, инданил, 1,2-дигидронафталин, 1,2,3,4-тетрагидронафтил и т.п., но не ограничиваются ими. Предпочтительно арил является фенильной группой.

[52] Термины "гетероцикл", "гетероциклил" и "гетероциклическое кольцо" используются здесь на равных основаниях и относятся к насыщенному или частично ненасыщенному (т.е. имеющему одну или более двойных и/или тройных связей в составе кольца) карбоциклическому радикалу из от 3 до 18 атомов в составе кольца, причем по меньшей мере один атом в составе кольца является гетероатомом, выбранным из азота, кислорода, фосфора и серы, а остальные атомы в составе кольца являются атомами С, где один или более атомов в составе кольца, необязательно, независимо, замещены одним или более заместителями, описанными ниже. Гетероцикл может являться моноциклической структурой, имеющей от 3 до 7 членов кольца (2-6 атомов углерода и 1-4 гетероатома, выбранных из N, О, Р и S) или бициклической структурой, имеющей от 7 до 10 членов кольца (4-9 атомов углерода и 1-6 гетероатомов, выбранных из N, О, Р и S), например: системой бицикло [4,5], [5,5], [5,6] или [6,6]. Гетероциклы описаны в Paquette, Leo A.; "Principles of Modem Heterocyclic Chemistry" (W.A. Benjamin, New York, 1968), в частности, в главах 1, 3, 4, 6, 7 и 9; "The Chemistry of Heterocyclic Compounds, A series of Monographs" (John Wiley & Sons, New York, с 1950 по настоящее время), в частности, томах 13, 14, 16, 19 и 28; и J. Am. Chem. Soc. (1960) 82:5566. "Гетероциклил" также включает радикалы, где гетероциклические радикалы конденсированы с насыщенным, частично ненасыщенным кольцом или ароматическим карбоциклическим, или гетероциклическим кольцом. Примеры гетероциклических колец включают пирролидинил, тетрагидрофуранил, дигидрофуранил, тетрагидротиенил, тетрагидропиранил, дигидропиранил, тетрагидротиопиранил, пиперидино, морфолино, тиоморфолино, тиоксанил, пиперазинил, гомопиперазинил, азетидинил, оксетанил, тиетанил, гомопиперидинил, оксепанил, тиепанил, оксазепинил, диазепинил, тиазепинил, 2-пирролинил, 3-пирролинил, индолинил, 2Н-пиранил, 4Н-пиранил, диоксанил, 1,3-диоксоланил, пиразолинил, дитианил, дитиоланил, дигидропиранил, дигидротиенил, дигидрофуранил, пиразолидинил, имидазолинил, имидазолидинил, 3-азабицикло[3.1.0]гексанил, 3-азабицикло[4.1.0]гептанил и азабицикло[2.2.2]гексанил, но не ограничиваются ими. В рамки данного определения также входят спирогруппы. Примерами гетероциклических групп, где кольцевые атомы замещены оксогруппами (=O), являются пиримидинонил и 1,1-диоксотиоморфолинил.

[53] Термин "гетероарил" относится к одновалентному ароматическому радикалу из 5- или 6-членных колец и включает системы конденсированных колец (по меньшей мере одно из которых является ароматическим) из 5-18 атомов, содержащих один или более гетероатомов, независимо выбранных из азота, кислорода и серы. Примерами гетероарильных групп являются пиридинил (включая, например, 2-гидроксипиридинил), имидазолил, имидазопиридинил, пиримидинил (включая, например, 4-гидроксипиримидинил), пиразолил, триазолил, пиразинил, тетразолил, фурил, тиенил, изоксазолил, тиазолил, оксазолил, изотиазолил, пирролил, хинолинил, изохинолинил, индолил, бензимидазолил, бензофуранил, циннолинил, индазолил, индолизинил, фталазинил, пиридазинил, триазинил, изоиндолил, птеридинил, пуринил, оксадиазолил, триазолил, тиадиазолил, фуразанил, бензофуразанил, бензотиофенил, бензотиазолил, бензоксазолил, хиназолинил, хиноксалинил, нафтиридинил и фуропиридинил.

[54] Гетероциклическая или гетероарильная группы могут, при возможности, присоединяться через атом углерода (углерод-связанная группа) или азота (азот-связанная группа). В качестве неограничивающего примера, гетероциклы или гетероарилы, присоединенные через атом углерода, присоединены по положению 2, 3, 4, 5 или 6 пиридина, положению 3, 4, 5 или 6 пиридазина, положению 2, 4, 5 или 6 пиримидина, положению 2, 3, 5 или 6 пиразина, положению 2, 3, 4 или 5 фурана, тетрагидрофурана, тиофурана, тиофена, пиррола или тетрагидропиррола, положению 2, 4 или 5 оксазола, имидазола или тиазола, положению 3, 4 или 5 изоксазола, пиразола или изотиазола, положению 2 или 3 азиридина, положению 2, 3 или 4 азетидина, положению 2, 3, 4, 5, 6, 7 или 8 хинолина или положению 1, 3,4, 5, 6, 7 или 8 изохинолина.

[55] В качестве неограничивающего примера, гетероциклы или гетероарилы, присоединенные через атом азота, присоединены по положению 1 азиридина, азетидина, пиррола, пирролидина, 2-пирролина, 3-пирролина, имидазола, имидазолидина, 2-имидазолина, 3-имидазолина, пиразола, пиразолина, 2-пиразолина, 3-пиразолина, пиперидина, пиперазина, индола, индолина, 1H-индазола, положению 2 изоиндола или изоиндолина, положению 4 морфолина и положению 9 карбазола или O-карболина.

[56] Гетероатомы, присутствующие в составе гетероарила или гетероциклила, включают окисленные формы, например NO, SO и SO2.

[57] Термин "гало" или "галоген" относится к F, Cl, Br или I.

[58] Алкил, алкенил, алкинил, циклический алкил, циклический алкенил, циклический алкинил, карбоциклил, арил, гетероциклил и гетероарил, описанные выше, могут быть, необязательно, замещены одним или более (например, 2, 3, 4, 5, 6 или более) заместителями.

[59] Если заместитель описан как "замещенный", то вместо атома водорода при атоме углерода, кислорода, серы или азота в составе заместителя присутствует заместитель, не являющийся атомом водорода. Так, например, замещенный алкильный заместитель является алкильным заместителем, где по меньшей мере один заместитель, не являющийся атомом водорода, присутствует вместо атома водорода в составе указанного алкильного заместителя. С целью иллюстрации монофторалкил является алкилом, замещенным фтор-заместителем, а дифторалкил является алкилом, замещенным двумя фтор-заместителями. Следует понимать, что если в составе заместителя присутствует более одной замены, каждый заместитель, не являющийся атомом водорода, может быть одинаковым или отличающимся (если не указано иное).

[60] Если заместитель описан как "необязательно замещенный", указанный заместитель может быть либо (1) не замещен, либо (2) замещен. Если атом углерода заместителя описан как необязательно замещенный одним или несколькими заместителями из списка, один или несколько атомов водорода при атоме углерода (если таковые имеются) по отдельности и/или совместно могут быть замещены независимо выбранным необязательным заместителем. Если атом азота заместителя описан как необязательно замещенный одним или несколькими заместителями из перечня, каждый из одного или нескольких атомов водорода при атоме азота (если таковые имеются) может быть замещен независимо выбранным необязательным заместителем. Один типичный заместитель может быть изображен как -NR'Rʺ, где R' и Rʺ, вместе с атомом азота, к которому они присоединены, могут образовывать гетероциклическое кольцо. Гетероциклическое кольцо, образованное R' и Rʺ вместе с атомом азота, к которому они присоединены, может быть частично или полностью насыщенным. В одном варианте воплощения указанное гетероциклическое кольцо содержит от 3 до 7 атомов. В другом варианте воплощения гетероциклическое кольцо выбрано из группы, состоящей из пирролила, имидазолила, пиразолила, триазолила, тетразолила, изоксазолила, пиридила и тиазолила.

[61] В настоящем описании термины "заместитель", "радикал" и "группа" используются взаимозаменяемо.

[62] Если группа заместителей совместно описана как необязательно замещенная одним или более заместителей из перечня, указанная группа может включать: (1) незамещаемые заместители, (2) замещаемые заместители, не замещенные необязательными заместителями, и/или (3) замещаемые заместители, замещенные одним или более необязательных заместителей.

[63] Если заместитель описан как необязательно замещенный определенным количеством заместителей, которые не являются водородом, то заместители могут быть либо (1) незамещенными; либо (2) замещенными указанным определенным количеством заместителей, не являющихся атомами водорода, или по максимальному количеству замещаемых положений в составе заместителя, в зависимости от того, какое значение из указанных является меньшим. Так, например, если заместитель описан как гетероарил, необязательно замещенный до 3 заместителями, не являющимися атомами водорода, то любой гетероарил с менее чем 3 замещаемыми положениями может, необязательно, быть замещенным лишь до такого количества заместителями, не являющимися атомами водорода, сколько замещаемых положений содержит указанный гетероарил. Такие заместители в неограничивающих примерах могут быть выбраны из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, арила, гетероарила, гетероциклила, галогена, гуанидиния [-NH(C=NH)NH2], -OR100, NR101R102, -NO2, -NR101COR102, -SR100, сульфоксида, представленного -SOR101, сульфона, представленного -SO2R101, сульфоната -SO3M, сульфата -OSO3M, сульфонамида, представленного -SO2NR101R102, цианогруппы, азидной группы, -COR101, -OCOR101, -OCONR101R102 и мономера полиэтиленгликоля (-OCH2CH2)nR101, где М является Н или фармацевтически приемлемым катионом (например, Na+ или K+); каждая из R101, R102 и R103, независимо, выбраны из Н, линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля (-OCH2CH2)n-R104, где n является целым числом от 1 до 24, арила, имеющего от 6 до 10 атомов углерода, гетероциклического кольца, имеющего от 3 до 10 атомов углерода, и гетероарила, имеющего от 5 до 10 атомов углерода; а R104 является Н или линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, где алкил, алкенил, алкинил, арил, гетероарил и гетероциклил в группах, представленных R100, R101, R102, R103 и R104, необязательно замещены одним или более (например, 2, 3, 4, 5, 6 или более) заместителей, независимо выбранных из галогена, -ОН, -CN, -NO2 и незамещенного линейного или разветвленного алкила, имеющего от 1 до 4 атомов углерода. Предпочтительно заместители необязательно замещенного алкила, алкенила, алкинила, циклического алкила, циклического алкенила, циклического алкинила, карбоциклила, арила, гетероциклила и гетероарила, описанных выше, включают галоген, -CN, -NR102R103, -CF3, -OR101, арил, гетероарил, гетероциклил, -SR101, -SOR101, -SO2R101 и -SO3M.

[64] Термины "соединение" или "цитотоксическое соединение", "цитотоксический димер" и "цитотоксическое димерное соединение" используется на равных основаниях. Подразумевается, что они включают соединения, для которых в настоящем изобретении описана структура или формула, или любое биологически активное производное, или их структура или формула, или любое производное включены посредством ссылки. Указанный термин также включает стереоизомеры, геометрические изомеры, таутомеры, сольваты, метаболиты, соли (например, фармацевтически приемлемые соли) и пролекарства, и соли пролекарств соединений всех формул, описанных в настоящем изобретении. Указанный термин также включает любые сольваты, гидраты и полиморфы любого из вышеуказанного. Конкретное перечисление "стереоизомеров", "геометрических изомеров", "таутомеров", "сольватов", "метаболитов", "соли", "пролекарства", "соли пролекарства", "конъюгатов", "солей конъюгатов", "сольвата", "гидрата" или "полиморфа" в некоторых аспектах изобретения, описанного в настоящей заявке, не должно толковаться как предполагаемое отсутствие указанных форм в других аспектах изобретения, где термин "соединение" используют без перечисления указанных других форм. В одном варианте воплощения цитотоксическое соединение включает связывающую группу или связывающую группу с присоединенной к ней реакционно-способной группой. В качестве альтернативы цитотоксическое соединение не содержит связывающей группы или связывающей группы с присоединенной к ней реакционно-способной группой.

[65] Термин "конъюгат", как используется здесь, относится к соединению, описанному здесь, или его производному, присоединенному к агенту, связывающемуся с клетками.

[66] Термин "связываемый с агентом, связывающимся с клеткой", как используется здесь, относится к соединениям, описанным здесь, или их производным, включающим по меньшей мере одну связывающую группу или ее предшественник, пригодные для связывания этих соединений или их производных с агентом, связывающимся с клетками.

[67] Термин "предшественник" данной группы относится к любой группе, которая может привести к получению указанной группы за счет деблокирования, химической модификации или реакции присоединения.

[68] Термин "присоединенный к агенту, связывающемуся с клетками" относится к молекуле конъюгата, включающей по меньшей мере одно из соединений, описанных здесь (например, соединений и соединений лекарственное вещество-линкер, описанных здесь), или его производное, связанное с агентом, связывающимся с клетками, посредством соответствующей связывающей группы или ее предшественника.

[69] Термин "хиральный" относится к молекулам, обладающим свойством не совпадать при наложении со своим зеркальным отображением, в то время как термин "ахиральный" относится к молекулам, которые при наложении совпадают со своим зеркальным отображением.

[70] Термин "стереоизомер" относится к соединениям, характеризующимся одинаковым химическим составом и внутримолекулярными связями, но различными типами ориентации атомов в пространстве, которые не могут взаимопревращаться путем поворота вокруг одинарных связей.

[71] "Диастереомеры" относится к стереоизомерам с двумя или более центров хиральности, молекулы которых не являются зеркальными отображениями друг друга. Диастереоизомеры имеют различные физические свойства, например температуры плавления, температуры кипения, спектральные свойства и реакционную способность. Смеси диастереоизомеров можно разделить с помощью аналитических методик с высокой степенью разделения, таких как кристаллизация, электрофорез и хроматография.

[72] "Энантиомеры" относится к двум стереоизомерам соединения, которые являются зеркальными отображениями друг друга, не совпадающими при наложении.

[73] Стереохимические определения и условные обозначения, используемые здесь, в целом соответствуют S.P. Parker, Ed., McGraw-Hill Dictionary of Chemical Terms (1984) McGraw-Hill Book Company, New York; и Eliel, E. and Wilen, S., "Stereochemistry of Organic Compounds," John Wiley & Sons, Inc., New York, 1994. Соединения согласно изобретению могут содержать асимметричные или хиральные центры и, следовательно, существуют в различных стереоизомерных формах. Предполагается, что все стереоизомерные формы соединений согласно изобретению, включая диастереомеры, энантиомеры и атропизомеры, а также их смеси, например рацемические смеси, не ограничиваясь ими, образуют часть настоящего изобретения. Многие органические соединения существуют в виде оптически активных форм, т.е. обладают способностью вращать плоскость плоскополяризованного света. При описании оптически активных соединений для обозначения абсолютной конфигурации молекулы относительно ее хирального(ых) центра(ов) используют префиксы d и I или R и S. Префиксы d и I или (+) и (-) используют для обозначения знака поворота плоскополяризованного света соединением, при этом префиксы (-) или 1 означают, что соединение является левовращающим. Соединение с префиксом (+) или d является правовращающим. Для данной химической структуры эти стереоизомеры являются одинаковыми, за исключением того, что они представляют собой зеркальные отражения друг друга. Конкретный стереоизомер также можно рассматривать в качестве энантиомера, при этом смесь таких изомеров часто называют энантиомерной смесью. Смесь энантиомеров 50:50 называют рацемической смесью или рацематом; указанная смесь может образовываться в случае, если в химической реакции или процессе отсутствуют стереоизбирательность или стереоспецифичность. Термины "рацемическая смесь" и "рацемат" относятся к эквимолярной смеси двух типов энантиомеров, не обладающей оптической активностью.

[74] Термин "таутомер" или "таутомерная форма" относится к структурным изомерам с различной энергией, взаимопревращающимся при переходе низкоэнергетического барьера. Например, протонные таутомеры (также известные как прототропные таутомеры) включают взаимопревращение посредством миграции протона, например, при кето-енольной и имин-енаминной изомеризации. Валентные таутомеры включают взаимопревращения путем реорганизации некоторых электронных связей.

[75] Термин "пролекарство", как используется в настоящей заявке, относится к предшественнику или производному соединения по изобретению, которое способно ферментативно или гидролитически активироваться или превращаться в более активную исходную форму. См., например, Wilman, "Prodrugs in Cancer Chemotherapy" Biochemical Society Transactions, 14, pp.375-382, 615th Meeting Belfast (1986) и Stella et al., "Prodrugs: A Chemical Approach to Targeted Drug Delivery," Directed Drug Delivery, Borchardt et al., (ed.), pp.247-267, Humana Press (1985). Пролекарства по настоящему изобретению включают сложноэфирные пролекарства, фосфат-содержащие пролекарства, тиофосфат-содержащие пролекарства, сульфат-содержащие пролекарства, пептид-содержащие пролекарства, пролекарства, модифицированные D-аминокислотами, гликозилированные пролекарства, β-лактам-содержащие пролекарства, пролекарства, содержащие необязательно замещенный феноксиацетамид, пролекарства, содержащие необязательно замещенный фенилацетамид, 5-фторцитозиновые и другие 5-фторуридиновые пролекарства, которые можно преобразовать в более активные цитотоксические свободные лекарственные вещества, но не ограничиваются ими. Примеры цитотоксических лекарственных веществ, которые можно преобразовать в форму пролекарства для использования в настоящем изобретении, включают соединения по изобретению и химиотерапевтические агенты, например, описанные выше, но не ограничиваются ими.

[76] Кроме того, подразумевают, что термин "пролекарство" включает производное соединения, способное подвергаться гидролизу, окислению или иным образом вступать в реакцию в биологических условиях (in vitro или in vivo) с получением соединения по настоящему изобретению. Пролекарства могут быть активным только после такой реакции в биологических условиях или могут обладать активностью в непрореагировавшей форме. Примеры пролекарств, рассматриваемые в настоящем изобретении, включают аналоги или производные соединений любой из формул, описанных здесь, включающие биогидролизуемые молекулы, например биогидролизуемые амидные, биогидролизуемые сложноэфирные, биогидролизуемые карбаматные, биогидролизуемые карбонатные, биогидролизуемые уреидные, а также биогидролизуемые фосфатные аналоги, но не ограничиваются ими. Другие примеры пролекарств включают производные соединений любой из формул, описанных здесь, включающие -NO, -NO2, -ONO или -ONO2-группы. Пролекарства обычно можно получить, используя широко известные способы, например способы, описанные в Burger's Medicinal Chemistry and Drug Discovery (1995) 172-178, 949-982 (Manfred E. Wolff ed., 5th ed); см. также Goodman and Oilman's, The Pharmacological basis of Therapeutics, 8th ed., McGraw-Hill, Int. Ed. 1992, "Biotransformation of Drugs".

[77] Одна предпочтительная форма Пролекарства по изобретению включает соединения (с или без линкерных групп) и конъюгаты по изобретению, содержащие аддукт, образованный между иминной связью соединений/конъюгатов и реагентом, способным взаимодействовать с иминами.

[78] Термин "реагент, способный взаимодействовать с иминами" относится к реагенту, способному взаимодействовать с иминогруппой. Примеры реагентов, способных взаимодействовать с иминами, включают сульфиты (H2SO3, H2SO2 или соль HSO3-, SO32- или HSO2-, образованную катионом), метабисульфит (H2S2O5 или соль S2O52-, образованную катионом), моно-, ди-, три- и тетратиофосфаты (PO3SH3, PO2S2H3, POS3H3, PS4H3 или соль PO3S3-, PO2S23-, POS33- или PS43-, образованную катионом), сложные эфиры тиофосфата ((RiO)2PS(ORi), RiSH, RiSOH, RiSO2H, RiSO3H), различные амины (гидроксиламин (например, NH2OH), гидразин (например, NH2NH2), NH2O-Ri, Ri'NH-Ri, NH2-Ri), NH2-CO-NH2, NH2-C(=S)-NH2', тиосульфат (H2S2O3 или соль S2O32-, образованную катионом), дитионит (H2S2O4 или соль S2O42-, образованную катионом), фосфородитиоат (Р(=S)(ORk)(SH)(ОН) или его соль, образованную катионом), гидроксамовую кислоту (RkC(=O)NHOH или соль, образованную катионом), гидразид (RkCONHNH2), формальдегидсульфоксилат (HOCH2SO2H или соль HOCH2SO2-, образованную катионом, например HOCH2SO2-Na+), гликозилированный нуклеотид (например, GDP-маннозу), флударабин или их смесь, где Ri и Ri', независимо, являются линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещены по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и РО3Н; Ri и Ri', необязательно, могут быть дополнительно замещены заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; a Rk является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом (предпочтительно Rk является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода; более предпочтительно Rk является метилом, этилом или пропилом), но не ограничиваются ими. Предпочтительно катион является одновалентным катионом, например Na+ или K+. Предпочтительно реагент, способный взаимодействовать с иминами, выбирают из сульфитов, гидроксиламина, мочевины и гидразина. Более предпочтительно реагент, способный взаимодействовать с иминами, является NaHSO3 или KHSO3.

[79] Как используется здесь, если не указано иное, термины "биогидролизуемый амидный", "биогидролизуемый сложноэфирный", "биогидролизуемый карбаматный", "биогидролизуемый карбонатный", "биогидролизуемый уреидный" и "биогидролизуемый фосфатный аналог" означает амидный, сложноэфирный, карбаматный, карбонатный, уреидный или фосфатный аналог, соответственно, который либо: 1) не нарушает биологическую активность соединения и придает указанному соединению выгодные свойства in vivo, например поглощение, продолжительность действия или начало действия, либо 2) сам по себе является биологически неактивным, но преобразуется in vivo в биологически активное соединение. Примеры биогидролизуемых амидов включают амиды низших алкилов, амиды α-аминокислот, алкоксиациламиды и алкиламиноалкилкарбониламиды, но не ограничиваются ими. Примеры биогидролизуемых сложных эфиров включают сложные эфиры низших алкилов, алкоксиацилоксиэфиры, алкилациламиноалкиловые сложные эфиры и сложные эфиры холина, но не ограничиваются ими. Примеры биогидролизуемых карбаматов включают низшие алкиламины, замещенные этилендиамины, аминокислоты, гидроксиалкиламины, гетероциклические и гетероароматические амины и полиэфирные амины, но не ограничиваются ими. Особенно предпочтительными пролекарствами и солями пролекарств являются пролекарства, повышающие биодоступность соединений по изобретению при введении таких соединений в организм млекопитающего.

[80] Фраза "фармацевтически приемлемая соль", как используется здесь, относится к фармацевтически приемлемым органическим или неорганическим солям соединения по настоящему изобретению. Типичные соли включают сульфат, цитрат, ацетат, оксалат, хлорид, бромид, иодид, нитрат, бисульфат, фосфат, кислый фосфат, изоникотинат, лактат, салицилат, кислый цитрат, тартрат, олеат, таннат, пантотенат, битартрат, аскорбат, сукцинат, малеат, гентизинат, фумарат, глюконат, глюкуронат, сахарат, формиат, бензоат, глутамат, метансульфонат "мезилат", этансульфонат, бензолсульфонат, п-толуолсульфонат, памоат (т.е. 1,1'-метилен-бис-(2-гидрокси-3-нафтоат)), соли щелочных металлов (например, натрия и калия), соли щелочноземельных металлов (например, магния) и соли аммония, но не ограничиваются ими. Фармацевтически приемлемые соли могут содержать включение другой молекулы, например, ацетат-иона, сукцинат-иона или другого противоиона. Противоион может являться любой органической или неорганической группой, стабилизирующей заряд исходного соединения. Кроме того, фармацевтически приемлемая соль может иметь более одного заряженного атома в своей структуре. В случае, когда несколько заряженных атомов являются частью фармацевтически приемлемой соли, она может содержать несколько противоионов. Таким образом, фармацевтически приемлемая соль может иметь один или более заряженных атомов и/или один или более противоионов.

[81] Если соединение по изобретению является основанием, желательную фармацевтически приемлемую соль можно получить любым подходящим способом, доступным в данной области техники, например обработкой свободного основания неорганической кислотой, например соляной кислотой, бромистоводородной кислотой, серной кислотой, азотной кислотой, метансульфоновой кислотой, фосфорной кислотой и т.п., или органической кислотой, например уксусной кислотой, малеиновой кислотой, янтарной кислотой, миндальной кислотой, фумаровой кислотой, малоновой кислотой, пировиноградной кислотой, щавелевой кислотой, гликолевой кислотой, салициловой кислотой, пиранозидной кислотой, например глюкуроновой кислотой или галактуроновой кислотой, альфа-гидроксикислотой, например лимонной кислотой или винной кислотой, аминокислотой, например аспарагиновой кислотой или глутаминовой кислотой, ароматической кислотой, например бензойной кислотой или коричной кислотой, сульфоновой кислотой, например п-толуолсульфоновой кислотой или этансульфоновой кислотой и т.п.

[82] Если соединение по изобретению является кислотой, желательную фармацевтически приемлемую соль можно получить любым подходящим способом, например обработкой свободной кислоты неорганическим или органическим основанием, например амином (первичным, вторичным или третичным), гидроксидом щелочного металла или гидроксидом щелочноземельного металла и т.п. Иллюстративные примеры подходящих солей включают органические соли, являющиеся производными аминокислот, например глицина и аргинина, аммиака, первичных, вторичных и третичных аминов и циклических аминов, например пиперидина, морфолина и пиперазина, и неорганические соли, являющиеся производными натрия, кальция, калия, магния, марганца, железа, меди, цинка, алюминия и лития, но не ограничиваются ими.

[83] Как используется здесь, термин "сольват" означает соединение, дополнительно включающее в стехиометрических или нестехиометрических количествах растворитель, например воду, изопропанол, ацетон, этанол, метанол, ДМСО, этилацетат, уксусную кислоту и этаноламин, дихлорметан, 2-пропанол и т.п., связанный за счет нековалентных межмолекулярных сил. Сольваты или гидраты соединений легко получить путем добавления по меньшей мере одного молярного эквивалента гидроксильного растворителя, например метанола, этанола, 1-пропанола, 2-пропанола или воды к соединению, что приводит к сольватированию или гидратированию иминогруппы.

[84] "Метаболит" является продуктом, полученным за счет метаболизма указанного соединения, его производного или его конъюгата, или его соли в организме. Метаболиты соединения, его производного или его конъюгата можно идентифицировать с помощью обычных методик, известных в данной области техники, и определить их активность с помощью тестов, например, описанных здесь. Такие продукты могут образовываться, например, в результате окисления, гидроксилирования, восстановления, гидролиза, амидирования, дезамидирования, этерификации, деэтерификации, ферментативного расщепления и т.п. введенного соединения. Соответственно, настоящее изобретение включает метаболиты соединений, их производных или их конъюгата по изобретению, включая соединения, их производные или их конъюгаты, полученные способом, включающим осуществление контакта соединения, его производного или его конъюгата по настоящему изобретению, с млекопитающим в течение времени, достаточного для получения его метаболического продукта.

[85] Фраза "фармацевтически приемлемый" означает, что вещество или композиция должны быть совместимы химически и/или токсикологически с другими ингредиентами, содержащимися в составе, и/или млекопитающим, подвергаемым лечению с использованием вещества или композиции.

[86] Термин "защитная группа" или "блокирующая группа" относится к заместителю, обычно используемому для блокирования или защиты определенной функциональной группы при взаимодействии других функциональных групп с соединением, его производным или его конъюгатом. Например, "аминозащитная группа" или "аминоблокирующая группа" является заместителем, присоединенным к аминогруппе, который блокирует или защищает функциональную аминогруппу в соединении. Такие группы хорошо известны в данной области техники (см., например, Р. Wuts and Т. Greene, 2007, Protective Groups in Organic Synthesis, Chapter 7, J. Wiley & Sons, NJ) и представлены карбаматами, например метил- и этилкарбаматом, FMOC, замещенными этилкарбаматами, карбаматами, расщепляемыми посредством 1,6-β-элиминирования (также называемые "жертвующими собой"), производными мочевины, амидами, пептидами, алкильными и арильными производными. Подходящие аминоблокирующие группы включают ацетил, трифторацетил, трет-бутоксикарбонил (ВОС), бензилоксикарбонил (CBZ) и 9-флуоренилметиленоксикарбонил (Fmoc). Общее описание защитных групп и их использования см. в Р. G.M. Wuts & Т.W. Greene, Protective Groups in Organic Synthesis, John Wiley & Sons, New York, 2007.

[87] Термин "уходящая группа" относится к заряженной или незаряженной группе, отсоединяющейся во время замены или замещения. Такие уходящие группы хорошо известны в данной области техники и включают галогены, сложные эфиры, алкокси, гидроксил, тозилаты, трифлаты, мезилаты, нитрилы, азид, карбамат, дисульфиды, сложные тиоэфиры, простые тиоэфиры и соединения диазония, но не ограничиваются ими.

[88] Термин "бифункциональный сшивающий агент", "бифункциональный линкер" или "сшивающий агент" относится к модифицирующим агентам, обладающим двумя реакционно-способными группами, соединенными со "связывающей группой", одна из которых способна взаимодействовать с агентом, связывающимся с клетками, а другая реагирует с цитотоксическим соединением, чтобы присоединить указанные две молекулы друг к другу. Такие бифункциональные сшивающие агенты хорошо известны в данной области техники (см., например, Isalm and Dent in Bioconjugation chapter 5, p218-363, Groves Dictionaries Inc. New York, 1999). Например, бифункциональные сшивающие агенты, обеспечивающие присоединение посредством тиоэфирной связи, включают N-сукцинимидил-4-(Н-малеимидметил)-циклогексан-1-карбоксилат (SMCC) для внедрения малеимидогрупп, либо N-сукцинимидил-4-(иодацетил)-аминобензоат (SIAB) для внедрения иодацетильных групп. Другие бифункциональные сшивающие агенты, внедряющие малеимидные группы или галоацетильные группы в агент, связывающийся с клетками, хорошо известны в данной области техники (см. заявки на патент США 2008/0050310, 20050169933, доступные в Pierce Biotechnology Inc., п/я 117, Рокленд, штат Иллинойс 61105, США) и включают бис-малеимидполиэтиленгликоль (ВМРЕО), ВМ(РЕО)2, ВМ(РЕО)3, N-(β-малеимидпропилокси)сукцинимидный эфир (BMPS), N-сукцинимидильный эфир γ-малеимидмасляной кислоты (GMBS), N-гидроксисукцинимидный эфир ε-малеимидокапроновой кислоты (EMCS), NHS 5-малеимидвалериановой кислоты, HBVS, Н-сукцинимидил-4-(N-малеимидметил)-циклогексан-1-карбокси-(6-амидокапроат), являющийся "длинноцепочечным" аналогом SMCC (LC-SMCC), м-малеимидбензоил-N-гидроксисукцинимидный эфир (MBS), гидразид или соль HCl и 4-(4-Н-малеимидфенил)-масляной кислоты (МРВН), N-сукцинимидил-3-(бромацетамидо)пропионат (SBAP), N-сукцинимидилиодацетат (SIA), N-сукцинимидильный эфир κ-малеимидундекановой кислоты (KMUA), N-сукцинимидил-4-(п-малеимидфенил)-бутират (SMPB), сукцинимидил-6-(β-малеимидпропионамидо)гексаноат (SMPH), сукцинимидил-(4-винилсульфонил)бензоат (SVSB), дитиобис-малеимидэтан (DTME), 1,4-бис-малеимидбутан (ВМВ), 1,4-бис-малеимидил-2,3-дигидроксибутан (BMDB), бис-малеимидгексан (ВМН), бис-малеимидэтан (ВМОЕ), сульфосукцинимидил-4-(N-малеимидметил)циклогексан-1-карбоксилат (сульфо-SMCC), сульфосукцинимидил(4-иодацетил)аминобензоат (сульфо-SIAB), м-малеимидбензоил-N-гидроксисульфосукцинимидный эфир (сульфо-MBS), N-(γ-малеимидобутирилокси)сульфосукцинимидный эфир (сульфо-GMBS), N-(ε-малеимидкапроилокси)сульфосукцинимидный эфир (сульфо-EMCS), N-(κ-малеимидундеканоилокси)сульфосукцинимидный эфир (сульфо-KMUS) и сульфосукцинимидил-4-(п-малеимидофенил)бутират (сульфо-SMPB), но не ограничиваются ими.

[89] Гетеробифункциональные сшивающие агенты являются бифункциональными сшивающими агентами, имеющими две различные реакционно-способные группы. Гетеробифункциональные сшивающие агенты, содержащие N-гидроксисукцинимидную группу (NHS-группу), способную взаимодействовать с аминогруппами, и гидразиновую группу, способную взаимодействовать с карбонильными группами, также можно использовать для соединения цитотоксических соединений, описанных здесь, с агентом, связывающимся с клетками (например, антитела). Примеры таких коммерчески доступных гетеробифункциональных сшивающих агентов включают гидразон сукцинимидил-6-гидразинникотинамида ацетона (SANH), гидрохлорид сукцинимидил-4-гидразидтерефталата (SHTH) и гидрохлорид сукцинимидилгидразинийникотината (SHNH). Конъюгаты, несущие кислотно-лабильную связь, также можно получить с использованием гидразин-несущего производного бензодиазепина согласно настоящему изобретению. Примеры бифункциональных сшивающих агентов, которые можно использовать, включают сукцинимидил-п-формилбензоат (SFB) и сукцинимидил-п-формилфеноксиацетат (SFPA).

[90] Бифункциональные сшивающие агенты, обеспечивающие присоединение агента, связывающегося с клетками, с цитотоксическими соединениями посредством дисульфидных связей, включают N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноат, а также другие агенты, известные в данной области техники, включающие N-сукцинимидил-3-(2-пиридилдитио)пропионат (SPDP), N-сукцинимидил-4-(2-пиридилдитио)пентаноат (SPP), N-сукцинимидил-4-(2-пиридилдитио)бутаноат (SPDB), N-сукцинимидил-4-(2-пиридилдитио)-2-сульфобутаноат (сульфо-SPDB), для внедрения дитиопиридильных групп. Другие бифункциональные сшивающие агенты, которые можно использовать для внедрения дисульфидных групп, известны в данной области техники и описаны в патентах США 6913748, 6716821 и публикациях патентов США 20090274713 и 20100129314, все из которых включены в настоящее описание посредством ссылки. В альтернативном случае также можно использовать сшивающие агенты, например 2-иминотиолан, гомоцистеинтиолактон или S-ацетилянтарный ангидрид, внедряющие тиоловые группы.

[91] "Линкер", "линкерная группа" или "связывающая группа", как определено здесь, относится к группе, соединяющей две группы, например агент, связывающий клетки, и цитотоксическое соединение друг с другом. Бифункциональный сшивающий агент может включать две реакционно-способные группы, по одной на каждом из концов линкерной группы, такой, что одна реакционно-способная группа может вначале взаимодействовать с цитотоксическим соединением, обеспечивая соединение, несущее линкер и вторую реакционно-способную группу, которая затем может взаимодействовать с агентом, связывающимся с клетками. В альтернативном случае один конец бифункционального сшивающего агента может вначале взаимодействовать с агентом, связывающимся с клетками, несущим линкерную группу и вторую реакционно-способную группу, которая затем может взаимодействовать с цитотоксическим соединением, Связывающая группа может содержать химическую связь, обеспечивающую высвобождение цитотоксической группы, в конкретном положении. Подходящие химические связи хорошо известны в данной области техники и включают дисульфидные связи, тиоэфирные связи, кислотолабильные связи, фотолабильные связи, пептидазолабильные связи и эстеразолабильные связи (см., например, патенты СИТА 5208020, 5475092, 6441163, 6716821, 6913748, 7276497, 7276499, 7368565, 7388026 и 7414073). Предпочтительными являются дисульфидные связи, тиоэфирные и пептидазолабильные связи. Другие линкеры, которые можно использовать в настоящем изобретении, включают нерасщепляемые линкеры, например, подробно описанные в публикации патента США номер 20050169933, или заряженные линкеры, или гидрофильные линкеры, и описаны в US 2009/0274713, US 2010/01293140 и WO 2009/134976, каждый из которых специально включен в настоящий документ посредством ссылки.

[92] В одном варианте воплощения связывающая группа с реакционно-способной группой, присоединенной к одному концу, такой как реакционно-способный сложный эфир, выбрана из следующего "Списка I":






























m, n, p, q, m', n', t' являются целыми числами от 1 до 10, или, необязательно, равны 0;

t, mʺ, nʺ и pʺ равны 0 или 1;

Xʺ выбран из OR36, SR37, HR38R39, где R36, R37, R38, R39 являются Н или линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 20 атомов углерода, и/или мономером полиэтиленгликоля -(ОСН2СН2)n, R37, необязательно, является тиол-блокирующей группой, если t=1, СОХʺ образует реакционно-способный сложный эфир, выбранный из N-гидроксисукцинимидных эфиров, N-гидроксифталимидных эфиров, N-гидроксисульфосукцинимидных эфиров, пара-нитрофениловых эфиров, динитрофениловых эфиров, пентафторфениловых эфиров и их производных, причем указанные производные облегчают образование амидной связи;

Yʺ отсутствует или выбрана из О, S, S-S или NR32, где R32 соответствует определению, приведенному выше для R, либо,

если Yʺ не является S-S и t=O, Xʺ выбран из малеимидогруппы, галоацетильной группы или SR37, где R37 соответствует вышеприведенному определению;

Аʺ является аминокислотой, выбранной из глицина, аланина, лейцина, валина, лизина, цитруллина и глутамата, или полипептидом, содержащим от 2 до 20 аминокислот;

R20, R21, R22, R23, R24, R25, R26 и R27 являются одинаковыми или различными и являются Н или линейным или разветвленным алкилом, имеющим от 1 до 5 атомов углерода;

R29 и R30 являются одинаковыми или различными и являются Н или алкилом, содержащим от 1 до 5 атомов углерода;

R33 является Н или линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 12 атомов углерода, мономером полиэтиленгликоля -(ОСН2СН2)n, либо R33 является -COR34, -CSR34, -SOR34, или -SO2R34, где R34 является Н или линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 20 атомов углерода, или мономером полиэтиленгликоля -(OCH2H2)n; и

одна из R40 и R41 является, необязательно, отрицательно или положительно заряженной функциональной группой, а другая является Н или алкилом, алкенилом, алкинилом, имеющим от 1 до 4 атомов углерода.

[93] Термин "аминокислота" относится к природной аминокислоте или неприродной аминокислоте, представленной NH2-C(Raa'Raa)-C(=O)OH, где каждая из Raa и Raa', независимо, является Н, необязательно замещенным линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероарилом или гетероциклилом. Термин "аминокислота" также относится к соответствующему остатку, когда с N- и/или С-конца аминокислоты удален один атом водорода, например -NH-C(Raa'Raa)-C(=O)-.

[94] Термин "катион" относится к иону с положительным зарядом. Катион может быть одновалентным (например, Na+, K+ и т.д.), двухвалентным (например, Са2+ Mg2+ и т.д.) или поливалентным (например, Al3+ и т.д.). Предпочтительно катион является одновалентным.

[95] Термин "терапевтически эффективное количество" означает количество активного соединения или конъюгата, вызывающее желательную биологическую реакцию у субъекта. Такая реакция включает облегчение симптомов заболевания или расстройства, подлежащего лечению, предотвращение, ингибирование или задержку рецидива симптома заболевания или самого заболевания, увеличение продолжительности жизни субъекта по сравнению с отсутствием лечения или предотвращение, ингибирование или задержку прогрессирования симптома заболевания или самого заболевания. Определение эффективного количества находится в пределах возможностей специалистов в данной области техники, особенно в свете приведенного здесь подробного описания. Токсичность и терапевтическую эффективность соединения I можно определить с помощью стандартных фармацевтических процедур в культурах клеток и на экспериментальных животных. Эффективное количество соединения или конъюгата по настоящему изобретению или другого терапевтического агента, подлежащего введению субъекту, зависит от стадии, категории и состояния множественной миеломы и характеристик субъекта, например общего состояния здоровья, возраста, пола, массы тела и переносимости лекарств. Эффективное количество соединения или конъюгата по настоящему изобретению или другого терапевтического агента, подлежащего введению, также зависит от пути введения и дозированной лекарственной формы. Количество и интервал дозировки можно регулировать индивидуально, обеспечивая уровни активного соединения в плазме, достаточные для поддержания желательного терапевтического эффекта.

[96] Термин "группа, способная взаимодействовать с тиолами" относится к функциональной группе, взаимодействующей с тиоловой группой. Примеры групп, способных взаимодействовать с тиолами, включают малеимидо, винилпиридин, винилсульфон, винилсульфонамид, группу на основе галоацетила (например, галоацетамидо) или дисульфид (например, -SSRd, где Rd является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, фенилом, нитрофенилом, динитрофенилом, карбоксинитрофенилом, пиридилом, 2-нитропиридилом, 4-нитропиридилом или 3-карбокси-4-нитропиридилом), но не ограничиваются ими.

[97] Термин "реакционно-способный сложный эфир" относится к сложному эфиру, содержащему уходящую группу, легко вытесняемую аминогруппой или гидроксильной группой. Примеры реакционно-способных сложных эфиров включают N-гидроксисукцинимидный эфир, N-гидроксисульфосукцинимидный эфир, нитрофениловый эфир, динитрофениловый эфир, тетрафторфениловый эфир, сульфотетрафторфениловый эфир и пентафторфениловый эфир. Предпочтительно реакционно-способный сложный эфир является N-гидроксисукцинимидным (NHS) эфиром.

[98] Термин "имин-содержащее лекарственное вещество" или "имин-содержащее цитотоксическое соединение" относится к соединению, описанному здесь (без линкерной группы), содержащему по меньшей мере одну иминную функциональную группу. Предпочтительно имин-содержащее лекарственное вещество содержит одну иминную функциональную группу.

Способы по настоящему изобретению

[99] В первом аспекте настоящее изобретение относится к способу получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие цитотоксического соединения с модифицированным СВА при рН приблизительно от 4 до 9, причем:

а) модифицированный СВА включает остаток бифункционального сшивающего агента, связанного с СВА, а указанный остаток включает связывающую группу и группу, способную взаимодействовать с тиолом; и б) цитотоксическое соединение включает тиоловую группу и группу, представленную следующей структурой:


Y является уходящей группой и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Rj, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rk' является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; R1' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом.

[100] В некоторых вариантах воплощения цитотоксическое соединение получают взаимодействием имин-содержащего цитотоксического соединения, несущего тиоловую группу, с реагентом, способным взаимодействовать с иминами.

[101] В некоторых вариантах воплощения способ может дополнительно включать очистку цитотоксического соединения до взаимодействия с модифицированным СВА.

[102] В некоторых вариантах воплощения

(1) имин-содержащее цитотоксическое соединение представлено одной из следующих формул или ее фармацевтически приемлемой солью:

(2) цитотоксическое соединение представлено одной из следующих формул или ее фармацевтически приемлемой солью:

(3) цитотоксическое соединение и фрагмент связывающей группы конъюгата представлены одной из следующих формул:


X' выбрана из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(СН2СН2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Y' выбрана из -Н, оксогруппы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов;

Rc является -Н или замещенным, или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-Rc, галогена, гуанидиния [-NH(ONH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+ сульфата -OSO3-M+, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

каждая из R' и Rʺ, независимо, выбрана из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

n является целым числом от 1 до 24;

W выбрана из С=O, C=S, CH2, ВН, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2 или галогеном;

Z и Z', независимо, выбраны из -(CH2)n'-, -(CH2)n'-CR7R8-(CH2)na'-, -(CH2)n'-NR9-(CH2)na'-, -(CH2)n'-O-(CH2)na'- и -(CH2)n'-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0,1, 2 и 3;

R7 и R8 являются одинаковыми или различными, и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-;

А и А' являются одинаковыми или различными и, независимо, выбраны из -O-, оксо (-С(=O)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- и -CRR'N(R5)-,

R5, в каждом случае независимо, является -Н или необязательно замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и, независимо, отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-ОСН2СН2)n-;

L отсутствует или, если присутствует, включает тиоловую группу и является мономером полиэтиленгликоля (-ОСН2СН2)n-, линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил, алкенил, фенил или гетероциклическое или гетероарильное кольцо является, необязательно, замещенным;

где по меньшей мере одна из X', Y', R6, Rc, R1, R2, R3, R4, R1', R2', R3', R4', L (например, посредством необязательно замещенной группы) присоединена к связывающей группе в формулах (Ib') или (IIb').

[103] В некоторых вариантах воплощения модифицированный СВА получают взаимодействием СВА с бифункциональным сшивающим агентом, причем указанный бифункциональный сшивающий агент содержит группу, способную взаимодействовать с тиолами, и группу, способную взаимодействовать с СВА, оба, присоединенные к связывающей группе.

[104] В некоторых вариантах воплощения группа, способная взаимодействовать с СВА, реагирует с аминогруппой СВА (например, аминогруппой боковой цепи Lys) или с тиоловой группой СВА (например, тиоловой группой боковой цепи Cys).

[105] В некоторых вариантах воплощения группа, способная взаимодействовать с тиолами, выбрана из группы, состоящей из малеимидо, винилпиридина, винилсульфона, винилсульфонамида, группы на основе галоацетила и дисульфидной группы.

[106] В качестве альтернативы группа, способная взаимодействовать с тиолами, может являться малеимидо, галоацетамидо или -SSRd, где Rd является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, фенилом, нитрофенилом, динитрофенилом, карбоксинитрофенилом, пиридилом, 2-нитропиридилом, 4-нитропиридилом или 3-карбокси-4-нитропиридилом.

[107] В некоторых вариантах воплощения модифицированный СВА является:


[108] Типичная схема реакции показана на Фиг.8, где на "первом этапе" реагент, способный взаимодействовать с иминами (показан на схеме реакции в виде нуклеофила (Nuc:)), добавляют к лекарственному веществу, содержащему тиол, и обеспечивают взаимодействие и образование модифицированного лекарственного вещества, несущего тиоловую группу. Модифицированное лекарственное вещество, необязательно, очищают с целью удаления избытка реагента, способного взаимодействовать с иминами. На "втором этапе" антитело модифицируют линкером, содержащим группу X, способную взаимодействовать с тиолами (малеимид, SSPy, винилсульфон и т.д.), и подвергают взаимодействию с модифицированным лекарственным веществом, несущим тиоловую группу, при рН 6-9, получая стабильную дисульфидную или тиоэфирную связь между лекарственным веществом и антителом. На "третьем этапе" удаляют побочные продукты (например, избыток реагента, способного взаимодействовать с иминами, модифицированного лекарственного вещества, не прореагировавшего с антителом, и т.д.) и формируют состав на основе конъюгата. Количество молекул лекарственного вещества, конъюгированных с антителом, равно n и может составлять, например, 1-10.

[109] Типичный пример способа двухэтапного конъюгирования описан на Фиг.16, где антитело вначале модифицируют бифункциональным сшивающим агентом, получая антитело, имеющее желательное количество линкеров, пригодных для взаимодействия с димерным соединением, имеющим свободную тиоловую группу. В указанном примере антитело huMy9-6 вначале модифицировали SPDB, получая антитело с линкерами, содержащими дитиопиридиловую группу. Затем модифицированное антитело подвергали воздействию свободного тиола, например, 2а, получая требуемый конъюгат huMy9-6-SPDB-2a. Дополнительные подходящие линкеры, способные взаимодействовать с тиолами, которые можно использовать в аналогичных реакциях, включены в Фиг.16.

[110] Реагент, способный взаимодействовать с иминами, можно смешать с лекарственным веществом, несущим тиоловую группу, в органическом растворителе (например, диметилацетамиде, диметилформамиде, диметилсульфоксиде, ацетонитриле, этаноле, метаноле, метиленхлориде, хлороформе, диоксане или их смеси) или смеси воды (например, деионизированной воды) и одного или более органических растворителей. При использовании только органического растворителя реагент, способный взаимодействовать с иминами, можно смешать с лекарственным веществом при комнатной температуре на 30 мин или дольше (например, приблизительно 1 час, приблизительно 2 часа, приблизительно 3 часа, приблизительно 4 часа, приблизительно 5 часов, приблизительно 10 часов, приблизительно 24 часа или до завершения реакции). Предпочтительно время инкубирования/реакции составляет примерно 0-4 часа или 1-3 часа. Полученную смесь можно немедленно использовать для взаимодействия с агентом, связывающимся с клетками (например, антителом), модифицированным группой, способной взаимодействовать с тиолами, в буфере при рН от приблизительно 4 до приблизительно 9, предпочтительно - от приблизительно 6 до приблизительно 9. В качестве альтернативы смесь можно заморозить и хранить, например, при -20°С или -80°С, и использовать позже при сохранении его способности взаимодействовать с агентом, связывающимся с клетками (например, антителом). Если используют смесь воды и органического растворителя(ей) в качестве системы смешиваемых сорастворителей (например, воды и диметилацетамида), реакционную смесь лекарственного вещества и реагента, способного взаимодействовать с иминами, используют немедленно или хранят в замороженном виде до использования после смешивания с целью взаимодействия с агентом, связывающимся с клетками, несущим группу, способную взаимодействовать с тиолами. Если используют смесь воды и органического растворителя(ей) в качестве системы несмешиваемых сорастворителей (например, воды и метиленхлорида), лекарственное вещество и реагент, способный взаимодействовать с иминами, смешивают на 10 мин или дольше (например, приблизительно 30 минут, приблизительно 1 час, приблизительно 2 часа, приблизительно 5 часов, приблизительно 10 часов, приблизительно 24 часа или до завершения реакции), собирают водный слой, оценивают в нем количество лекарственного вещества и реакционно-способного тиола (например, УФ-спектроскопией и анализом по Элману cDTNB-реагентом (5,5'-дитиобис-(2-нитробензойной кислотой))) и добавляют к агенту, связывающемуся с клетками (например, антителу), несущему группу, способную взаимодействовать с тиолами, в буфере при рН от приблизительно 4 до приблизительно 9, предпочтительно - от приблизительно 6 до приблизительно 9.

[111] Во втором аспекте настоящее изобретение обеспечивает способ получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие СВА с имин-содержащим цитотоксическим соединением, реагентом, способным взаимодействовать с иминами, и бифункциональным сшивающим агентом, включающим связывающую группу, с образованием конъюгата.

[112] В некоторых вариантах воплощения агент, связывающийся с клетками (например, антитело) приводят в контакт с лекарственным веществом (например, имин-содержащим цитотоксическим соединением) и реагентом, способным взаимодействовать с иминами, с образованием первой смеси; а затем первую смесь приводят в контакт с бифункциональным сшивающим агентом с образованием конъюгата связывающийся с клетками агент/лекарственное вещество. Предпочтительно бифункциональный сшивающий агент приводят в контакт с первой смесью непосредственно после образования первой смеси. В качестве альтернативы первую смесь выдерживали в течение интервала времени (например, приблизительно 1-10 минут, приблизительно 10-30 минут, приблизительно от 30 минут до 1 часа, приблизительно от 1 до 5 часов, приблизительно от 5 до 24 часов или приблизительно от 1 до 2 дней) до контакта с бифункциональным сшивающим агентом.

[113] В некоторых вариантах воплощения указанный способ может дополнительно включать очистку конъюгата.

[114] Типичная схема реакции показана на Фиг.10, где на "первом этапе" реагент, способный взаимодействовать с иминами (показан на схеме реакции в виде нуклеофила (Nuc:)), добавляют к СВА (например, антителу), лекарственному веществу, содержащему тиол, бифункциональному сшивающему агенту, содержащему как группу X, способную взаимодействовать с тиолами (малеимид, SSPy, винилсульфон и т.д.), так и реакционно-способную сложноэфирную группу, и обеспечивают протекание реакции при рН 6-9, получая стабильный конъюгат лекарственное вещество/антитело. На "втором этапе" удаляют побочные продукты (например, избыток реагента, способного взаимодействовать с иминами, модифицированного лекарственного вещества, не прореагировавшего с антителом и т.д.) и формируют состав на основе конъюгата. Количество молекул лекарственного вещества, конъюгированных с антителом, равно n и может составлять, например, 1-10.

[115] В третьем аспекте настоящее изобретение обеспечивает способ получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, способ, включающий:

а) взаимодействие цитотоксического соединения с бифункциональным сшивающим агентом, включающим связывающую группу, группу, реагирующую с СВА (например, тиоловую группу, малеимидную группу, галоацетамидную группу или аминогруппу), и группу, способную взаимодействовать с цитотоксическим соединением с образованием модифицированного цитотоксического соединения, ковалентно связанного с остатком бифункционального сшивающего агента, причем указанный остаток включает связывающую группу и группу, способную реагировать с СВА;

причем цитотоксическое соединение представлено одной из следующих формул или ее фармацевтически приемлемой солью:



Y является уходящей группой и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; R1 является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом;

X' выбрана из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Y' выбрана из -Н, оксогруппы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов;

Rc является -Н или замещенным, или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-Rc, галогена, гуанидиния [-NH(ONH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+, сульфата -OSO3-M+, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, необязательно, замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

каждая из R' и Rʺ, независимо, выбрана из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

n является целым числом от 1 до 24;

W выбрана из С=O, C=S, СН2, ВН, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2 или галогеном;

Z и Z', независимо, выбраны из -(CH2)n'-, -(CH2)n'-CR7R8-(CH2)na'-, -(CH2)n'-NR9-(CH2)na'-, -(CH2)n'-O-(CH2)na'- и -(CH2)n'-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0, 1, 2 и 3;

R7 и R8 являются одинаковыми или различными, и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-;

А и А' являются одинаковыми или различными и, независимо, выбраны из -O-, оксо (-С(=O)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- и -CRR'N(R5)-,

R5, в каждом случае независимо, является -Н или необязательно замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и, независимо, отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-ОСН2СН2)n-;

L отсутствует или, если присутствует, включает тиоловую группу, или является мономером полиэтиленгликоля (-ОСН2СН2)n-, линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил, алкенил, фенил или гетероциклическое или гетероарильное кольцо является, необязательно, замещенным; и

б) взаимодействие модифицированного цитотоксического соединения с СВА посредством группы, способной взаимодействовать с СВА, при рН от приблизительно 4 до приблизительно 9, с образованием конъюгата.

[116] В некоторых вариантах воплощения цитотоксическое соединение получают за счет взаимодействия имин-содержащего цитотоксического соединения, несущего тиоловую группу следующих формул, с реагентом, способным взаимодействовать с иминами, в реакционной смеси

[117] В некоторых вариантах воплощения указанный способ может дополнительно включать очистку цитотоксического соединения перед этапом а).

[118] В некоторых вариантах воплощения указанный способ может дополнительно включать очистку модифицированного цитотоксического соединения перед этапом б).

[119] В некоторых вариантах воплощения реакционную смесь хранят в замороженном виде до оттаивания замороженной смеси и проведения этапа а).

[120] В некоторых вариантах воплощения указанный способ может дополнительно включать хранение реакционной смеси, полученной на этапе а), в замороженном виде до оттаивания и проведения этапа б).

[121] В некоторых вариантах воплощения бифункциональный сшивающий агент является бис-малеимидогексаном или ВМРЕО.

[122] Типичная схема реакции показана на Фиг.11, где на "первом этапе" реагент, способный взаимодействовать с иминами (показан на схеме реакции в виде нуклеофила (Nuc:)), добавляют к цитотоксическому соединению, содержащему тиол. Полученное цитотоксическое соединение, необязательно, очищают перед взаимодействием цитотоксического соединения на "втором этапе" с бифункциональным сшивающим агентом (например, бис-малеимидогексаном или ВМРЕО), получая второе модифицированное лекарственное вещество, несущее группу, взаимодействующую с тиолами. Затем на "третьем этапе" добавляют тиол-содержащий СВА (например, антитело) и обеспечивают протекание реакции (рН 6-9), получая стабильный конъюгат лекарственное вещество/антитело. На "четвертом этапе" удаляют побочные продукты (например, избыток реагента, способного взаимодействовать с иминами, модифицированного лекарственного вещества, не прореагировавшего с антителом и т.д.) и формируют состав на основе конъюгата. Количество молекул лекарственного вещества, конъюгированных с антителом, равно n и может составлять, например, 1-10.

[123] Реагент, способный взаимодействовать с иминами, можно смешать с лекарственным веществом, несущим группу, способную взаимодействовать с тиолами, в органическом растворителе (например, диметилацетамиде, диметилформамиде, диметилсульфоксиде, ацетонитриле, этаноле, метаноле, метиленхлориде, хлороформе, диоксане или их смеси) или смеси воды (например, деионизированной воды) и одного или более органических растворителей. При использовании только органического растворителя реагент, способный взаимодействовать с иминами, можно смешать с лекарственным веществом при комнатной температуре на 30 мин или дольше (например, приблизительно 1 час, приблизительно 2 часа, приблизительно 3 часа, приблизительно 4 часа, приблизительно 5 часов, приблизительно 10 часов, приблизительно 24 часа или до завершения реакции). Предпочтительно время инкубирования/реакции составляет примерно 0-4 часа или 1-3 часа. Полученную смесь можно немедленно использовать для взаимодействия с агентом, связывающимся с клетками (например, антителом), модифицированным группой, способной взаимодействовать с тиолами, в буфере при рН от приблизительно 4 до приблизительно 9, предпочтительно - от приблизительно 6 до приблизительно 9. В качестве альтернативы смесь можно заморозить и хранить, например, при -20°С или -80°С, и использовать позже при сохранении его способности взаимодействовать с агентом, связывающимся с клетками (например, антителом). Если используют смесь воды и органического растворителя(ей) в качестве системы смешиваемых сорастворителей (например, воды и диметилацетамида), реакционную смесь лекарственного вещества и реагента, способного взаимодействовать с иминами, используют немедленно после смешивания или хранят в замороженном виде до использования с целью взаимодействия с агентом, связывающимся с клетками, несущим группу, способную взаимодействовать с тиолами. Если используют смесь воды и органического растворителя(ей) в качестве системы несмешиваемых сорастворителей (например, воды и метиленхлорида), лекарственное вещество и реагент, способный взаимодействовать с иминами, смешивают на 10 мин или дольше (например, приблизительно 30 минут, приблизительно 1 час, приблизительно 2 часа, приблизительно 5 часов, приблизительно 10 часов, приблизительно 24 часа или до завершения реакции), собирают водный слой, оценивают в нем количество лекарственного вещества (например, УФ-спектроскопией) и добавляют к агенту, связывающемуся с клетками (например, антителу), несущему тиоловую группу, в буфере при рН от приблизительно 4 до приблизительно 9, предпочтительно - от приблизительно 6 до приблизительно 9.

[124] В четвертом аспекте настоящее изобретение относится к способу получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие модифицированного цитотоксического соединения с СВА при рН приблизительно от 4 до 9, причем модифицированное цитотоксическое соединение включает:

а) остаток бифункционального сшивающего агента, связанный с цитотоксическим соединением и включающий связывающую группу и реакционно-способную группу, выбранную из реакционно-способного сложного эфира и группы, способной взаимодействовать с тиолами, и

б) группу, представленную:


Y является уходящей группой и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (RCC(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н;

Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом.

[125] В некоторых вариантах воплощения модифицированное цитотоксическое соединение получают путем взаимодействия реагента, способного взаимодействовать с иминами, с имин-содержащим цитотоксическим соединением, несущим связывающую группу и реакционно-способную группу.

[126] В некоторых вариантах воплощения указанный способ может дополнительно включать очистку модифицированного цитотоксического соединения до взаимодействия с СВА.

[127] В некоторых вариантах воплощения реакционно-способный сложный эфир может быть выбран из группы, состоящей из N-гидроксисукцинимидного эфира, N-гидроксисульфосукцинимидного эфира, нитрофенилового эфира, динитрофенилового эфира, тетрафторофенилового эфира, сульфотетрафторофенилового эфира и пентафторофенилового эфира. Предпочтительно реакционно-способный сложный эфир является N-гидроксисукцинимидным эфиром.

[128] В некоторых вариантах воплощения группа, способная взаимодействовать с тиолами, может быть выбрана из группы, состоящей из малеимидо, винилпиридина, винилсульфона, винилсульфонамида, группы на основе галоацетила и дисульфидной группы.

[129] В некоторых вариантах воплощения группа, способная взаимодействовать с тиолами, может являться малеимидо, галоацетамидо или -SSRd, где Rd является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, фенилом, нитрофенилом, динитрофенилом, карбоксинитрофенилом, пиридилом, 2-нитропиридилом, 4-нитропиридилом или 3-карбокси-4-нитропиридилом.

[130] Типичная схема реакции показана на Фиг.7, где на "первом этапе" реагент, способный взаимодействовать с иминами (показан на схеме реакции в виде нуклеофила (Nuc:)), добавляют к лекарственному веществу, содержащему реакционно-способный сложный эфир (1с), и обеспечивают взаимодействие с образованием модифицированного лекарственного вещества. Модифицированное лекарственное вещество, необязательно, можно очистить с целью удаления избытка реагента, способного взаимодействовать с иминами. На "втором этапе" модифицированное лекарственное вещество с реакционно-способным сложным эфиром подвергают взаимодействию с антителом в буфере при рН 6-9. На "третьем этапе" удаляют побочные продукты (например, избыток реагента, способного взаимодействовать с иминами, модифицированного лекарственного вещества, не прореагировавшего с антителом и т.д.), и формируют состав на основе конъюгата. Количество молекул лекарственного вещества, конъюгированных с антителом, равно n и может составлять, например, 1-10.

[131] Еще одна схема реакции, изображающая типичный способ по настоящему изобретению, показана на Фиг.9. На "первом этапе" к лекарственному веществу, содержащему группу, способную взаимодействовать с тиолами (где R является малеимидной группой, SSPyy и т.д.), добавляют реагент, способный взаимодействовать с иминами, и обеспечивают их взаимодействие и образование модифицированного лекарственного вещества. Модифицированное лекарственное вещество, необязательно, очищают с целью удаления избытка реагента, способного взаимодействовать с иминами. На "втором этапе" модифицированное лекарственное вещество подвергают взаимодействию с антителом, содержащим реакционно-способный тиол, образуя конъюгат антитело/лекарственное вещество, имеющий антитело, ковалентно связанное с лекарственным веществом посредством стабильной дисульфидной или тиоэфирной связи. Антитела с реакционно-способной тиоловой группой можно получить описанными здесь способами, например путем восстановления межцепочечных дисульфидных связей, генетическим кодированием цистеина или путем модификации антител линкерами, содержащими тиолы или химически замаскированные тиолы. На "третьем этапе" удаляют лекарственное вещество, не прореагировавшее с антителами, и формируют состав на основе конъюгата. Количество молекул лекарственного вещества, конъюгированных с антителом, равно n и может составлять, например, 1-10.

[132] Реагент, способный взаимодействовать с иминами, можно смешать с лекарственным веществом, несущим активированный сложный эфир (например, N-гидроксисукцинимидный эфир, пентафторофеноловый эфир, сульфо-N-гидроксисукцинимидный эфир) в органическом растворителе (например, диметилацетамиде, этаноле, метиленхлориде, хлороформе, диоксане или их смеси) или смеси воды (например, деионизированной воды) и одного или более органических растворителей. При использовании только органического растворителя реагент, способный взаимодействовать с иминами, можно смешать с лекарственным веществом при температуре 0-100°С, предпочтительно - при температуре 0-30°С, более предпочтительно - при комнатной температуре на 5 мин или дольше (например, приблизительно 30 мин, 1 час, приблизительно 2 часа, приблизительно 3 часа, приблизительно 4 часа, приблизительно 5 часов, приблизительно 10 часов, приблизительно 24 часа или до завершения реакции). Предпочтительно время инкубирования/реакции составляет примерно 0-4 часа или 1-3 часа. Полученную реакционную смесь можно немедленно использовать для взаимодействия с агентом, связывающимся с клетками (например, антителом), в буфере при рН от приблизительно 4 до приблизительно 9, предпочтительно - от приблизительно 6 до приблизительно 9. В качестве альтернативы реакционную смесь можно заморозить и хранить, например, при температуре приблизительно -20°С или -80°С и использовать позже при сохранении ее способности взаимодействовать с антителом. Предпочтительно очистка промежуточных продуктов не требуется. При использовании смеси воды и органического растворителя в качестве системы смешиваемых сорастворителей (например, воды и диметилацетамида), смесь лекарственного вещества и реагента, способного взаимодействовать с иминами, используют немедленно после смешивания или хранят в замороженном виде до взаимодействия с агентом, связывающимся с клетками (например, антителом). При использовании смеси воды и органического растворителя в качестве системы несмешиваемых сорастворителей (например, воды и метиленхлорида), лекарственное вещество и реагент, способный взаимодействовать с иминами, смешивают на 10 мин или дольше, собирают водный слой, оценивают в нем количество лекарственного вещества и добавляют к агенту, связывающемуся с клетками (например, антителу), в буфере при рН от приблизительно 4 до приблизительно 9, предпочтительно - от приблизительно 6 до приблизительно 9.

[133] В любом из вышеуказанных аспектов можно использовать подходящее количество реагента, способного взаимодействовать с иминами. Например, можно использовать от приблизительно 0,1 до приблизительно 30 молярных эквивалентов реагента, способного взаимодействовать с иминами. Предпочтительно можно использовать от приблизительно 1 до приблизительно 10 молярных эквивалентов, более предпочтительно - от приблизительно 1 до приблизительно 5 молярных эквивалентов, а еще более предпочтительно - от приблизительно 3 до приблизительно 5 молярных эквивалентов реагента, способного взаимодействовать с иминами.

[134] Используя указанную общую процедуру в любом из вышеописанных аспектов можно использовать любой из следующих реагентов, способных взаимодействовать с иминами: сульфиты (H2SO2, H2SO2 или соль HSO3-, S032- или HSO2-, образованную катионом), метабисульфит (H2S2O5 или соль S2O52-, образованную катионом), моно-, ди-, три- и тетратиофосфаты (PO3SH3, PO2S2H3, POS3H3, PS4H3 или соль PO3S3-, PO2S23-, POS33- или PS43-, образованную катионом), сложные эфиры тиофосфата ((RiO)2PS(ORi), RiSH, RiSOH, RiSO2H, RiSO3H), различные амины (гидроксиламин (например, NH2OH), гидразин (например, NH2NH2), NH2O-Ri, Ri'NH-Ri, NH2-Ri), NH2-CO-NH2, NH2-C(=S)-NH2, тиосульфат (H2S2O3 или соль S2O32-, образованную катионом), дитионит (H2S2O4 или соль S2O42-, образованную катионом), фосфородитиоат (Р(=S)(ORk(SH)(ОН) или его соль, образованную катионом), гидроксамовую кислоту (RkC(=O)NHOH или соль, образованную катионом), гидразид (RkCONHNH2), формальдегидсульфоксилат (HOCH2SO2H или соль HOCH2SO2-, образованную катионом, например HOCH2SO2-Na+), гликозилированный нуклеотид (например, GDP-маннозу), флударабин или их смесь, где Ri и Ri', независимо, являются линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещены по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri и Ri', необязательно, могут быть дополнительно замещены заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; a Rk является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом (предпочтительно Rk является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода; более предпочтительно Rk является метилом, этилом или пропилом). Предпочтительно катион является одновалентным катионом, например Na+ или K+.

[135] Предпочтительно реагент, способный взаимодействовать с иминами, выбирают из сульфитов (например, NaHSO3 или KHSO3), гидроксиламина, гидразина и мочевины. Более предпочтительно реагент, способный взаимодействовать с иминами, является NaHSO3 или KHSO3.

[136] В одном варианте воплощения модифицированные лекарственные вещества, описанные в любом из вышеуказанных аспектов, очищают перед взаимодействием с агентом, связывающимся с клетками. Для очистки модифицированного лекарственного вещества можно использовать любые подходящие способы, известные в данной области техники. Например, модифицированный препарат можно очистить с помощью колоночной хроматографии (например, хроматографии на силикагеле) или ВЭЖХ.

[137] В еще одном варианте воплощения конъюгат, связывающийся с клетками агент/лекарственное вещество, полученный в соответствии с любым из вышеописанных аспектов, очищают с помощью тангенциальной проточной фильтрации, адсорбционной хроматографии, адсорбционной фильтрации, избирательного осаждения, неабсорбционной фильтрации или их комбинации. Для очистки конъюгатов предпочтительно используют тангенциальную проточную фильтрацию (TFF, также известную как фильтрация в тангенциальном потоке, ультрафильтрация и диафильтрация) и/или смолы для адсорбционной хроматографии.

[138] Можно использовать любые подходящие системы TFF, в том числе системы типа Pellicon (Millipore, Биллерика, штат Массачусетс, США), систему Sartocon Cassette (Sartorius AG, Эджвуд, Нью-Йорк, США) и систему типа Centrasette (Pall Corp., Ист-Хилз, штат Нью-Йорк, США).

[139] Можно использовать любую подходящую смолу для адсорбционной хроматографии. Предпочтительные смолы для адсорбционной хроматографии включают смолы для хроматографии на гидроксиапатите, гидрофобной хроматографии с индукцией заряда (HCIC), гидрофобной хроматографии (HIC), ионообменной хроматографии, ионообменной хроматографии смешанного типа, аффинной хроматографии с использованием иммобилизованных металлов (IMAC), хроматографии краситель-лиганд, аффинной хроматографии, обращенно-фазовой хроматографии и их комбинаций. Примеры подходящих смол на основе гидроксиапатита включают керамический гидроксиапатит (СНТ I типа и II типа, Bio-Rad Laboratories, Херкулиз, штат Калифорния, США), гидроксиапатит НА Ultrogel (Pall Corp., Ист-Хилз, штат Нью-Йорк, США) и керамический фтороапатит (CFT I типа и II типа, Bio-Rad Laboratories, Херкулиз, штат Калифорния, США). Примером подходящей смолы для HCIC является смола МЕР Hypercel (Pall Corp., Ист-Хилз, штат Нью-Йорк, США). Примеры подходящих смол для HIC включают смолы Butyl-Sepharose, Hexyl-Sepaharose, Phenyl-Sepharose и Octyl Sepharose (все от компании GE Healthcare, Пискатауэй, штат Нью-Джерси, США), а также смолы Macro-prep Methyl и Macro-Prep t-Butyl (Biorad Laboratories, Херкулиз, штат Калифорния, США). Примеры подходящих ионообменных смол включают смолы SP-Sepharose, CM-Sepharose и Q-Sepharose (все от компании GE Healthcare, Пискатауэй, штат Нью-Джерси, США), а также смолу Unosphere S (Bio-Rad Laboratories, Херкулиз, штат Калифорния, США). Примеры подходящих ионообменников смешанного типа включают смолу Bakerbond ABx (JT Baker, Филлипсбург, штат Нью-Джерси, США). Примеры подходящих IMAC-смол включают смолу Chelating Sepharose (GE Healthcare, Пискатауэй, штат Нью-Джерси, США) и смолу Profinity IMAC (Bio-Rad Laboratories, Херкулиз, штат Калифорния, США). Примеры подходящих краситель-лигандных смол включают смолу Blue Sepharose (GE Healthcare, Пискатауэй, штат Нью-Джерси, США) и смолу Affi-gel Blue (Bio-Rad Laboratories, Херкулиз, штат Калифорния, США). Примеры подходящих аффинных смол включают смолу Protein A Sepharose (например, MabSelect, GE Healthcare, Пискатауэй, штат Нью-Джерси, США), где агент, связывающийся с клетками, является антителом, и пектиновые аффинные смолы, например смолу Lentil Lectin Sepharose (GE Healthcare, Пискатауэй, штат Нью-Джерси, США), где агент, связывающийся с клетками, несет сайты связывания соответствующего лектина. В качестве альтернативы можно использовать антитело, специфичное к агенту, связывающемуся с клетками. Такое антитело можно иммобилизовать, например, на смоле Sepharose 4 Fast Flow (GE Healthcare, Пискатауэй, штат Нью-Джерси, США). Примеры подходящих обращенно-фазовых смол включают смолы С4, С8 и С18 (Grace Vydac, Хесперия, штат Калифорния, США).

[140] В способах согласно настоящему изобретению можно использовать любую подходящую смолу для неабсорбционной хроматографии. Примеры подходящих хроматографических смол включают смолы SEPHADEX™ G-25, G-50, G-100, SEPHACRYL™ (например, S-200 и S-300), смолы SUPERDEX™ (например, SUPERDEX™ 75 и SUPERDEX™ 200), смолы BIO-GEL® (например, Р-6, Р-10, Р-30, Р-60 и Р-100) и другие смолы, известные специалистам в данной области техники, но не ограничиваются ими.

Лекарственные вещества, несущие связывающую группу

[141] Лекарственные вещества, которые можно использовать в способах по настоящему изобретению, включают соединения, описанные в US 2010/031665 6, US 2010/003641, US 2010/0203007, все из которых включены в настоящее описание посредством ссылки.

[142] В некоторых других вариантах воплощения цитотоксические соединения, которые можно конъюгировать с агентами, связывающимися с клетками, посредством связывающей группы, не содержат связывающей группы. Вместо этого для конъюгирования цитотоксического соединения, не имеющего линкера, с СВА посредством линкерной группы может требоваться бифункциональный сшивающий реагент (включающий связывающую группу).

[143] Так, в первом специфическом варианте воплощения лекарственное вещество, ковалентно соединенное со связывающей группой посредством присоединенной к ней реакционно-способной группы, которое можно использовать в способах по настоящему изобретению (например, в одноэтапном реагентном способе, как описано выше в четвертом аспекте настоящего изобретения) или которое может являться промежуточным продуктом способов по настоящему изобретению (например, способа, описанного в третьем аспекте настоящего изобретения), является цитотоксическим соединением, несущим реакционно-способную группу, например реакционно-способный сложный эфир или группу, способную взаимодействовать с тиолами (обобщенно "реакционно-способную группу"), включающую связывающую группу с присоединенной к ней реакционно-способной группой, способной ковалентно связывать цитотоксическое соединение с СВА, причем указанное цитотоксическое соединение представлено любой из следующих формул:


или их фармацевтически приемлемой солью. После взаимодействия с реагентом, способным взаимодействовать с иминами, цитотоксическое соединение может быть представлено любой из следующих формул:



Y является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3 тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом;

X' выбрана из -Н, -ОН, амин-блокирующей группы, связывающей группы с присоединенной к ней реакционно-способной группой, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Y' выбрана из -Н, оксогруппы, связывающей группы с присоединенной к ней реакционно-способной группой, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов;

Rc является -Н или замещенным, или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, или связывающей группой с присоединенной к ней реакционно-способной группой;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CIH2)n-Rc, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+, сульфата -OSO3-M+, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ и связывающей группы с присоединенной к ней реакционно-способной группой;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

каждая из R' и Rʺ, независимо, выбрана из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

n является целым числом от 1 до 24;

W выбрана из С=O, C=S, СН2, ВН, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2, галогеном или связывающей группой с присоединенной к ней реакционно-способной группой;

Z и Z', независимо, выбраны из -(CH2)n'-, -(CH2)n'-CR7R8-(CH2)na'-, -(CH2)n'-NR9-(CH2)na'-, -(СН2)n'-O-(СН2)na'- и -(CH2)n'-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0, 1, 2 и 3;

R7 и R8 являются одинаковыми или различными, и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-;

А и А' являются одинаковыми или различными и, независимо, выбраны из -O-, оксо (-С(=O)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -NR5 и -CRR'N(R5)-;

R5, в каждом случае независимо, является -Н или необязательно замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и, независимо, отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-OCH2CH2)n-;

L отсутствует, является связывающей группой с присоединенной к ней реакционно-способной группой, мономером полиэтиленгликоля (-OCH2CH2)n-, линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил или алкенил, необязательно, замещены связывающей группой с присоединенной к ней реакционно-способной группой, фенил или гетероциклическое или гетероарильное кольцо могут быть, необязательно, замещены, причем заместитель может являться связывающей группой с присоединенной к ней реакционно-способной группой.

Предпочтительно L отсутствует или выбрана из необязательно замещенной фенильной группы и необязательно замещенной пиридильной группы, где фенильная и пиридильная группа несет связывающую группу с присоединенной к ней реакционно-способной группой, либо L является аминогруппой, несущей связывающую группу с присоединенной к ней реакционно-способной группой (т.е. -N(связывающая группа)-), либо L является линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 6 атомов углерода и несущим связывающую группу с присоединенной к ней реакционно-способной группой.

[144] Некоторые типичные соединения формул (Ia') и (IIa') перечислены ниже:

[145] В некоторых вариантах воплощения

X' выбрана из группы, состоящей из -H, -ОН, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, фенила, связывающей группы с присоединенной к ней реакционно-способной группой и амино-блокирующей группы. Предпочтительно X' является -Н, -ОН, -Me или связывающей группой с присоединенной к ней реакционно-способной группой. Более предпочтительно X' является -Н;

Y' выбрана из группы, состоящей из -Н, оксогруппы, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода. Предпочтительно Y' выбрана из -Н или оксогруппы. Более предпочтительно Y' является -Н;

W является C=O;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из -Н, -NR'Rʺ, -NR'(C=O)R, -OR, -SR, -NO2 и связывающей группы с присоединенной к ней реакционно-способной группой. Предпочтительно одна из R2, R3, R2' и R3' является связывающей группой с присоединенной к ней реакционно-способной группой, а остальные являются -Н;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, или фенила;

R' и Rʺ являются одинаковыми или различными и, независимо, выбраны из -Н, -ОН, -OR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, или фенила;

R6 является -ORc или -SRc, где Rc является -Н, линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода. Предпочтительно R6 является -ОМе или -SMe. Еще более предпочтительно R6 является -ОМе;

Z и Z' являются -СН2-;

А и А' являются одинаковыми или различными и выбраны из -O-, -S-, -NR5 и оксогруппы (С=O). Предпочтительно А и А' являются одинаковыми или различными и выбраны из -О- и -S-. Более предпочтительно А и А' являются -O-;

D и D' являются одинаковыми или различными и, независимо, выбраны из мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 24, аминокислоты, пептида, несущего от 2 до 6 аминокислот, или линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, где алкил, алкенил и алкинил, необязательно, замещены одним или более (например, 2, 3, 4, 5, 6 или более) заместителей, независимо выбранных из группы, состоящей из галогена, -OR, -NR'CORʺ, -SR и COR';

предпочтительно D и D' являются одинаковыми или различными и, независимо, выбраны из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода. Более предпочтительно D и D' являются линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода. Еще более предпочтительно D и D' являются одинаковыми или различными и выбраны из линейного алкила, имеющего от 1 до 4 атомов углерода;

L отсутствует или выбрана из необязательно замещенной фенильной группы и необязательно замещенной пиридильной группы, где фенильная и пиридильная группа несет связывающую группу с присоединенной к ней реакционно-способной группой, либо L является аминогруппой, несущей связывающую группу с присоединенной к ней реакционно-способной группой (т.е. -N(связывающая группа)-), либо L является линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 6 атомов углерода и несущим связывающую группу с присоединенной к ней реакционно-способной группой.

[146] Во втором специфическом варианте воплощения для цитотоксических димеров (1а) или (На) переменные описаны ниже:

W является С=O;

R1, R2, R1', R2', R4 и R4' являются -Н;

одна из R3 или R3', необязательно, является связывающей группой с присоединенной к ней реакционно-способной группой, а другая является -Н;

R6 является -ОМе;

Z и Z' являются -СН2-;

X' является -Н;

Y' является -Н;

А и А' являются -O-; а остальные переменные соответствуют описанию в первом специфическом варианте воплощения.

[147] В третьем специфическом варианте воплощения цитотоксические димеры (соединенные со связывающей группой посредством присоединенной к ней реакционно-способной группы) формулы (Ia') и (IIa') представлены следующими формулами:


X' выбрана из группы, состоящей из -Н, -ОН, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, фенила и амино-блокирующей группы. Предпочтительно X' является -Н, -ОН или -Me. Более предпочтительно X' является -Н;

Y' выбрана из группы, состоящей из -Н, оксогруппы, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода. Предпочтительно Y' выбрана из -Н или -Me. Более предпочтительно Y' является -Н;

L', Lʺ и Lʺ' являются одинаковыми или различными и, независимо, выбраны из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)nRc, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO3R', сульфоната -SO3-M+, сульфата -OSO3+М+, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ и связывающей группы с присоединенной к ней реакционно-способной группой, при условии, что только одна из L', Lʺ и Lʺ' является связывающей группой с присоединенной к ней реакционно-способной группой. Предпочтительно L' является связывающей группой с присоединенной к ней реакционно-способной группой. В качестве альтернативы одна из L', Lʺ или Lʺ' является связывающей группой с присоединенной к ней реакционно-способной группой, в то время как другие являются -Н. Более предпочтительно L' является связывающей группой с присоединенной к ней реакционно-способной группой, а Lʺ и Lʺ' являются -Н;

R6 является -ORc или -SRc, где Rc является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода. Предпочтительно R6 является -ОМе или -SMe. Еще более предпочтительно R6 является -ОМе;

А и А' выбраны из -О- и -S-. Предпочтительно А и А' являются -O-;

R является -Н, необязательно замещенным линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или ПЭГ-группой (CH2CH2)n-Rc;

n является целым числом от 1 до 24; и

Rc является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода;

R' и Rʺ являются одинаковыми или различными и выбраны из -Н, -ОН, -OR, -NRR8, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, выбранных из О, S, N и Р, ПЭГ-группы -(CH2CH2O)n-Rc, где n является целым числом от 1 до 24, предпочтительно n равен 2, 4 или 8; a R8 является -Н, необязательно замещенным линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или ПЭГ-группой (CHzCH2O)n-Rc;

G выбрана из -СН- или -N-; а остальные переменные соответствуют описанию в первом специфическом варианте воплощения.

[148] В четвертом специфическом варианте воплощения цитотоксических димеров формулы (IAa') или (IIAa') L' представлена формулой:



W' и V являются одинаковыми или различными и каждая из них, независимо, отсутствует или выбрана из -CReRe'-, -O-, -O-С(=O)-, -С(=O)-O-, -S-, -SO-, -SO2-, -CH2-S-, -CH2O-, -CH2NRe-, -O-(C=O)O-, -O-(C=O)N(Re)-, -N(Re)-, -N(Re)-C(=O)-, -C(=O)-N(Re)-, -N(Re)-C(=O)O-, -N(C(=O)Re)C(=O)-, -N(C(=O)Re)-, -(O-CH2-CH2)n-, -SS- или -С(=O)-, или аминокислоты, или пептида, имеющего от 2 до 8 аминокислот;

Rx и Ry являются одинаковыми или различными и каждая из них, независимо, отсутствует или является необязательно замещенным линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, имеющим от 6 до 10 атомов углерода, или 3-8-членным гетероциклическим кольцом, несущим от 1 до 3 гетероатомов, выбранных из О, N или S;

Re и Re' являются одинаковыми или различными и выбраны из -Н, линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, или -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим вторичную аминогруппу (например, -NHR101) или третичную аминогруппу (-NR101R102), или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин, где каждая из R101 и R102, независимо, является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода; предпочтительно каждая R101 и R102, независимо, представляет собой линейный или разветвленный алкил, имеющий от 1 до 6 атомов углерода;

n является целым числом от 1 до 24; и

J включает реакционно-способную группу, связанную с ней, и выбрана из малеимида, галоацетамидо, -SH, -SSRd, -CH2SH, -CH(Me)SH, -C(Me)2SH и -СОЕ, где -СОЕ является реакционно-способным сложным эфиром, выбранным из N-гидроксисукцинимидным эфиром, N-гидроксисульфосукцинимидным эфиром, нитрофениловым (например, 2- или 4-нитрофениловым) эфиром, динитрофениловым (например, 2,4-динитрофениловым) эфиром, сульфотетрафторофениловым (например, 4-сульфо-2,3,5,6-тетрафторофениловым) эфиром и пентафторофениловым эфиром, но не ограничивающимся ими, a Rc1 является -Н или замещенным или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, и

Rd выбрана из фенила, нитрофенила (например, 2- или 4-нитрофенила), динитрофенила (например, 2- или 4-нитрофенила), карбоксинитрофенила (например, 3-карбокси-4-нитрофенила), пиридила или нитропиридила (например, 4-нитропиридила).

[149] Предпочтительно J является -SH, -SSRd, малеимидом или N-гидроксисукцинимидным эфиром.

[150] Предпочтительно Re' является -Н или -Me; Re является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода, или -(СН2-СН2-O)n-Rk; n является целым числом от 2 до 8; предпочтительно Rk является -Н, -Me или -СН2СН2-NMe2, а остальные переменные соответствуют описанию, приведенному выше в третьем специфическом варианте воплощения.

[151] В еще одном предпочтительном варианте воплощения V является аминокислотой или пептидом, имеющим от 2 до 8 аминокислот. Более предпочтительно V является валин-цитруллином, gly-gly-gly или ala-leu-ala-leu.

[152] В еще одном предпочтительном варианте воплощения W' является -O-, -N(Re)- или -N(Re)-C(=O)-; Re является -Н, линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, или -(CH2-CH2-O)n-Rk; Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; V отсутствует или является -(O-СН2-СН2)n-, -C(=O)-NH-, -S-, -NH-C(=O)-; Ry отсутствует или является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода; а J является -SH, -SSR или -СОЕ (предпочтительно N-гидроксисукцинимидным эфиром). Остальные переменные соответствуют описанию в четвертом специфическом варианте воплощения.

[153] В еще одном предпочтительном варианте воплощения W является -O-, -N(Re)- или -N(Re)-C(=O)-; Re является Н, -Me или -(CH2-CH2-O)n-Me; n является целым числом от 2 до 6; Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; V и Ry отсутствуют; а J является -СОЕ, предпочтительно N-гидроксисукцинимидным эфиром.

[154] В пятом специфическом варианте воплощения L' представлена следующей формулой:



каждая из R, R и R, независимо, является -Н или -Me;

R является -Н, -Me, -SO3H или -SO3-M+ где М+ является фармацевтически приемлемым катионом;

а является целым числом от 0 до 2, b является целым числом от 0 до 3; а Cy является, необязательно, замещенным 5-членным гетероциклическим кольцом, несущим гетероатом N, предпочтительно Cy является

[155] В некоторых вариантах воплощения, например в четвертом или пятом специфических вариантах воплощения, W является -N(Re)-.

[156] В некоторых вариантах воплощения, например в четвертом или пятом специфических вариантах воплощения, Re является -(СН2-СН2-O)2-6- Rk, где Rk является - Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода.

[157] В некоторых вариантах воплощения, например в четвертом или пятом специфических вариантах воплощения, V является -S- или -SS-.

[158] В шестом специфическом варианте воплощения L', например, как и в четвертом или пятом специфических вариантах воплощения, представлена следующей формулой:


[159] В некоторых вариантах воплощения цитотоксическое соединение, соединенное со связывающей группой посредством реакционно-способной группы, присоединенной к ней, как в 4-м, 5-м и 6-м специфических вариантах воплощения, является:


где Y является -SO3M, а М является -Н или фармацевтически приемлемым катионом.

[160] В седьмом специфическом варианте воплощения L', например, как и в четвертом, пятом или шестом специфических вариантах воплощения, представлена следующей формулой:


[161] В некоторых вариантах воплощения цитотоксическое соединение, соединенное со связывающей группой посредством реакционно-способной группы, присоединенной к ней, как в 4-м, 5-м и 7-м специфических вариантах воплощения, является:


где Y является -SO3M, а М является -Н или фармацевтически приемлемым катионом.

[162] В восьмом специфическом варианте воплощения цитотоксические соединения формулы (Ia) и (IIa) представлены следующими формулами:


W' отсутствует или выбрана из -O-, -N(Re)-, -N(Re)-C(=O)-, -N(C(=O)Re)-, -S- или -CH2-S-, -CH2NRe-;

Rx отсутствует или выбрана из линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

Re является -Н, линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или -(СН2-СН2-O)n-Rk, где R является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим вторичную аминогруппу (например, -NHR101) или третичную аминогруппу (-NR101R102), или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин, где каждая из R101 и R102, независимо, является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода. Предпочтительно каждая из R101 и R102, независимо, является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода;

Z5 является -Н, -SRm;

Rm является Rd или замещенным, или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, несущим реакционно-способный сложный эфир, выбранный из N-гидроксисукцинимидных эфиров, N-гидроксифталимидных эфиров, N-гидроксисульфосукцинимидных эфиров, пара-нитрофениловых эфиров, динитрофениловых эфиров, пентафторофениловых эфиров;

Rd выбрана из фенила, нитрофенила, динитрофенила, карбоксинитрофенила, пиридила или нитропиридила;

n является целым числом от 1 до 24, а остальные переменные соответствуют описанию, приведенному выше в четвертом специфическом варианте воплощения.

[163] Предпочтительно Rk является -Н или -Me, a n является целым числом от 2 до 8. Предпочтительно Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода, а остальные переменные соответствуют описанию, приведенному выше в пятом специфическом варианте воплощения.

[164] В некоторых вариантах воплощения для соединений формулы (IBa) и (IIBa), описанных в восьмом специфическом варианте воплощения, переменные соответствуют описанию, приведенному ниже:

X' и Y' оба являются -Н;

А и А' оба являются -O-;

R6 является -ОМе;

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода, а остальные переменные соответствуют описанию, приведенному выше в восьмом специфическом варианте воплощения.

[165] Предпочтительно Rx является -(СН2)р-(CRfRg)-, где каждая из Rf и Rg, независимо, выбрана из Н или линейного или разветвленного алкила, имеющего от 1 до 4 атомов углерода; р равен 0, 1, 2 или 3. Более предпочтительно Rf и Rg являются одинаковыми или различными и выбраны из -Н и -Me, а р равен 1.

[166] В девятом специфическом варианте воплощения цитотоксическое соединение, соединенное со связывающей группой посредством присоединенной к ней реакционно-способной группы, представлено любой из следующих формул:



Y выбрана из -SO3M, -SO2M или -OSO3M;

М является -Н или фармацевтически приемлемым катионом, например Na+ или K+;

X' выбрана из группы, состоящей из -Н, -ОН, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, фенила и амино-блокирующей группы;

Y' выбрана из группы, состоящей из -Н, оксогруппы, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода;

А и А' выбраны из -О- и -S-;

W' отсутствует или выбрана из -O-, -N(Re)-, -N(Re)-C(=O)-, -N(C(=O)Re)-, -S- или -CH2-S-, -CH2NRe-;

Rx отсутствует или выбрана из линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

Re является -Н, линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим вторичную аминогруппу (например, -NHR101) или третичную аминогруппу (-NR101R102), или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин, где каждая из R101 и R102, независимо, является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода;

G выбрана из -СН- или -N-;

Z3 является -Н или выбрана из любой из следующих формул:


q является целым числом от 1 до 5; предпочтительно q равен 2;

n является целым числом от 2 до 6; предпочтительно n равен 4;

D является -Н или -SO3M;

М является -Н или фармацевтически приемлемым катионом, например Na+ или K+.

[167] В некоторых вариантах воплощения Zs представлена любой из следующих формул:

[168] В некоторых вариантах воплощения, например в девятом специфическом варианте воплощения, W' является -N(Re)-.

[169] В некоторых вариантах воплощения Re является -(CH2-CH2-O)n-Rk где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода.

[170] В некоторых вариантах воплощения Rk является -Н или -Me, n равен 4, a q равен 2.

[171] В некоторых вариантах воплощения Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[172] В некоторых вариантах воплощения Rx является -(CH2)p-(CRfRg)-, где каждая из Rf и Rg независимо выбрана из -Н или линейного или разветвленного алкила, имеющего от 1 до 4 атомов углерода; а р равен 0, 1, 2 или 3.

[173] В некоторых вариантах воплощения Rf и Rg являются одинаковыми или различными и выбраны из -Н и -Me; а р равен 1.

[174] В десятом специфическом варианте воплощения переменные девятого специфического варианта воплощения приведены ниже: Y является -SO3M; М является -Н или фармацевтически приемлемый катионом (например, Na+); X' и Y' оба являются -Н; А и А' оба являются -O-; R6 является -ОМе; a Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[175] В любом из вышеприведенных вариантов воплощения, например в специфических вариантах воплощения с 1-го по 9-й, Y выбрана из -SO3M, -SO2M и сульфата -OSO3M. Предпочтительно Y является -SO3M, где М предпочтительно является -Н, Na+ или K+.

[176] В любом из вышеприведенных вариантов воплощения, например в специфических вариантах воплощения с 1-го по 10-й, W, если присутствует, является С=O.

[177] В любом из вышеприведенных вариантов воплощения, например в специфических вариантах воплощения с 1-го по 10-й, Z и Z', если присутствуют, являются -СН2.

[178] В любом из вышеприведенных вариантов воплощения, например в специфических вариантах воплощения с 1-го по 10-й, X' выбрана из группы, состоящей из -Н, -ОН, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, фенила, связывающей группы с присоединенной к ней реакционно-способной группой и амино-блокирующей группы. Предпочтительно X' является -Н, -ОН, -Me или связывающей группой с присоединенной к ней реакционно-способной группой. Более предпочтительно X' является -Н.

[179] В любом из вышеприведенных вариантов воплощения, например в специфических вариантах воплощения с 1-го по 10-й, Y' выбрана из группы, состоящей из -Н, оксогруппы, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода. Предпочтительно Y' является -Н или оксогруппой. Более предпочтительно Y' является -Н.

[180] В любом из вышеприведенных вариантов воплощения, например в специфических вариантах воплощения с 1-го по 10-й, А и А' являются одинаковыми или различными и выбраны из -O-, -S-, -NR5- и оксогруппы -(С=O)-. Предпочтительно А и А' являются одинаковыми или различными и выбраны из -О- и -S-. Более предпочтительно А и А' являются -O-.

[181] В любом из вышеприведенных вариантов воплощения, например в специфических вариантах воплощения с 1-го по 10-й, D и D', если присутствуют, являются одинаковыми или различными и, независимо, выбраны из мономера полиэтиленгликоля (-OCH2CH2)n, где n является целым числом от 1 до 24, аминокислоты, пептида, несущего от 2 до 6 аминокислот, или линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, где алкил, алкенил и алкинил, необязательно, замещены одним или более заместителей, независимо выбранных из группы, состоящей из галогена, -OR, -NR'CORʺ, -SR и -COR'. Предпочтительно D и D' являются линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода.

[182] В одиннадцатом специфическом варианте воплощения различные группы цитотоксических соединений первого, третьего и девятого специфического варианта воплощения приведены ниже: W является С=O; R1, R2, R1', R2', R4 и R4' являются -Н; одна из R3 или R3', необязательно, является связывающей группой с присоединенной к ней реакционно-способной группой, а другая является -Н; R6 является -ОМе; Z и Z' являются -СН2-; X' является -Н; Y' является -Н; а А и А' являются -O-.

[183] В другом варианте воплощения связывающая группа с присоединенной к ней реакционно-способной группой, как в любом из вышеприведенных специфических вариантов воплощения, является любой из групп, перечисленных в списке 1.

[184] В еще одном варианте воплощения цитотоксические димеры без линкерных групп (например, линкерных групп, описанных выше), присоединенных к ним, могут дополнительно взаимодействовать с бифункциональным сшивающим реагентом с образованием лекарственного вещества, несущего связывающую группу с присоединенной к ней реакционно-способной группой, предназначенного для использования в способах по настоящему изобретению (например, с целью дальнейшего взаимодействия с агентом, связывающимся с клетками, с образованием конъюгата лекарственное вещество/СВА). Альтернативно цитотоксические димеры без линкерных групп (например, линкерных групп, описанных выше), присоединенных к ним, могут дополнительно взаимодействовать с бифункциональным сшивающим реагентом и реагентом, связывающимся с клетками, в одноэтапной реакции с целью непосредственного образования конъюгата лекарственное вещество/СВА. В любом случае реагент, способный взаимодействовать с иминами, можно добавлять к реакционной смеси с образованием аддукта лекарственное вещество - реагент, способный взаимодействовать с иминами (например, аддукта бисульфита) перед реакцией образования конъюгата лекарственное вещество/СВА. Предпочтительно цитотоксические димеры без линкерных групп (например, линкерных групп, описанных выше), присоединенных к ним, можно вначале предварительно инкубировать с реагентом, способным взаимодействовать с иминами, с образованием аддукта, до использования реакционной смеси в последующей реакции с образованием конъюгата лекарственное вещество/СВА.

[185] Так, в двенадцатом специфическом варианте воплощения имин-содержащее цитотоксическое соединение представлено любой из следующих формул или его фармацевтически приемлемой солью:

а после реакции с реагентом, способным взаимодействовать с иминами, цитотоксическое соединение представлено следующей формулой или его фармацевтически приемлемой солью:


Y является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (Р(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk' C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом; предпочтительно Y является аддуктом бисульфита, гидросульфита или метабисульфита, или их солью (например, солью натрия);

X' выбрана из группы, состоящей из -Н, -ОН, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода (например, фенила), необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р. Предпочтительно X' является -Н, -ОН или -Me. Более предпочтительно X' является -Н;

Y' выбрана из группы, состоящей из -Н, оксогруппы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов. Предпочтительно Y' выбрана из -Н или оксогруппы. Более предпочтительно Y' является -Н;

Rc является -Н или замещенным, или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода;

каждая из R1, R2, R3, R4, R1', R2'; R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-Rc, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+, сульфата -OSO3-M+, сульфонамида, представленного –SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR' и -OCONR'Rʺ. Предпочтительно 1, 2, 3 или все из R2, R3, R2' и R3' являются -Н;

М является -Н или фармацевтически приемлемым катионом;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

R' и Rʺ являются одинаковыми или различными и, независимо, выбраны из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

n является целым числом от 1 до 24;

W выбрана из С=O, C=S, CH2, ВН, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2, галогеном, -ORc или -SRc; предпочтительно R6 является -ОМе или -SMe. Еще более предпочтительно R6 является -ОМе;

Z и Z', независимо, выбраны из -(CH2)n'-, -(CH2)n'-CR7R8-(CH2)na'-, -(CH2)n'-NR9-(CH2)na'-, -(СН2)n'-O-(СН2)na'- и -(CH2)n'-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0, 1, 2 и 3;

R7 и R8 являются одинаковыми или различными и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-;

А и А' являются одинаковыми или различными и, независимо, выбраны из -O-, оксо (-С(=O)-), -CRR'O-, -CRR'-, -S-, - CRR'S-, -N(R5)- и -CRR'N(R5)-. Предпочтительно А и А' являются одинаковыми или различными и выбраны из -O-и -S-. Более предпочтительно А и А' являются -O-;

R5, в каждом случае независимо, является -Н или необязательно замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и, независимо, отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-ОСН2СН2)n-;

L отсутствует или, если присутствует, включает тиоловую группу и является мономером полиэтиленгликоля (-ОСН2СН2)n-, линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил, алкенил, фенил или гетероциклическое или гетероарильное кольцо является, необязательно, замещенным.

[186] Типичные структуры таких имин-содержащих цитотоксических соединений показаны в Таблице 15. См. соединения 1, 3, 4, 5 и 1d.

[187] В некоторых вариантах воплощения W является 0=O;

R1, R2, R3, R4, R1', R2', R3' и R4' являются -Н;

Z и Z' являются -СН2-;

А и А' оба являются -O-;

W является -(С=O)-;

G является -СН-;

R6 является -Н или, необязательно, замещенным С1-С10 линейным, С1-С10 разветвленным или С3-С7 циклическим алкилом, -O-алкилом или -O-гало-алкилом, например -ОМе;

X' выбрана из группы, состоящей из -Н, -ОН, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, фенила и амино-блокирующей группы; а

Y' выбрана из группы, состоящей из -Н, оксогруппы, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода.

[188] Предпочтительно Y выбрана из -SO3M, -SO2M или -OSO3M, где М является -Н или фармацевтически приемлемым катионом, например Na+ или K+.

[189] Предпочтительно Y является -SO3M; М является -Н или Na+.

[190] В некоторых вариантах воплощения имин-содержащее цитотоксическое соединение представлено любой из следующих формул:



Lʺ, Lʺ и L'ʺ являются одинаковыми или различными и, независимо, выбраны из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-Re, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3M, сульфата -OSO3M, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ;

М является -Н или фармацевтически приемлемым катионом; а G выбрана из -СН- или -N-.

[191] В некоторых вариантах воплощения цитотоксическое соединение, если присутствует, представлено одной из следующих формул или его фармацевтически приемлемой солью:


[192] В некоторых вариантах воплощения одна из L', Lʺ или L''' несет тиоловую группу, а другие являются -Н. Предпочтительно L' несет тиоловую группу, а Lʺ и L''' являются -Н.

[193] В некоторых вариантах воплощения А и А' оба являются -O-; R6 является -ОМе; а G является -СН-.

[194] В некоторых вариантах воплощения имин-содержащее цитотоксическое соединение может быть представлено любой из следующих формул:



W' отсутствует или, если присутствует, выбрана из -CReRe'-, -O-, -O-С(=O)-, -С(=O)-O-, -S-, -SO-, -SO2-, -CH2-S-, -CH2O-, -CH2NRe-, -O-(C=O)O-, -O-(С=O)N(Re)-, -N(Re)-, -N(Re)-C(=O)-, -C(=O)-N(Re)-, -N(Re)-C(=O)O-, -N(C(=O)Re)C(=O)-, -N(C(=O)Re)-, -(O-CH2-CH2)n-, -SS- или -С(=O)-, или аминокислоты, или пептида, имеющего от 2 до 8 аминокислот;

Rx отсутствует или, если присутствует, является необязательно замещенным линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, имеющим от 6 до 10 атомов углерода, или 3-8-членным гетероциклическим кольцом, несущим от 1 до 3 гетероатомов, выбранных из О, N или S;

Re и Re' являются одинаковыми или различными и выбраны из -Н, линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, или -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим вторичную аминогруппу (например, -NHR101) или третичную аминогруппу (-NR101R102), или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин, где каждая из R101 и R102, независимо, является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода; предпочтительно каждая R101 и R102, независимо, является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода;

n является целым числом от 1 до 24.

[195] В некоторых вариантах воплощения цитотоксическое соединение, если присутствует, может быть представлено одной из следующих формул или его фармацевтически приемлемой солью:


[196] В некоторых вариантах воплощения

Y выбрана из -SO3M, -SO2M или -OSO3M;

М является -Н или фармацевтически приемлемым катионом, например Na+ или K+;

X' выбрана из группы, состоящей из -Н, -ОН, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, фенила и амино-блокирующей группы;

Y' выбрана из группы, состоящей из -Н, оксогруппы, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода;

А и А' выбраны из -О- и -S-;

W' отсутствует или выбрана из -O-, -N(Re)-, -N(Re)-C(=O)-, -N(C(=O)Re)-, -S- или -CH2-S-, -CH2NRe-;

Rx отсутствует или выбрана из линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

Re является -Н, линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или -(СН2-СН2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим вторичную аминогруппу (например, -NHR101) или третичную аминогруппу (-NR101R102), или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин, где каждая из R101 и R102, независимо, является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода;

G выбрана из -СН- или -N-.

[197] В некоторых вариантах воплощения W является -N(Re)-.

[198] В некоторых вариантах воплощения Re является -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода.

[199] В некоторых вариантах воплощения Rk является -Н или -Me, n равен 4, a q равен 2.

[200] В некоторых вариантах воплощения Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[201] В некоторых вариантах воплощения Rx является -(СН2)р-(CRfRg)-, где каждая из Rf и Rg независимо, выбрана из -Н или линейного или разветвленного алкила, имеющего от 1 до 4 атомов углерода; а р равен 0, 1, 2 или 3.

[202] В некоторых вариантах воплощения Rf и Rg являются одинаковыми или различными и выбраны из -Н и -Me; а р равен 1.

[203] В некоторых вариантах воплощения

Y является -SO3M, -SO2M или сульфатом -OSO3M; предпочтительно -SO3M;

М является -Н или фармацевтически приемлемым катионом (например, Na+);

X' и Y' оба являются -Н;

А и А' оба являются -O-;

R6 является -ОМе; а

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[204] В некоторых вариантах воплощения бифункциональный сшивающий агент является:

группой на основе малеимида, выбранной из: N-сукцинимидил-4-(малеимидометил)циклогексанкарбоксилата (SMCC), N-сукцинимидил-4-(N-малеимидометил)-циклогексан-1-карбокси-(6-амидокапроата) (LC-SMCC), N-сукцинимидилового эфира κ-малеимидундекановой кислоты (KMUA), N-сукцинимидилового эфира γ-малеимидмасляной кислоты (GMBS), N-гидроксисукцинимидного эфира ε-малеимидокапроновой кислоты (EMCS), м-малеимидобензоил-N-гидроксисукцинимидного эфира (MBS), N-(α-малеимидоацетокси)-сукцинимидного эфира (AMAS), сукцинимидил-6-(β-малеимидопропионамидо)гексаноата (SMPH), N-сукцинимидил-4-(п-малеимидофенил)бутирата (SMPB), N-(п-малеимидофенил)изоцианата (PMPI), N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноата; либо группой на основе галоацетила, выбранной из: Н-сукцинимидил-4-(иодоацетил)-аминобензоата (SIAB), N-сукцинимидилиодоацетата (SIA), N-сукцинимидилбромоацетата (SBA) и N-сукцинимидил-3-(бромоацетамидо)пропионата (SBAP), бис-малеимидополиэтиленгликоля (ВМРЕО), ВМ(РЕО)2, ВМ(РЕО)3, N-(β-малеимидопропилокси)сукцинимидного эфира (BMPS), NHS 5-малеимидовалериановой кислоты, HBVS, гидразида⋅HCl 4-(4-N-малеимидофенил)-масляной кислоты (МРВН), сукцинимидил-(4-винилсульфонил)бензоата (SVSB), дитиобис-малеимидоэтана (DTME), 1,4-бис-малеимидобутана (ВМВ), 1,4-бисмалеимидил-2,3-дигидроксибутана (BMDB), бис-малеимидогексана (ВМН), бис-малеимидоэтана (ВМОЕ), сульфосукцинимидил 4-(N-малеимидо-метил)циклогексан-1 -карбоксилата (сульфо-SMCC), сульфосукцинимидил(4-иодо-ацетил)аминобензоата (сульфо-SIAB), м-малеимидобензоил-N-гидроксисульфосукцинимидного эфира (сульфо-MBS), N-(γ-малеимидобутирилокси)сульфосукцинимидного эфира (сульфо-GMBS), N-(ε-малеимидокапроилокси)сульфосукцинимидного эфира (сульфо-EMCS), N-(κ-малеимидоундеканоилокси)сульфосукцинимидного эфира (сульфо-KMUS), сульфосукцинимидил-4-(п-малеимидофенил)бутирата (сульфо-SMPB), СХ1-1, сульфо-Mal и ПЭГn-Mal.

[205] В некоторых вариантах воплощения бифункциональный сшивающий агент выбран из группы, состоящей из SMCC, сульфо-SMCC, BMPS, GMBS, SIA, SIAB, N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноата, бис-малеимидогексана или ВМРЕО.

[206] В некоторых вариантах воплощения модифицированный СВА, если присутствует, является:


[207] В тринадцатом специфическом варианте воплощения имин-содержащее цитотоксическое соединение является:

[208] Бифункциональные сшивающие агенты могут являться любыми бифункциональными линкерами, известными в данной области техники. Например, бифункциональные линкеры, которые можно использовать для изготовления соединений лекарственное вещество-линкер, являются линкерами, образующими дисульфидные связи, простые тиоэфирные связи, кислотнолабильные связи, фотолабильные связи, пептидазо-лабильные связи и эстеразо-лабильные связи с цитотоксическими соединениями (см., например, патенты США 5208020; 5475092; 6441163; 6716821; 6913748; 7276497; 7276499; 7368565; 7388026 и 7414073, включенные в настоящий документ посредством ссылки). Предпочтительно бифункциональные сшивающие агенты являются агентами, образующими дисульфидные связи, простые тиоэфирные связи и пептидазо-лабильные связи с цитотоксическими соединениями. Другие бифункциональные сшивающие агенты, которые можно использовать в настоящем изобретении, включают нерасщепляемые линкеры, например линкеры, описанные в публикации патента США №2005/0169933, или заряженные линкеры, или гидрофильные линкеры и описанные в US 2009/0274713, US 2010/01293140 и WO 2009/134976, каждый из которых специально включен в настоящий документ посредством ссылки. Бифункциональные сшивающие агенты, которые можно использовать для изготовления соединений лекарственное вещество-линкер по настоящему изобретению, также включают соединения, описанные в Thermo Scientific Pierce Crosslinking Technical Handbook, содержание которой полностью включено в настоящий документ посредством ссылки.

[209] В еще одном предпочтительном варианте лекарственное вещество (с или без линкерной группы с присоединенной к ней реакционно-способной группой), которое можно использовать в настоящем изобретении, является любым из соединений, показанных в Таблицах 1-7. В еще одном предпочтительном варианте воплощения конъюгат связывающийся с клетками агент/лекарственное вещество, который можно изготовить согласно настоящему изобретению, является любым из конъюгатов, показанных в Таблице 8.

Таблица 1.
Структуры типичных соединений по настоящему изобретению.
n=1 или 3
m=3 или 4
W=ОН, ОМе, ONHS, NHNH2, H, Me, Ph, пептид
X=CH2, О, S, NH или NMe
Y=CH2 или отсутствует
Zʺ=H, Me, SMe, S(CH2)3C(O)NHS или СН2С(O)NHS или BMPS или SMCC или SPy или SPy-NO2

Таблица 2.
Структуры типичных соединений по настоящему изобретению (продолжение).
n=1, 2 или 3
m=3 или 4
W=ОН, OMe, ONHS, NHNH2, H, Me, Ph, пептид
X=CH2, O, S, NH, NMe
Y=отсутствует или CH2
Z=CH или N
Z'=H, Me, SMe, S(CH2)3C(O)NHS или СН2С(O)NHS или BMPS или SMCC или SPy или SPy-NO2

Таблица 3.
Структуры типичных соединений по настоящему изобретению (продолжение).
n=1, 2 или 3
m=3 или 4
W=ОН, OMe, ONHS, NHNH2, H, Me, Ph, пептид
X=CH2, O, S, NH, NMe
Z=CH или N
Zʺ=H, Me, SMe, 8(СН2)3С(O)NHS или CH2C(O)NHS или BMPS или SMCC или SPy или SPy-NO2

Таблица 4.
Структуры типичных соединений по настоящему изобретению (продолжение).
n=1, 2 или 3
m=3 или 4
W=ОН, ОМе, ONHS, NHNH2, Н, Me, Ph, пептид
Х=СН2, О, S, NH, NMe
Z=СН или N
Zʺ=Н, Me, SMe, S(СН2)3С(O)NHS или CH2C(O)NHS или BMPS или SMCC или SPy или SPy-NO2

Таблица 5.
Структуры типичных соединений по настоящему изобретению.

Таблица 6.
Структуры типичных соединений по настоящему изобретению (продолжение).

Таблица 7.
Структуры типичных соединений по настоящему изобретению (продолжение).

Таблица 8.
Структуры типичных конъюгатов по настоящему изобретению.

[210] В любом из соединений или конъюгатов, описанных выше в Таблицах 1-8, двойная иминная связь может взаимодействовать/прореагировать с любым из реагентов, способных взаимодействовать с иминами (например, реагентами, описанными здесь), в соответствии со способами по изобретению, с образованием аддуктов, в том числе аддуктов бисульфита. Такие имин-блокированные аддукты в соединениях из Таблиц 1-7 можно использовать в дальнейших реакциях, в соответствии со способами по настоящему изобретению, с целью получения конъюгатов по изобретению. Аналогично соединения, содержащие имин-блокированные аддукты, можно использовать в способах по настоящему изобретению для получения конъюгатов из Таблицы 8.

[211] В еще одном варианте воплощения лекарственные вещества, необязательно содержащие связывающую группу (например, линкерную группу с присоединенной к ней реакционно-способной группой), которые можно использовать в способах по настоящему изобретению, представлены формулой (А1) или (А2):


двойная линия между N и С представляет собой одинарную связь или двойную связь, при условии, что по меньшей мере одна из между N и С представляет собой двойную связь, и, когда она является двойной связью, Х отсутствует, a Y является -Н, а когда она является одинарной связью, Х является -Н или амино-блокирующей группой, преобразующей соединение в пролекарство; в предпочтительном случае, когда она является двойной связью, Х отсутствует, Y является -Н, а двойная связь может взаимодействовать с реагентом по изобретению, способным взаимодействовать с иминами, с образованием аддукта (например, аддукта бисульфита), перед использованием аддукта в способах по изобретению с целью получения конъюгатов лекарственное вещество/СВА;

Y выбрана из -Н, -OR, сложного эфира, представленного -OCOR', карбоната, представленного -OCOOR', карбамата, представленного -OCONR'Rʺ, амина или гидроксиламина, представленного -NR'Rʺ, амида, представленного -NRCOR', пептида, представленного -NRCOR', где Р является аминокислотой или полипептидом, содержащим от 2 до 20 аминокислот, тиоэфиром, представленным -SR', сульфоксидом, представленным -SOR', сульфоном, представленным -SO2R', сульфитом -SO3, бисульфитом -OSO3, -SO2M, -SO3M, -OSO3M, галогеном, цианогруппой, азидогруппой или тиолом; где М является -Н или фармацевтически приемлемым катионом (например, Na+); или

Y является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (Р(=S)(ORk')(S)(ОН) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+ или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом;

R, R' и Rʺ являются одинаковыми или различными и выбраны из -Н, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономером полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20), 5- или 6-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, 5-18-членной системы конденсированных колец, где по меньшей мере одно из колец является ароматическим, содержащей один или более гетероатомов, независимо выбранных из азота, кислорода и серы, арила, имеющего от 6 до 18 атомов углерода, 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, выбранных из О, S, N и Р, где заместитель выбран из галогена, -OR7, -NR8R9, -NO2, -NRCOR', -SR10, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфита -SO3, бисульфита -OSO3, сульфонамида, представленного -SO2NRR', цианогруппы, азидогруппы, -COR11, -OCOR11 или -OCONR11R12;

каждая из R7, R8, R9, R10, R11 и R12, независимо, выбрана из -Н, линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20), 5- или 6-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, 5-18-членной системы конденсированных колец, где по меньшей мере одно из колец является ароматическим, содержащей один или более гетероатомов, независимо выбранных из азота, кислорода и серы, арила, имеющего от 6 до 18 атомов углерода, 3-10-членного гетероциклического кольца, имеющего 3-18-членное гетероциклическое кольцо, имеющее от 1 до 6 гетероатомов, выбранных из О, S, N и Р, а R10, необязательно, является SR13 или COR13;

R13 выбрана из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, 5- или 6-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, 5-18-членной системы конденсированных колец, где по меньшей мере одно из колец является ароматическим, содержащим один или более гетероатомов, независимо выбранных из азота, кислорода и серы, арила, имеющего от 6 до 18 атомов углерода, 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, выбранных из О, S, N и Р, R11, необязательно, является OR14, где R14 имеет то же значение, что и R, Rʺ, необязательно, является -ОН;

W является С=O, C=S, CH2, ВН, SO и SO2;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из -Н, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20), или заместителя, выбранного из галогена, гуанидиния [-NH(C=NH)NH2], -OR7, -NR8R9, -NO2, -NRCOR', -SR10, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфита -SO3, бисульфита -OSO3, сульфонамида, представленного -SO2NRR', цианогруппы, азидогруппы, -COR11, -OCOR11 или -OCONR11R12, где R7, R8, R9, R10, R11 и R12 такие, как определено выше, необязательно, каждая из R1, R2, R3, R4, R1', R2', R3' или R4' является линкерной группой с присоединенной к ней реакционно-способной группой (если присутствует), которую можно выбрать из мономера полипирроло, полииндолила, полиимидазолила, полипирролоимидазолила, полипирролоиндолила или полиимидазолоиндолила, необязательно несущего линкерную группу с присоединенной к ней реакционно-способной группой;

Z выбрана из -(СН2)n-, где n равен 1, 2 или 3, -CR15R16, -NR17, -O- или -S-, где каждая из R15, R16 и R17, независимо, выбрана из -Н, линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20);

R6 является -OR, -SR или -NRR', где R и R' соответствуют вышеприведенным определениям, необязательно, R6 является связывающей группой с присоединенной к ней реакционно-способной группой (если присутствует);

X' выбран из -СН2, -NR, -СО, -ВН, -SO или -SO2, где R соответствует вышеприведенному определению;

Y' является -O-, -СН2-, -NR или -S, где R соответствует вышеприведенному определению;

Z' является -СН2 или -(СН2)n, где n равен 2, 3 или 4, при условии, что не все из X', Y' и Z' являются СН2 одновременно;

А и А' являются одинаковыми или различными и выбраны из -O-, -CRR'O, S, -CRR'S, -NR15 или -CRR'NHR15, где R и R' соответствуют вышеприведенным определениям и где R15 имеет то же значение, что и R;

D и D' являются одинаковыми или различными и, независимо, выбраны из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного любым из галогена, -OR7, -NR8R9, -NO2, -NRCOR', -SR10, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфита -SO3, бисульфита -OSO3, сульфонамида, представленного -SO2NRR', цианогруппы, азидогруппы, -COR11, -OCOR11 или -OCONR11R12, где определения R7, R8, R9, R10, R11 и R12 соответствуют вышеопределенным, или мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20);

L является необязательной фенильной группой или 3-18-членным гетероциклическим кольцом, имеющим от 1 до 6 гетероатомов, выбранных из О, S, N и Р, необязательно замещенным, причем заместитель является связывающей группой с присоединенной к ней реакционно-способной группой (если присутствует) или выбран из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного любым из галогена, -OR7, -NR8R9, -NO2, -NRCOR', -SR10, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфита -SO3, бисульфита -OSO3, сульфонамида, представленного -SO2NRR', цианогруппы, азидогруппы, -COR11, OCOR11 или OCONR11R12, где R7, R8, R9, R10, R11 и R12 соответствуют вышеприведенным определениям, мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20); необязательно, L сама по себе является связывающей группой с присоединенной к ней реакционно-способной группой или ее фармацевтически приемлемыми сольватами, солями, гидратами или гидратированными солями, их оптическими изомерами, рацематами, диастереомерами, энантиомерами или полиморфными кристаллическими структурами указанных соединений; при условии, что указанное соединение содержит не более одной связывающей группы с присоединенной к ней реакционно-способной группой.

[212] В одном предпочтительном варианте воплощения для лекарственных веществ формулы (А1) и (А2):

двойная линия между N и С представляет собой одинарную связь или двойную связь, при условии, что, когда она является двойной связью, Х отсутствует, a Y является -Н, а когда она является одинарной связью, Х является -Н или амино-блокирующей группой, преобразующей соединение в пролекарство;

Y выбрана из -Н, -OR, NR'Rʺ, сульфита -SO3M или бисульфита -OSO3M, где М является -Н или фармацевтически приемлемым катионом (например, Na+);

R выбрана из -Н, линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля (-OCH2CH2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20), арила, имеющего от 6 до 10 атомов углерода, гетероциклического кольца, имеющего от 3 до 10 атомов углерода;

W является С=O, СН2 или SO2;

R1, R2, R3, R4, R1', R2'. Каждая из R3' и R4', независимо, выбрана из -Н, -NO2 или связывающей группы с присоединенной к ней реакционно-способной группой (если присутствует);

R6 является –OR18, где R18 соответствует определению для R;

Z выбрана из -(СН2)n, где n равен 1, 2 или 3, -CR15R16, -NR17, -O- или -S-, где каждая из R15, R16 и R17, независимо, выбрана из -Н, линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20);

X' выбрана из -СН2 или С=O;

Y' является -O-, -NR или -S, где R соответствует вышеприведенному определению;

Z' является -СН2- или -(СН2)2-;

каждая из А и А' является -O-;

D и D' являются одинаковыми или различными и, независимо, выбраны из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода;

L является необязательной фенильной группой или гетероциклическим кольцом, имеющим от 3 до 10 атомов углерода, необязательно замещенным, причем заместитель является связывающей группой с присоединенной к ней реакционно-способной группой (если присутствует) или выбран из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного любым из галогена, -OR7, -NR8R9, -NO2, -NRCOR', -SR10, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфита -SO3, бисульфита -OSO3, сульфонамида, представленного -SO2NRR', цианогруппы, азидогруппы, -COR11, -OCOR11 или –OCONR11R12, мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 2000 (предпочтительно 1-200 или 1-20); необязательно, L сама по себе является связывающей группой с присоединенной к ней реакционно-способной группой; или ее фармацевтически приемлемыми сольватами, солями, гидратами или гидратированными солями, их оптическими изомерами, рацематами, диастереомерами, энантиомерами или полиморфными кристаллическими структурами указанных соединений.

[213] В еще одном предпочтительном варианте воплощения лекарственное вещество формулы (А1) или (А2) представлено соединениями формул (А4) или (А5):


двойная линия между N и С представляет собой одинарную связь или двойную связь, при условии, что, когда она является двойной связью, Х отсутствует, a Y является -Н, а когда она является одинарной связью, Х является -Н или амино-блокирующей группой, преобразующей соединение в пролекарство;

Y выбрана из -Н, -ОН, эфира, представленного -OR, -NR'Rʺ, сульфита -SO3M или бисульфита -OSO3M;

М является -Н или фармацевтически приемлемым катионом (например, Na+;

R, R' и Rʺ выбраны из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода;

одна из R2, R3, R2' и R3' является связывающей группой с присоединенной к ней реакционно-способной группой (если присутствует), а другие являются -Н, -NRCOR' или -NO2;

R6 является -OR, где R соответствует вышеприведенному определению;

Z является -СН2- или -NR, где R соответствует вышеприведенному определению;

А является -О- или -NR15;

L является -(CH2)nn-, где nn является 0 или целым числом от 1 до 5, или замещенным или незамещенным алкилом или алкенилом, имеющим от 2 до 4 атомов углерода, причем заместитель выбран из галогена, -OR7, -NR8R9, -NO2, -NRCOR', -SR10, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфита -SO3, бисульфита -OSO3, сульфонамида, представленного -SO2NRR', цианогруппы, азидогруппы, -COR11, -OCOR11 или -OCONR11R12;

R7, R8, R9, R10, R11, R12 и R15 соответствуют вышеприведенному определению;

необязательно, L сама по себе является связывающей группой с присоединенной к ней реакционно-способной группой (елей присутствует);

одна из L', Lʺ или Lʺ' является связывающей группой с прикрепленной к ней реакционно-способной группой (если присутствует), в то время как другие являются -Н;

предпочтительно L' является связывающей группой с прикрепленной к ней реакционно-способной группой (если присутствует); а

G является -СН- или -N-, или их фармацевтически приемлемыми сольватами, солями, гидратами или гидратированными солями, их оптическими изомерами, рацематами, диастереомерами, энантиомерами или полиморфными кристаллическими структурами указанных соединений.

[214] В еще одном предпочтительном варианте воплощения соединение формулы (А1) или (А2) представлено соединениями формул (А6) или (А7):


двойная линия между N и С представляет собой одинарную связь или двойную связь, при условии, что, когда она является двойной связью, Х отсутствует, a Y является -Н, а когда она является одинарной связью, Х является -Н или амино-блокирующей группой, преобразующей соединение в пролекарство;

Y выбрана из -Н, -ОН, эфира, представленного -OR, сульфита -SO3 или бисульфита -OSO3;

R выбрана из линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода;

nn равен 0 или целому числу от 1 до 5;

одна из R2, R3, R2' и R3' является связывающей группой с присоединенной к ней реакционно-способной группой (если присутствует), а другие являются -Н, -NRCOR' или -NO2;

одна из L', Lʺ или Lʺ' является связывающей группой с прикрепленной к ней реакционно-способной группой (если присутствует), при условии, что, если одна из L', Lʺ или L'" является связывающей группой с прикрепленной к ней реакционно-способной группой, другие являются -Н (например; если L' является связывающей группой с прикрепленной к ней реакционно-способной группой, то Lʺ и Lʺ' являются -Н);

G является -СН- или -N-, или их фармацевтически приемлемыми сольватами, солями, гидратами или гидратированными солями, их оптическими изомерами, рацематами, диастереомерами, энантиомерами или полиморфными кристаллическими структурами указанных соединений.

[215] В другом специфическом варианте воплощения одна из R2, R3, R2' и R3' формул (А4) и (А6) является связывающей группой с присоединенной к ней реакционно-способной группой (если присутствует) и представлена формулой -W'-Rx-V-Ry-J, а другие являются -Н; Lʺ и Lʺʺ формул (А5) и (А7) являются -Н, а L' является связывающей группой с присоединенной к ней реакционно-способной группой (если присутствует) и представлена формулой



W' отсутствует, является -CRcRe-, -O-, -O-С(=O)-, -S-, -CH2-S-, -O-(С=O)O-, -O-(C=O)N(Re)-, -N(Re)-, -N(Re)-C(=O)-, -N(Re)-C(=O)O- или -С(=O)-;

Rx отсутствует или является необязательно замещенным линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода;

V отсутствует, является -(СН2-СН2-O)n-, -O-, -O-С(=O)-, -S-, -O-(С=O)O-, O-(C=O)N(Re)-, -N(Re)-, -N(Re)-C(=O)-, -N(Re)-C(=O)O-, -C(=O)-, аминокислотой или пептидом, имеющим от 2 до 8 аминокислот;

Ry отсутствует или является линейным, разветвленным или циклическим алкилом, имеющим от 1 до 10 атомов углерода;

Rc является -Н или линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода;

Re является -Н, линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или -(CH2-CH2-O)n-Rc,

n является целым числом от 1 до 24; а

J соответствует описанию, приведенному выше в четвертом специфическом варианте воплощения.

[216] Предпочтительно Rc является -Н или -Me; Re является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода, или -(СН2-СН2-O)n-Rc, n является целым числом от 2 до 8, а остальные переменные соответствуют описанию, приведенному выше в четвертом специфическом варианте воплощения.

[217] В еще одном предпочтительном варианте воплощения V является аминокислотой или пептидом, имеющим от 2 до 8 аминокислот. Более предпочтительно V является валин-цитруллином, gly-gly-gly или ala-leu-ala-leu.

[218] Предпочтительно J является -SH, -SSRd или -СОЕ, как описано выше.

[219] В еще одном специфическом варианте воплощения одна из R2, R3, R2' и R3' формулы (А4) и (А6) является связывающей группой с присоединенной к ней реакционно-способной группой (если присутствует), и представлена формулой -W'-Rx-S-Zs; Lʺ и Lʺ' формул (А5) и (А7) являются -Н, a L' представлена -W'-Rx-S-Zs, где переменные соответствуют описанию, приведенному в восьмом и девятом специфических вариантах воплощения.

[220] В другом варианте воплощения соединения формулы (А1)-(А7) (с или без предварительного инкубирования с реагентом, способным взаимодействовать с иминами), если связывающая группа с присоединенной к ней реакционно-способной группой уже отсутствует, может далее взаимодействовать с бифункциональным сшивающим реагентом, описанным выше, с образованием имин-содержащего лекарственного вещества, несущего связывающую группу с присоединенной к ней реакционно-способной группой, которое можно использовать в способах по настоящему изобретению.

[221] В некоторых вариантах воплощения имин-содержащее лекарственное вещество, несущее связывающую группу с присоединенной к ней реакционно-способной группой, которое можно использовать в способах по настоящему изобретению, представлено любой из следующих формул:


"Линкер" представлен формулой (а1), (а2), (а3), (а4), (а5), (а6), (а7) или (а8), описанной выше (в девятом специфическом варианте воплощения);

q является целым числом от 1 до 5;

n является целым числом от 2 до 6;

D является -Н или -SO3M;

М является -Н или фармацевтически приемлемым катионом, например Na+ или K+; а остальные переменные соответствуют описанию в восьмом или девятом специфических вариантах воплощения.

[222] Предпочтительно q равен 2, а n равен 4.

[223] В предпочтительном варианте воплощения линкер представлен формулой (а1), (а4), (а5), (а9) или (а10), описанной выше.

[224] В некоторых вариантах воплощения для соединений формулы (А8), описанных непосредственно выше, переменные соответствуют описанию, приведенному ниже;

W' является -O-, -N(Re)-, -N(Re)-C(=O)-, -N(CORe)-, -S- или -CH2-S-;

Rx отсутствует или выбрана из линейного, разветвленного или циклического алкила, имеющего от 1 до 6 атомов углерода;

Re является -Н, линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным или циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим первичную, вторичную или третичную аминогруппу или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин;

n является целым числом от 1 до 24, а остальные переменные соответствуют описанию, приведенному в варианте воплощения непосредственно выше.

[225] Предпочтительно Rk является -Н или -Me, a n является целым числом от 2 до 8. Предпочтительно Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[226] В еще одном предпочтительном варианте воплощения линкер представлен любой формулой, выбранной из формул (а1), (а4), (а5), (а10) и (a11), показанных выше, а остальные переменные соответствуют описанию, приведенному выше в девятом специфическом варианте воплощения.

[227] В некоторых вариантах воплощения для соединений формулы (А8), описанных выше в вариантах воплощения, переменные соответствуют описанию, приведенному ниже:

X' и Y' оба являются -Н;

А и А' оба являются -O-;

R6 является -ОМе;

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода, а остальные переменные соответствуют описанию, приведенному выше.

[228] Предпочтительно Rx является -(СН2)р-(CRfRg)-, где каждая из Rf и Rg, независимо, выбрана из -Н или линейного, или разветвленного алкила, имеющего от 1 до 4 атомов углерода; р равен 0, 1, 2 или 3. Более предпочтительно Rf и Rg являются одинаковыми или различными и выбраны из -Н и -Me, а р равен 1.

[229] В еще одном предпочтительном варианте воплощения линкер представлен любой формулой, выбранной из формул (а1), (а4), (а5), (а10) и (a11), показанных выше, а остальные переменные соответствуют описанию, приведенному выше.

[230] В еще одном предпочтительном варианте воплощения лекарственное вещество формулы (А1), (А2) или (A3) является любым из соединений, показанных в Таблицах 11-13, а конъюгат, который можно изготовить согласно способу по настоящему изобретению, является любым из конъюгатов, показанных в Таблице 14.

Таблица 11.
Структуры типичных лекарственных веществ, которые можно использовать в способах по настоящему изобретению.
Примечание: Zʺ=Н, SMe, SPy, SPy-NO2, Ac; Xʺ'=NHS;

Таблица 12.
Структуры типичных лекарственных веществ, которые можно использовать в способах по настоящему изобретению (продолжение).
Примечание: Zʺ=Н, SMe, SPy, SPy-NO2, Ac; Xʺ'=NHS;

Таблица 13.
Структуры типичных лекарственных веществ, которые можно использовать в способах по настоящему изобретению (продолжение).

Таблица 14.
Структуры типичных конъюгатов, которые можно изготовить согласно способам по настоящему изобретению.

[231] Любые соединения из Таблиц 11-13 и любые конъюгаты из Таблицы 14 могут содержать по меньшей мере одну из иминных связей, взаимодействующих с исследуемым реагентом, способным взаимодействовать с иминами, таким образом образуя аддукт, например аддукт бисульфита.

[232] В одном варианте воплощения имин-содержащее лекарственное вещество, несущее связывающую группу, является соединениями, имеющими реакционно-способную сложноэфирную группу, тиол или группу, способную взаимодействовать с тиолами, описанную выше.

[233] Альтернативно вышеописанное лекарственное вещество может дополнительно взаимодействовать с бифункциональным сшивающим агентом с образованием лекарственного вещества, несущего связывающую группу. Можно использовать любые описанные бифункциональные сшивающие агенты.

[234] В еще одном предпочтительном варианте воплощения лекарственное вещество, которое можно использовать в настоящем изобретении, является любым из соединений, показанных в Таблице 15.

Таблица 15.
Типичные лекарственные соединения, которые можно использовать в способах по настоящему изобретению.


[235] Эффективность конъюгатов по изобретению в качестве терапевтических агентов зависит от тщательного подбора соответствующего агента, связывающегося с клетками. Агенты, связывающиеся с клетками, могут являться агентами любого типа, известного в настоящее время, или исследуемыми агентами и включают пептиды и непептидные соединения. В общем случае они могут являться антителами (особенно моноклональными антителами), лимфокинами, гормонами, факторами роста, витаминами (например, фолатом и т.д., способным связываться с рецептором поверхности клеток, например рецептором фолата), молекулами-переносчиками питательных веществ (например, трансферрином) или любой другой молекулой или веществом, связывающимся с клетками.

[236] В некоторых вариантах воплощения агенты, связывающиеся с клетками, являются белками или полипептидами, или соединениями, включающими белки или полипептиды. Предпочтительно белки или полипептиды включают один или более остатков Lys с -NH3-группами боковой цепи. В качестве альтернативы или дополнения белки или полипептиды включают один или более остатков Cys. -SH-группы боковой цепи остатков Cys могут являться интактными или могут находиться в составе дисульфидной связи, которую можно восстановить. Предпочтительно восстановление дисульфидной(ых) связи(ей) не оказывает существенного отрицательного влияния на функцию связывания с клетками белков или полипептидов (например, в случае антитела или его антиген-связывающего фрагмента восстановление дисульфидных связей не приводит к существенному усилению диссоциации легких цепей/тяжелых цепей).

[237] -NH2-группы боковой цепи Lys и/или -SH-группы боковой цепи Cys могут быть ковалентно соединены с линкерами, которые, в свою очередь, соединены с димерными соединениями по изобретению, тем самым осуществляя конъюгирование агентов, связывающихся с клетками, с димерными соединениями по изобретению. Каждые белковые агенты, связывающиеся с клетками, могут содержать несколько -NH2-групп боковых цепей Lys и/или -SH-групп боковой цепи Cys, доступных для связывания соединения по изобретению посредством бифункциональных сшивающих агентов.

[238] В частности, примеры агентов, связывающихся с клетками, которые можно использовать, включают:

поликлональные антитела;

моноклональные антитела;

фрагменты антител, например Fab, Fab' и F(ab’)2, Fv, минитела, диатела, тритела, тетратела (Parham, J. Immunol. 131:2895-2902 (1983); Spring et al. J. Immunol. 113:470-478 (1974); Nisonoff et al. Arch. Biochem. Biophys. 89:230-244 (1960), Kim et al., Mol, Cancer Ther., 7: 2486-2497 (2008), Carter, Nature Revs., 6: 343-357 (2006));

интерфероны (например, α, β, γ);

лимфокины, например IL-2, IL-3, IL-4, IL-6;

гормоны, например инсулин, TRH (тиреотропин-рилизинг-гормон), МСГ (меланотропин-стимулирующий гормонион), стероидные гормоны, например андрогены и эстрогены;

факторы роста и колониестимулирующие факторы, например ЭФР, ТФР-альфа, FGF, ФРЭС, ГКСФ, МКСФ и ГМ-КСФ (Burgess, Immunology Today 5:155-158 (1984));

трансферрин (O'Keefe et al. J. Biol. Chem. 260:932-937 (1985));

витамины, например фолат;

белковые каркасные структуры на основе консенсусной последовательности повторов фибронектина III типа (FN3) (также известных как Centyrins; см. публикацию патента США 2010/0255056, включенную в настоящий документ посредством ссылки);

сконструированные белки с анкириновым повтором (DARPin; заявки на патент США под номерами 20040132028; 20090082274; 20110118146; 20110224100, включенные в настоящий документ посредством ссылки, С. Zahnd et al. 2010, Cancer Res., 70; 1595-1605, включенная в настоящий документ посредством ссылки); и

каркасные белки домена фибронектина (аднектины: заявки на патент США под номерами 20070082365; 20080139791, включенные в настоящий документ посредством ссылки).

[239] Методики моноклональных антител обеспечивают продукцию чрезвычайно специфических агентов, связывающихся с клетками, в виде специфических моноклональных антител. Особенно хорошо известны в данной области методики создания моноклональных антител, продуцируемых путем иммунизации мышей, крыс, хомяков или любого другого млекопитающего представляющим интерес антигеном, например интактной клеткой-мишенью, антигенами, выделенными из клетки-мишени, цельным вирусом, ослабленным цельным вирусом и вирусными белками, например белками оболочки вируса. Кроме того, можно использовать сенсибилизированные клетки человека. Еще одним способом создания моноклональных антител является использование фаговых библиотек scFv (одноцепочечных вариабельных областей), в частности, scFv человека (см., например, Griffiths et al., патенты США под номерами 5885793 и 5969108; McCafferty et al., WO 92/01047; Liming et al., WO 99/06587). Кроме того, можно использовать антитела с модифицированной поверхностью, описанные в патенте США №5639641, а также химерные и гуманизированные антитела. Выбор подходящего агента, связывающегося с клетками, зависит от конкретной популяции клеток, являющейся потенциальной мишенью, однако в целом предпочтительны моноклональные антитела человека, если доступно соответствующее антитело.

[240] Например, моноклональное антитело MY9 является IgG1-антителом мыши, специфически связывающимся с антигеном CD33 {J.D. Griffin et al 8 Leukemia Res., 521 (1984)}, и может использоваться, если клетки-мишени экспрессируют CD33, как при остром миелобластном лейкозе (ОМЛ). Агент, связывающий клетки, может являться любым соединением, способным связывать клетку специфическим или неспецифическим образом. Как правило, указанные агенты могут являться антителами (в частности, моноклональными антителами и фрагментами антител), интерферонами, лимфокинами, гормонами, факторами роста, витаминами, транспортными молекулами питательных веществ (например, трансферрином) или любой другой молекулой или веществом, связывающимся с клетками.

[241] Если агент, связывающийся с клетками, является антителом, он связывается с антигеном, который является полипептидом, и может являться трансмембранной молекулой (например, рецептором) или лигандом, например, фактором роста. Типичные антигены включают такие молекулы как ренин; гормон роста, включая гормон роста человека и бычий гормон роста; рилизинг-фактор гормона роста; паратиреоидный гормон; тиреотропный гормон; липопротеины; альфа-1-антитрипсин; А-цепь инсулина; В-цепь инсулина; проинсулин; фолликулостимулирующий гормон; кальцитонин; лютеинизирующий гормон; глюкагон; факторы свертывания крови, например фактор vmc, фактор IX, тканевый фактор (TF) и фактор Виллебранда; антикоагулянты, например протеин С; предсердный натрийуретический фактор; сурфактант легких; активатор плазминогена, например урокиназу, мочу человека или тканевый активатор плазминогена (t-PA); бомбезин; тромбин; гемопоэтический фактор роста; факторы некроза опухолей-альфа и -бета; энкефалиназу; RANTES (хемокин, экспрессируемый и выделяемый Т-клетками при активации); макрофагальный белок воспаления человека (MIP-1-альфа); сывороточный альбумин, например человеческий сывороточный альбумин; мюллерову ингибирующую субстанцию; А-цепь релаксина; В-цепь релаксина; прорелаксин; пептид, связанный с гонад отропином мыши; микробный белок, например бета-лактамазу; ДНазу; IgE; антиген, ассоциированный с цитотоксическими Т-лимфоцитами (CTLA), например CTLA-4; ингибин; активин; фактор роста эндотелия сосудов (ФРЭС); рецепторы гормонов или факторов роста; белок А или D; ревматоидные факторы; нейротрофический фактор, например нейротрофический фактор костей (BDNF), нейротрофин-3, -4, -5 или -6 (NT-3, NT-4, NT-5 или NT-6) или фактор роста нервов, например NGF-β; тромбоцитарный фактор роста (PDGF); фактор роста фибробластов, например aFGF и bFGF; рецептор 2 фактора роста фибробластов (FGFR2); эпидермальный фактор роста (ЭФР); трансформирующий ростовой фактор (ТРФ), например ТРФ-альфа и ТРФ-бета, включая ТРФ-β1, ТРФ-β2, ТРФ-β3, ТРФ-β4 или ТРФ-β5; инсулиноподобный фактор роста-I и -II (ИФР-I и ИФР-II); дез(1-3)-ИФР-I (ИФР-I головного мозга); белки, связывающие инсулиноподобный фактор роста; ЕрСАМ, GD3, FLT3, PSMA, PSCA, MUC1, MUC16, STEAP, СЕА, TENB2, рецепторы EphA, рецепторы EphB, рецептор фолата, FOLR1, мезотелин, cripto, альфаvбета6, интегрины, ФРЭС, VEGFR, EGFR, рецептор трансферрина, IRTA1, IRTA2, IRTA3, IRTA4, IRTA5; CD-белки, такие как CD2, CD3, CD4, CD5, CD6, CD8, CD11, CD14, CD19, CD20, CD21, CD22, CD25, CD26, CD28, CD30, CD33, CD36, CD37, CD38, CD40, CD44, CD52, CD55, CD56, CD59, CD70, CD79, CD80, CD81, CD103, CD105, CD134, CD137, CD138, CD152 или антитело, связывающееся с одним или более опухоль-ассоциированных антигенов или рецепторов поверхности клеток, описанных в публикации патента США №20080171040 или публикации патента США №20080305044 и полностью включенные посредством ссылки; эритропоэтин; остеоиндуктивные факторы; иммунотоксины; костный морфогенетический белок (КМБ); интерферон, например интерферон-альфа, -бета и -гамма; колониестимулирующие факторы (КСФ), например МКСФ, ГМ-КСФ и ГКСФ; интерлейкины (IL), например от IL-1 до IL-10; супероксиддисмутазу; Т-клеточные рецепторы; поверхностные белки мембран; стимулятор гемолиза (DAF-фактор); вирусный антиген, например фрагмент оболочки ВИЧ; транспортные белки; "хоминг"-рецепторы; адрессины; регуляторные белки; интегрины, например CD11a, CD11b, CD11c, CD18, ICAM, VLA-4 и VCAM; опухоль-ассоциированный антиген, например рецептор HER2, HER3 или HER4; эндоглин, c-Met, 1GF1R, PSGR, NGEP, PSMA, PSCA, LGR5, В7Н4 и фрагменты любого из вышеперечисленных полипептидов.

[242] Альтернативно ГМ-КСФ, связывающийся с миелоидными клетками, можно использовать в качестве агента, связывающего больные клетки при остром миелолейкозе. IL-2, связывающийся с активированными Т-клетками, можно использовать для профилактики отторжения трансплантата, для лечения и профилактики реакции трансплантат против хозяина, а также для лечения острого Т-клеточного лейкоза. МСГ, связывающийся с меланоцитами, можно использовать для лечения меланомы, как и антитела против меланомы. Фолиевую кислоту можно использовать для направленного воздействия на рецептор фолата, экспрессируемый опухолями яичников и другими опухолями. Эпидермальный фактор роста можно использовать для направленного воздействия на виды плоскоклеточного рака, например рак легких и головы, и шеи. Соматостатин можно использовать для направленного воздействия на нейробластому и другие типы опухолей.

[243] Рак молочной железы и яичек может являться мишенью эстрогена (или аналогов эстрогена) или андрогена (или аналогов андрогена), соответственно, используемых в качестве агентов, связывающихся с клетками.

[244] В одном варианте воплощения агент, связывающийся с клетками, является гуманизированными моноклональными антителами. В еще одном варианте воплощения агент, связывающийся с клетками, является huMy9-6 или другими родственными антителами, описанными в патентах США под номерами 7342110 и 7557189 (включенных в настоящее описание посредством ссылки). В еще одном варианте воплощения агент, связывающийся с клетками, является антителом против рецептора фолата, описанным в предварительных заявках США под номерами 61/307797, 61/346595, 61/413172 и заявке на патент США №13/033723 (опубликованной как US 2012-0009181 А1). Содержание всех указанных заявок полностью включено в настоящий документ посредством ссылки.

[245] В некоторых вариантах воплощения агент, связывающийся с клетками, может являться моноклональным антителом или его антиген-связывающими фрагментами, критическими для связывания антигена с антителом, описанных здесь, например, huMy9-6 или родственных ему антител, описанных в патентах США под номерами 7342110 и 7557189 (включенных в настоящий документ посредством ссылки). Указанные производные антител могут содержать практически одинаковые или идентичные (1) CDR3-области легкую цепь и/или тяжелой цепи; (2) CDR1, CDR2 и CDR3-области легкой цепи и/или тяжелой цепи; или (3) области легкой цепи и/или тяжелой цепи, по сравнению с антителом, описанным здесь. Последовательности в пределах этих областей могут содержать консервативные аминокислотные замены, в том числе замены внутри CDR-областей. Предпочтительно, чтобы было не более 1, 2, 3, 4 или 5 консервативных замен. В некоторых вариантах воплощения производные антител содержат область легкой цепи и/или область тяжелой цепи, по меньшей мере на 90%, 95%, 99% или 100% идентичные антителу, описанному здесь. Указанные производные антител могут обладать практически аналогичной специфичностью связывания и/или сродством к антигену-мишени по сравнению с антителом, описанным здесь. Предпочтительно значения Kd и/или koff производных антител находятся в пределах 10-кратных (выше или ниже), 5-кратных (выше или ниже), 3-кратных (выше или ниже) либо 2-кратных (выше или ниже) значений для антител, описанных здесь. Указанные производные антител могут являться полностью человеческими антителами или гуманизированными антителами, или химерными антителами. Производные антител можно получить любым из способов, известных в данной области техники.

[246] В одном варианте воплощения антитело против рецептора является гуманизированным антителом или его антиген-связывающим фрагментом, специфически связывающим рецептор 1 фолата человека, причем указанное антитело включает: (а) CDR1 тяжелой цепи, включающий GYFMN (SEQ ID NO:1); CDR2 тяжелой цепи, включающий RIHPYDGDTFYNQXaa1FXaa2Xaa3 (SEQ ID NO:2); и CDR3 тяжелой цепи, включающий YDGSRAMDY (SEQ ID NO:3) и (б) CDR1 легкой цепи, включающий KASQSVSFAGTSLMH (SEQ ID NO:4), CDR2 легкой цепи, включающий RASNLEA (SEQ ID NO:5); и CDR3 легкой цепи, включающий QQSREYPYT (SEQ ID NO:6); где Xaa1 выбрана из K, Q, Н и R; Хаа2 выбрана из Q, Н, N и R; а Хаа3 выбрана из G, Е, Т, S, А и V. Предпочтительно последовательность CDR2 тяжелой цепи включает RIHPYDGDTFYNQKFQG (SEQ ID NO:7).

[247] В еще одном варианте воплощения антитело против рецептора фолата является гуманизированным антителом или его антиген-связывающим фрагментом, специфически связывающим рецептор 1 фолата человека, включающим тяжелую цепь, обладающую аминокислотной последовательностью









[248] В еще одном варианте воплощения антитело против рецептора фолата является гуманизированным антителом или его антиген-связывающим фрагментом, кодируемым плазмидной ДНК, депонированной в АТСС 7 апреля 2010 года и имеющей номера депонирования АТСС РТА-10772 и РТА-10773 или 10774.

[249] В еще одном варианте воплощения антитело против рецептора фолата является гуманизированным антителом или его антиген-связывающим фрагментом, специфически связывающим рецептор 1 фолата человека, включающим легкую цепь, обладающую аминокислотной последовательностью









[250] В еще одном варианте воплощения антитело против рецептора фолата является гуманизированным антителом или его антиген-связывающим фрагментом, специфически связывающим рецептор 1 фолата человека, включающим тяжелую цепь, обладающую аминокислотной последовательностью SEQ ID NO:8, и легкую цепь, обладающую аминокислотной последовательностью SEQ ID NO:9 или SEQ ID NO:10. Предпочтительно антитело включает тяжелую цепь, обладающую аминокислотной последовательностью SEQ ID NO:8, и легкую цепь, обладающую аминокислотной последовательностью SEQ ID NO:10 (hu FOLR1).

[251] В еще одном варианте воплощения антитело против рецептора фолата является гуманизированным антителом или его антиген-связывающим фрагментом, кодируемым плазмидной ДНК, депонированной в АТСС 7 апреля 2010 года и имеющей номера депонирования АТСС РТА-10772 и РТА-10773 или 10774.

[252] В еще одном варианте воплощения антитело против рецептора фолата является гуманизированным антителом или его антиген-связывающим фрагментом, включающим вариабельный домен тяжелой цепи, по меньшей мере приблизительно на 90%, 95%, 99% или 100% идентичный QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIGRIHPYDGDT FYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDYWGQGTTVT VSS (SEQ ID NO:11), и вариабельный домен легкой цепи, по меньшей мере приблизительно на 90%, 95%, 99% или 100% идентичный DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRASNLEA GVPDRFSGSGSKTDFTLNISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKR (SEQ ID NO:12); или DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRASNLEA GVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKR (SEQ ID NO:13).

[253] Агент, связывающий клетки, например антитело, можно модифицировать гетеробифункциональным сшивающим агентом, несущим группу, способную взаимодействовать с аминами, например N-гидроксисукцинимидную группу (NHS-группу), способную взаимодействовать с тиолами малеимидогруппу, винилпиридин, винилсульфон, винилсульфонамид или группу на основе галоацетила, или тиоловую группу.

[254] Тиоловые остатки можно внедрить в состав антитела с помощью ряда способов, известных в данной области техники, в том числе: а) модификации антитела тиол-генерирующими реагентами, например 2-иминотиолана или тиолактона гомоцистеина, или б) посредством реакции с дисульфид-содержащим гетеробифункциональным сшивающим агентом, например SPP, SPDP, SPDB, сульфо-SPDB, с последующим восстановлением дисульфидной связи DTT или ТСЕР, получая свободный тиол, в) мутагенезом с целью внедрения неприродных остатков цистеина, например цистеин-сконструированные антитела (US 2007/0092940 A1, US 2010/0003766 A1, US 7723485 B2), или г) восстановления нативных дисульфидных связей (del Rosario, R. В. et al; Cancer Res. Suppl. 1990, 50, 804s-808s).

[255] Группу, способную взаимодействовать с тиолами, например малеимидо, винилпиридин, винилсульфон, винилсульфонамид или группу на основе галоацетила можно внедрить в антитело путем его модификации гетеробифункциональным сшивающим агентом, несущим группу, способную взаимодействовать с тиолами (включая SPDB, N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноат, сульфо-SMCC, SMCC, LC-SMCC, KMUA, BMPS, GMBS, сульфо-GMBS, EMCS, сульфо-EMCS, AMAS, SVSB, SPP, NHS-(n3r)n-mal, где n=1-24, предпочтительно 2, 4, 8, 12 и 24, но не ограничиваясь ими). Сшивающие агенты, включающие группу на основе малеимидогруппы, включают N-сукцинимидил-4-(малеимидометил)циклогексанкарбоксилат (SMCC), N-сукцинимидил-4-(N-малеимидометил)-циклогексан-1-карбокси-(6-амидокапроат), являющийся "длинноцепочечным" аналогом SMCC (LC-SMCC), N-сукцинимидильный эфир κ-малеимидоундекановой кислоты (KMUA), N-сукцинимидильный эфир γ-малеимидомасляной кислоты (GMBS), N-гидроксисукцинимидный эфир ε-малеимидокапроновой кислоты (EMCS), м-малеимидобензоил-N-гидроксисукцинимидный эфир (MBS), N-(α-малеимидоацетокси)-сукцинимидный эфир (AMAS), сукцинимидил-6-(β-малеимидопропионамидо)гексаноат (SMPH), N-сукцинимидил-4-(п-малеимидофенил)бутират (SMPB) и N-(п-малеимидофенил)изоцианат (PMPI). Описаны соединения, способные взаимодействовать с тиолами, содержащие винилпиридин (Friedman M. et. Al. Int. J. Peptide Protein Res. 1974, 6, 183-185; Mak A. et. Al. Anal. Biochem. 1978, 84, 432-440). Описаны соединения, способные взаимодействовать с тиолами, содержащие винилсульфоновую группу (Masri M. S. J. Protein Chem., 1988, 7, 49-54; Morpurgo, M. et. Al. Bioconjugate Chem. 1996, 7, 363-368). Сшивающие реагенты, включающие группу на основе галоацетила, включают N-сукцинимидил-4-(иодоацетил)-аминобензоат (SIAB), N-сукцинимидилиодоацетат (SIA), N-сукцинимидилбромоацетат (SBA) и N-сукцинимидил-3-(бромоацетамидо)пропионат (SBAP).

[256] Модифицированное антитело можно очистить с помощью любых подходящих способов, известных в данной области техники, например гель-фильтрации, тонкопленочной фильтрации или ионообменной хроматографии, или аффинной хроматографии.

[257] Все ссылки, приведенные здесь и в приведенных ниже примерах, специально полностью включены посредством ссылки.


[258] Настоящее изобретение обеспечивает усовершенствованные способы получения конъюгатов связывающийся с клетками агент/лекарственное вещество, включающих агент, связывающийся с клетками, присоединенный к одному или более цитотоксических соединений по настоящему изобретению с помощью различных линкеров, включая дисульфидные линкеры, простые тиоэфирные линкеры, линкеры на основе амидных связей, пептидазо-лабильные линкеры, кислото-лабильные линкеры, эстеразо-лабильные линкеры, но не ограничиваясь ими.

[259] Типичные конъюгаты, которые можно изготовить с помощью способов по изобретению, включают антитело/цитотоксическое соединение, фрагмент антитела/цитотоксическое соединение, эпидермальный фактор роста (ЭФР)/цитотоксическое соединение, меланотропин (МСГ)/цитотоксическое соединение, тиреотропин (ТТГ)/цитотоксическое соединение, соматостатин/цитотоксическое соединение, фолат/цитотоксическое соединение, эстроген/цитотоксическое соединение, аналог эстрогена/цитотоксическое соединение, андроген/цитотоксическое соединение и аналог андрогена/цитотоксическое соединение. Типичный конъюгат фолат/цитотоксическое соединение, содержащий необязательный аддукт -SO3Na при иминной связи одного из двух мономеров лекарственного вещества, изображен ниже. Типичная схема синтеза указанного конъюгата показана на Фиг.26.

[260] В предпочтительном варианте воплощения настоящее изобретение обеспечивает способы получения конъюгатов, включающих индолинобензодиазепиновое димерное соединение (например, формул (Ib'), (IIb'), (Iab'), (IIAb'), (IBb'), (IIBb'), (XIIIb'), (Xb') и т.д.) и агент, связывающийся с клетками, соединенные посредством ковалентной связи. Линкер может расщепляться в области опухоли/нежелательных пролиферирующих клеток, доставляя цитотоксический агент к его мишени различными путями. Линкер может быть расщепленным, например, при низком рН (гидразон), в восстанавливающей среде (дисульфид), путем протеолиза (амидная/пептидная связь) или путем ферментативной реакции (эстеразной/гликозидазной).

[261] В предпочтительном аспекте типичные цитотоксические конъюгаты, которые можно изготовить с помощью способов по изобретению, являются конъюгатами антитело/индолинобензодиазепиновое димерное соединение, фрагмент антитела/индолинобензодиазепиновое димерное соединение, эпидермальный фактор роста (ЭФР)/индолинобензодиазепиновое димерное соединение, меланотропин (МСГ)/индолинобензодиазепиновое димерное соединение, тиреотропин (ТТГ)/индолинобензодиазепиновое димерное соединение, соматостатин/индолинобензодиазепиновое димерное соединение, фолат/индолинобензодиазепиновое димерное соединение, эстроген/индолинобензодиазепиновое димерное соединение, аналог эстрогена/индолинобензодиазепиновое димерное соединение, ингибитор простатоспецифического мембранного антигена (PSMA)/индолинобензодиазепиновое димерное соединение, ингибитор матриптазы/индолинобензодиазепиновое димерное соединение, сконструированные белки с анкириновыми повторами (DARPin)/индолинобензодиазепиновое димерное соединение, андроген/индолинобензодиазепиновое димерное соединение и аналог андрогена/индолинобензодиазепиновое димерное соединение.

[262] Так, в четырнадцатом специфическом варианте воплощения способы по изобретению обеспечивают получение конъюгата, включающего: цитотоксическое соединение и агент, связывающийся с клетками (СВА), причем указанное цитотоксическое соединение ковалентно связано с СВА посредством связывающей группы, и фрагмент конъюгата, и при этом цитотоксическое соединение и связывающая группа, представлены любой из следующих формул:

или ее фармацевтически приемлемой солью, где:

Y является уходящей группой и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H2S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H1, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(ORk')(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'С(=O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где R1 является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом; предпочтительно Y является аддуктом бисульфита, гидросульфита или метабисульфита, или их солями (например, солью натрия);

X' выбрана из -Н, амин-блокирующей группы, связывающей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, и необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Y' выбрана из -Н, оксогруппы, связывающей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, необязательно замещенного 6-18-членного арила, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов;

Rc является -Н или замещенным, или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода или связывающей группой;

каждая из R1, R2, R3, R4, R1', R2', R3' и R4', независимо, выбрана из группы, состоящей из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2-CH2)n-Rc, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NCO, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3-M+, сульфата -OSO3-M+, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ и связывающей группы;

М является -Н или фармацевтически приемлемым катионом, например Na+;

R, в каждом случае независимо, выбрана из группы, состоящей из -Н, амин-блокирующей группы, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc, необязательно замещенного арила, имеющего от 6 до 18 атомов углерода, необязательно замещенного 5-18-членного гетероарильного кольца, содержащего один или более гетероатомов, независимо выбранных из азота, кислорода и серы, или необязательно замещенного 3-18-членного гетероциклического кольца, содержащего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

каждая из R' и Rʺ, независимо, выбрана из -Н, -ОН, -OR, -NHR, -NR2, -COR, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(CH2CH2O)n-Rc и необязательно замещенного 3-18-членного гетероциклического кольца, имеющего от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р;

Rc является -Н или замещенным, или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода или связывающей группой;

n является целым числом от 1 до 24;

W выбрана из С=O, C=S, CH2, ВН, SO и SO2;

R6 является -Н, -R, -OR, -SR, -NR'Rʺ, -NO2, галогеном или связывающей группой;

Z и Z', независимо, выбраны из -(CH2)n'-, -(CH2)n'-CR7R8-(CH2)na'-, -(CH2)n'-NR9-(CH2)na'-, -(СН2)n-O-(СН2)na'- И -(CH2)n'-S-(CH2)na'-;

n' и na' являются одинаковыми или различными и выбраны из 0, 1, 2 и 3;

R7 и R8 являются одинаковыми или различными, и каждая из них, независимо, выбрана из -Н, -ОН, -SH, -СООН, -NHR', мономера полиэтиленгликоля -(ОСН2СН2)n-, аминокислоты, пептидной единицы, несущей от 2 до 6 аминокислот, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

R9, независимо, выбрана из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(ОСН2СН2)n-;

А и А' являются одинаковыми или различными и, независимо, выбраны из -O-, оксо (-С(=O)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- и -CRR'N(R5)-,

R5, в каждом случае независимо, является -Н или, необязательно, замещенным линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода;

D и D' являются одинаковыми или различными и, независимо, отсутствуют или выбраны из группы, состоящей из необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, аминокислоты, пептида, несущего от 2 до 6 аминокислот, и мономера полиэтиленгликоля (-ОСН2СН2)n-;

L отсутствует, является связывающей группой, мономером полиэтиленгликоля (-ОСН2СН2)n-, необязательно замещенным линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 10 атомов углерода, фенильной группой, 3-18-членным гетероциклическим кольцом или 5-18-членным гетероарильным кольцом, имеющим от 1 до 6 гетероатомов, независимо выбранных из О, S, N и Р, где алкил или алкенил, необязательно, замещены связывающей группой, фенил или гетероциклическое или гетероарильное кольцо могут быть, необязательно, замещены, причем заместитель может включать связывающую группу.

[263] Типичный конъюгат представлен ниже ("Ab" означает СВА, например, антитело):

[264] В некоторых вариантах воплощения Y является -SO2M, -SO3M или -OSO3M.

[265] В некоторых вариантах воплощения конъюгаты, которые можно синтезировать согласно способам по изобретению, включают следующие соединения:


СВА является агентом, связывающимся с клетками, r является целым числом от 1 до 10, Y является -Н, аддуктом бисульфита, гидросульфита, метабисульфита или их солями, или -SO3M, а М является -Н или фармацевтически приемлемым катионом.

[266] В некоторых вариантах воплощения L отсутствует или выбрана из необязательно замещенной фенильной группы и необязательно замещенной пиридильной группы, где фенильная и пиридильная группа несет связывающую группу, либо L является аминогруппой, несущей связывающую группу (т.е. -N(связывающая группа)-), либо L является линейным, разветвленным или циклическим алкилом или алкенилом, имеющим от 1 до 6 атомов углерода и несущим связывающую группу.

[267] В пятнадцатом специфическом варианте воплощения цитотоксическое соединение, присоединенное к связывающей группе, представлено любой из следующих формул:



L', Lʺ и Lʺ' являются одинаковыми или различными и, независимо, выбраны из -Н, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, мономера полиэтиленгликоля -(OCH2CH2)n-Rc, галогена, гуанидиния [-NH(C=NH)NH2], -OR, -NR'Rʺ, -NO2, -NR'CORʺ, -SR, сульфоксида, представленного -SOR', сульфона, представленного -SO2R', сульфоната -SO3M, сульфата -OSO3M, сульфонамида, представленного -SO2NR'Rʺ, цианогруппы, азидной группы, -COR', -OCOR', -OCONR'Rʺ и связывающей группы, при условии, что только одна из L', Lʺ и Lʺ' является связывающей группой; а

G выбрана из -СН- или -N-. Остальные группы соответствуют описанию, приведенному выше в четырнадцатом специфическом варианте воплощения.

[268] В некоторых вариантах воплощения одна из L', Lʺ или Lʺ' является связывающей группой, а другие являются -Н. Предпочтительно L' является связывающей группой, а Lʺ и Lʺ' являются -Н.

[269] В некоторых вариантах воплощения А и А' обе являются -O-, R6 является -ОМе, а G является -СН-.

[270] В шестнадцатом специфическом варианте воплощения L' представлена следующей формулой:

-W'-Rx-V-Ry-J, где:

W и V являются одинаковыми или различными, и каждая из них, независимо, отсутствует или выбрана из -CReRe' -, -O-, -O-С(=O)-, -С(=O)-O-, -S-, -SO-, -SO2-, -CH2-S-, -CH2O-, -CH2NRe-, -O-(C=O)O-, -O-(C=O)N(Re)-, -N(Re)-, -N(Re)-C(=O)-, -C(=O)-N(Re)-, -N(Re)-C(=O)O-, -N(C (=O)Re)C(=O)-, -N(C(=O)Re)-, -(O-CH2-CH2)n-, -SS- или -С(=O)-, или аминокислоты, или пептида, имеющего от 2 до 8 аминокислот;

Rx и Ry являются одинаковыми или различивши, и каждая из них, независимо, отсутствует или является необязательно замещенным линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, имеющим от 6 до 10 атомов углерода, или 3-8-членным гетероциклическим кольцом, несущим от 1 до 3 гетероатомов, выбранных из О, K или S;

Re и Re' являются одинаковыми или различными и выбраны из -Н, линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, или -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим вторичную аминогруппу (например, -NHR101) или третичную аминогруппу (-NR101R102), или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин, где каждая из R101 и R102, независимо, является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода; предпочтительно каждая R101 и R102, независимо, является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода;

n является целым числом от 1 до 24; а

J ковалентно связана с СВА и выбрана из сукцинимида, ацетамидо, -S-, -SS-, -CH2S-, -CH(Me)S-, -C(Me)2S-, -NRc1-, -CH2NRc1-, -NRc1N- и -С(=O)-, где Rc1 является -Н или замещенным, или незамещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода.

[271] В некоторых вариантах воплощения J является -S-, -SS-, сукцинимидом или -С(=O)-.

[272] В некоторых вариантах воплощения Re' является -Н или -Me; Re является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода, или -(СН2-CH2-O)n-Rk; n является целым числом от 2 до 8; Rk является -Н, -Me или -CH2-CH2-NMe2, a остальные переменные соответствуют описанию, приведенному выше в пятнадцатом специфическом варианте воплощения.

[273] В некоторых вариантах воплощения V является аминокислотой или пептидом, имеющим от 2 до 8 аминокислот.

[274] В некоторых вариантах воплощения V является валин-цитруллином, gly-gly-gly или ala-leu-ala-leu.

[275] В некоторых вариантах воплощения

W' является -O-, -N(Re)- или -N(Re)-C(=O)-;

Re является Н, линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, или -(CH2-CH2-O)n-R;

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода;

V отсутствует или является -(О-CH2-CH2)n-, -C(=O)-NH-, -S-, -NH-C(=O)-;

Ry отсутствует или является линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода; а

J является -S-, -SS- или -С(=O)-, а остальные группы соответствуют определению в шестнадцатом специфическом варианте воплощения.

[276] В некоторых вариантах воплощения

W является -O-, -N(Re)- или -N(Re)-C(=O)-;

Re является -Н, -Me или -(СН2-СН2-O)n-Ме;

n является целым числом от 2 до 6;

Rx является линейным или разветвленным алкилом, несущим от 1 до 6 атомов углерода;

V и Ry отсутствуют; а

J является -С(=О)-. Остальные группы соответствуют определению в шестнадцатом специфическом варианте воплощения.

[277] В семнадцатом специфическом варианте воплощения L' из шестнадцатого специфического варианта воплощения представлена следующей формулой:



каждая из R, R и R, независимо, является -Н или линейным, или разветвленным алкилом, несущим от 1 до 4 атомов углерода, предпочтительно -Me;

R является -Н, линейным или разветвленным алкилом, несущим от 1 до 4 атомов углерода (предпочтительно -Me), -SO3H или -SO3-M+, где М+ является фармацевтически приемлемым катионом;

а является целыми числами от 0 до 5 (например, от 0 до 2, 3, 4 или 5), a b - целым числом от 0 до 6 (например, от 0 до 3, 4, 5 или 6); а

Cy является, необязательно, замещенным 5-членным гетероциклическим кольцом, несущим гетероатом N, предпочтительно Cy является

[278] В некоторых вариантах воплощения, например в шестнадцатом или семнадцатом специфическом варианте воплощения, W' является -N(Re)-.

[279] В некоторых вариантах воплощения, например в шестнадцатом или семнадцатом специфическом варианте воплощения, Re является -(CH2-CH2-O)2-6-Rk, где Rk является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[280] В некоторых вариантах воплощения, например в шестнадцатом или семнадцатом специфическом варианте воплощения, V является -S- или -SS-.

[281] В восемнадцатом специфическом варианте воплощения L' из шестнадцатого или семнадцатого специфического варианта воплощения представлена следующей формулой:


[282] В некоторых вариантах воплощения, например в шестнадцатом-семнадцатом специфических вариантах воплощения, конъюгат является:


где r является целым числом от 1 до 10, Y является -SO3M, а М является -Н или фармацевтически приемлемым катионом.

[283] В некоторых вариантах воплощения, например в шестнадцатом-восемнадцатом специфических вариантах воплощения, антитело является huMy9-6.

[284] В девятнадцатом специфическом варианте воплощения L' из шестнадцатого или семнадцатого специфического варианта воплощения представлена следующей формулой:


[285] В некоторых вариантах воплощения, например в шестнадцатом, семнадцатом и девятнадцатом специфических вариантах воплощения, конъюгат является:


где r является целым числом от 1 до 10, Y является -SO3M, а М является -H или фармацевтически приемлемым катионом.

[286] В некоторых вариантах воплощения, например в шестнадцатом, семнадцатом и девятнадцатом специфических вариантах воплощения, антитело является huMy9-6.

[287] В двадцатом специфическом варианте воплощения цитотоксическое соединение, присоединенное к связывающей группе, представлено следующей формулой:


W' отсутствует или выбрана из -O-, -N(Re)-, -N(Re)-C(=O)-, -N(C(=O)Re)-, -S-, -CH2-S- или -CH2NRe-;

Rx отсутствует или выбрана из линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

Re является -Н, линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или -(СН2-СН2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим вторичную аминогруппу (например, -NHR101) или третичную аминогруппу (-NR101R102), или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин, где каждая из R101 и R102, независимо, является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода;

Zs присоединена к СВА и является углерод-углеродной связью или -SRm;

Rm является Rd или замещенным линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода, несущим реакционно-способный сложный эфир, выбранный из N-гидроксисукцинимидных эфиров, N-гидроксифталимидных эфиров, N-гидроксисульфосукцинимидных эфиров, пара-нитрофениловых эфиров, динитрофениловых эфиров и пентафторофениловых эфиров;

Rd выбрана из фенила, нитрофенила, динитрофенила, карбоксинитрофенила, пиридила или нитропиридила; а

n является целым числом от 1 до 24, а остальные переменные соответствуют описанию, приведенному выше в восьмом или пятнадцатом специфическом варианте воплощения.

[288] В двадцать первом специфическом варианте воплощения цитотоксическое соединение, присоединенное к связывающей группе, представлено следующей формулой;


W' отсутствует или выбрана из -O-, -N(Re)-, -N(Re)-C(=O)-, -N(C(=O)Re)-, -S-, -CH2-S- или -CH2NRe-;

Rx отсутствует или выбрана из линейного, разветвленного или циклического алкила, имеющего от 1 до 10 атомов углерода;

Re является -Н, линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, или -(СН2-СН2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода, необязательно несущим вторичную аминогруппу (например, -NHR101) или третичную аминогруппу (-NR101R102), или 5- или 6-членный азот-содержащий гетероцикл, например пиперидин или морфолин, где каждая из R101 и R102, независимо, является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода;

n является целым числом от 2 до 6;

Zs присоединена к СВА и выбрана из:




q является целым числом от 1 до 5; а

М является -Н или фармацевтически приемлемым катионом, например Na+ или K+.

[289] В некоторых вариантах воплощения Zs представлена любой из следующих формул:

[290] В некоторых вариантах воплощения, например в 21-м специфическом варианте воплощения, W' является -N(Re)-.

[291] В некоторых вариантах воплощения, например в 21-м специфическом варианте воплощения, Re является -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода.

[292] В некоторых вариантах воплощения, например в 21-м специфическом варианте воплощения, Rk является -Н или Me, n равен 4, а q равен 2.

[293] В некоторых вариантах воплощения, например в 21-м специфическом варианте воплощения, Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[294] В некоторых вариантах воплощения, например в 21-м специфическом варианте воплощения, Rx является -(СН2)р-(CRfRg)-, где каждая из Rf и Re независимо выбрана из Н или линейного или разветвленного алкила, имеющего от 1 до 4 атомов углерода; а р равен 0, 1, 2 или 3.

[295] В некоторых вариантах воплощения, например в 21-м специфическом варианте воплощения, Rf и Rg являются одинаковыми или различными и выбраны из -Н и -Me; a p равен 1.

[296] В двадцать втором специфическом варианте воплощения конъюгат формулы (VIIIb') и (Xb'), а также описанный в двадцать первом специфическом варианте воплощения, переменные соответствуют описанию, приведенному ниже:

Y является -SO3M;

М является -Н или фармацевтически приемлемым катионом (например, Na+);

как X', так и Y' являются -Н;

как А, так и А' являются -O-;

R6 является -ОМе; а

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[297] В некоторых вариантах воплощения, например специфических вариантах воплощения с 14-го по 21-й, Y выбрана из -SO3M, -SO2M и сульфата -OSO3M. Предпочтительно Y является -SO3M. Предпочтительно М является -Н, Na+ или K+.

[298] В некоторых вариантах воплощения, например специфических вариантах воплощения с 14-го по 22-й, W, если присутствует, является С=O.

[299] В некоторых вариантах воплощения, например специфических вариантах воплощения с 14-го по 22-й, Z и Z', если присутствуют, являются -CH2-.

[300] В некоторых вариантах воплощения, например специфических вариантах воплощения с 14-го по 22-й, X' выбрана из группы, состоящей из -Н, -ОН, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, фенила, связывающей группы и амин-блокирующей группы. В некоторых вариантах воплощения X' является -Н, -ОН, -Me или связывающей группой. Предпочтительно X' является -Н.

[301] В некоторых вариантах воплощения, например специфических вариантах воплощения с 14-го по 22-й, Y' выбрана из группы, состоящей из -Н, оксогруппы, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода. Предпочтительно Y' является -Н или оксогруппой. Более предпочтительно - -Н.

[302] В некоторых вариантах воплощения, например специфических вариантах воплощения с 14-го по 22-й, А и А' являются одинаковыми или различными, и выбраны из -O-, -S-, -N(R5)- и оксогруппы (С=O). Предпочтительно А и А' являются одинаковыми или различными и выбраны из -О- и -S-. Более предпочтительно А и А' являются -O-.

[303] В некоторых вариантах воплощения, например специфических вариантах воплощения с 14-го по 22-й, D и D', если присутствуют, являются одинаковыми или различными и независимо выбраны из мономера полиэтиленгликоля (-ОСН2СН2)n, где n является целым числом от 1 до 24, аминокислоты, пептида, несущего от 2 до 6 аминокислот, или линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, где алкил, алкенил и алкинил, необязательно, замещены одним или более заместителями, независимо выбранными из группы, состоящей из галогена, -OR, -NR'CORʺ, -SR и -COR', Предпочтительно D и D' являются линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода.

[304] В двадцать третьем специфическом варианте воплощения для соединений формулы (Ibb') или (IIBb’), описанных в двадцатом специфическом варианте воплощения, переменные соответствуют описанию, приведенному ниже:

Y является -SO3M;

М является -Н или Na+;

как X', так и Y' являются -Н;

как А, так и А' являются -O-;

R6 является -ОМе;

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

[305] Предпочтительно Rx является -(CH2)p-(CRfRg)-, где каждая из Rf и Rg, независимо, выбрана из -Н или линейного или разветвленного алкила, имеющего от 1 до 4 атомов углерода; р равен 0, 1, 2 или 3. Более предпочтительно Rf и Rg являются одинаковыми или различными и выбраны из -Н и -Me, а р равен 1.

[306] В двадцать четвертом специфическом варианте воплощения конъюгат по настоящему изобретению, соответствующий описанию в четырнадцатом, пятнадцатом или двадцать первом специфическом варианте воплощения, представлен следующим образом:

Y является -SO3M, где М является -Н или фармацевтически приемлемым катионом (например, Na+);

W является С=O;

R1, R2, R1', R2', R4 и R4' являются -Н;

одна из R3 или R3', необязательно, является связывающей группой, а другая является -Н;

R6 является -ОМе;

Z и Z' являются -СН2;

X' является -Н;

Y' является -Н; а

А и А' являются -O-.

[307] В любом из вышеописанных специфических вариантов воплощения конъюгата по настоящему изобретению, например специфических вариантах воплощения с 14-го по 24-й, Y выбрана из -SO3M, -SO2M и сульфата -OSO3M. Предпочтительно Y является -SO3M.

[308] В некоторых вариантах воплощения, например специфических вариантах воплощения с 14-го по 24-й, М является -Н, Na+ или K+.

[309] В любом из вышеописанных специфических вариантов воплощения конъюгата по настоящему изобретению, например специфических вариантах воплощения с 14-го по 24-й, W, если присутствует, является С=O.

[310] В любом из вышеописанных специфических вариантов воплощения конъюгата по настоящему изобретению, например специфических вариантах воплощения с 14-го по 24-й, Z и Z', если присутствуют, являются -СН2-.

[311] В любом из вышеописанных специфических вариантов воплощения конъюгата по настоящему изобретению, например специфических вариантах воплощения с 14-го по 24-й, X' выбрана из группы, состоящей из -Н, -ОН, необязательно замещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, фенила, связывающей группы и амин-блокирующей группы. В некоторых вариантах воплощения X' является -Н, -ОН, -Me или связывающей группой. В некоторых вариантах воплощения X' является -Н.

[312] В любом из вышеописанных специфических вариантов воплощения конъюгата по настоящему изобретению, например в специфических вариантах воплощения с 14-го по 24-й, Y' выбрана из группы, состоящей из -Н, оксогруппы, замещенного или незамещенного линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода. В некоторых вариантах воплощения Y' является -Н или оксогруппой. В некоторых вариантах воплощения Y' является -Н.

[313] В любом из вышеописанных специфических вариантов воплощения конъюгата по настоящему изобретению, например в специфических вариантах воплощения с 14-го по 24-й, А и А' являются одинаковыми или различными и выбраны из -O-, -S-, -N(R5)- и оксогруппы (С=O). В некоторых вариантах воплощения А и А' являются одинаковыми или различными и выбраны из -О- и -S-. В некоторых вариантах воплощения А и А' являются -O-.

[314] В любом из вышеописанных специфических вариантов воплощения конъюгата по настоящему изобретению, например в специфических вариантах воплощения с 14-го по 24-й, D и D', если присутствуют, являются одинаковыми или различными и независимо выбраны из мономера полиэтиленгликоля (-OCH2CH2)n, где n является целым числом от 1 до 24, аминокислоты, пептида, несущего от 2 до 6 аминокислот, или линейного, разветвленного или циклического алкила, алкенила или алкинила, имеющего от 1 до 10 атомов углерода, где алкил, алкенил и алкинил, необязательно, замещены одним или более заместителями, независимо выбранными из группы, состоящей из галогена, -OR, -NR'CORʺ, -SR и -COR'. В некоторых вариантах воплощения D и D' являются линейным или разветвленным алкилом, имеющим от 1 до 4 атомов углерода.

[315] В некоторых вариантах воплощения конъюгат по любому из описанных вариантов воплощения, например специфических вариантов воплощения с 14-го по 24-й, может включать 1-10 цитотоксических соединений, 2-9 цитотоксических соединений, 3-8 цитотоксических соединений, 4-7 цитотоксических соединений или 5-6 цитотоксических соединений, причем каждое цитотоксическое соединение включает связывающую группу, присоединяющую цитотоксическое соединение к СВА, и все цитотоксические соединения в составе конъюгата одинаковы.

[316] В некоторых вариантах воплощения конъюгат по любому из описанных вариантов воплощения, например специфических вариантов воплощения с 14-го по 24-й, может включать 1-10 цитотоксических соединений, 2-9 цитотоксических соединений, 3-8 цитотоксических соединений, 4-7 цитотоксических соединений или 5-6 цитотоксических соединений, причем каждое цитотоксическое соединение включает связывающую группу, присоединяющую цитотоксическое соединение к СВА, и все цитотоксические соединения в составе конъюгата одинаковы.

[317] В некоторых вариантах воплощения конъюгат по любому из описанных вариантов воплощения, например специфических вариантов воплощения с 14-го по 24-й, может включать в общей сложности 1-10 цитотоксических соединений и (немодифицированных) имин-содержащих цитотоксических соединений, в общей сложности 2-9 цитотоксических соединений и (немодифицированных) имин-содержащих цитотоксических соединений, в общей сложности 3-8 цитотоксических соединений и (немодифицированных) имин-содержащих цитотоксических соединений, в общей сложности 4-7 цитотоксических соединений и (немодифицированных) имин-содержащих цитотоксических соединений, в общей сложности 5-6 цитотоксических соединений и (немодифицированных) имин-содержащих цитотоксических соединений, причем каждое цитотоксическое соединение или (немодифицированное) имин-содержащее цитотоксическое соединение включает связывающую группу, присоединяющую цитотоксическое соединение или (немодифицированное) имин-содержащее цитотоксическое соединение к СВА, и все цитотоксические соединения или (немодифицированные) имин-содержащие цитотоксические соединения в составе конъюгата одинаковы (за исключением (бисульфитной) модификации).

[318] В любом из вариантов воплощения конъюгатов, например специфических вариантах воплощения с 14-го по 24-й, агент, связывающийся с клетками, может связываться с клетками-мишенями, выбранными из опухолевых клеток, клеток, инфицированных вирусом, клеток, инфицированных микроорганизмами, клеток, инфицированных паразитами, аутоиммунных клеток, активированных клеток, миелоидных клеток, активированных Т-клеток, В-клеток или меланоцитов; клеток, экспрессирующих CD4, CD6, CD19, CD20, CD22, CD30, CD33, CD37, CD38, CD40, CD44, CD56, ЕрСАМ, CanAg, CALLA или антигены HER-2, антигены Her-3; или клеток, экспрессирующих рецептор инсулиноподобного фактора роста, рецептор эпидермального фактора роста, рецептор фолата.

[319] В любом из вариантов воплощения конъюгатов, например специфических вариантах воплощения с 14-го по 24-й, агент, связывающийся с клетками, может являться антителом, одноцепочечным антителом, фрагментом антитела, специфически связывающимся с клеткой-мишенью, моноклональным антителом, одноцепочечным моноклональным антителом или фрагментом моноклонального антитела, специфически связывающимся с клеткой-мишенью, химерным антителом, фрагментом химерного антитела, специфически связывающимся с клеткой-мишенью, доменным антителом, фрагментом доменного антитела, специфически связывающимся с клеткой-мишенью, лимфокином, гормоном, витамином, фактором роста, колониестимулирующим фактором или молекулой транспорта питательных веществ.

[320] Антитело может являться антителом с модифицированной поверхностью, одноцепочечным антителом с модифицированной поверхностью или фрагментом антитела с модифицированной поверхностью.

[321] Антитело может являться моноклональным антителом, одноцепочечным моноклональным антителом или фрагментом моноклонального антитела.

[322] Антитело может являться гуманизированным антителом, гуманизированным одноцепочечным антителом или фрагментом гуманизированного антитела.

[323] В любом из специфических вариантов воплощения, приведенных здесь, например специфических вариантах воплощения с 1-го по 24-й, реагент, способный взаимодействовать с иминами, выбран из группы, состоящей из сульфитов (H2SO3, H2SO2 или соли HSO3-, SO32- или HSO2-, образованной катионом), метабисульфита (H2S2O5 или соли S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатов (PO3SH3, PO2S2H3, POS3H3, PS4H3 или соли PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложных эфиров тиофосфата ((RiO)2PS(ORi), RiSH, RiSOH, RiSO2H, RiSO3H), различных аминов (гидроксиламина (например, NH2OH), гидразина (например, NH2NH2), NH2O-Ri, Ri'NH-Ri, NH2-Ri), NH2-CO-NH2, NH2-C(=S)-NH2', тиосульфата (H2S2O3 или соли S2O32-, образованной катионом), дитионита (H2S20O4 или соли S2O42-, образованной катионом), фосфородитиоата (P(=S)(ORk)(SH)(OH) или его соли, образованной катионом), гидроксамовой кислоты (RkC(=O)NHOH или соли, образованной катионом), гидразида (RkCONHNH2), формальдегидсульфоксилата (HOCH2SO2H или соли HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+), гликозилированного нуклеотида (например, GDP-маннозы), флударабина или их смеси, где Ri и Ri' независимо являются линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещены по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri и Ri', необязательно, могут быть дополнительно замещены заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом.

[324] Предпочтительно реагент, способный взаимодействовать с иминами, выбирают из сульфитов, гидроксиламина, гидразина и мочевины. Более предпочтительно реагент, способный взаимодействовать с иминами, является NaHSO3 или KHSO3.

[325] В любом из специфических вариантов воплощения, приведенных здесь, например специфических вариантах воплощения с 1-го по 24-й, используют от приблизительно 0,1 до приблизительно 30 молярных эквивалентов реагента, способного взаимодействовать с иминами, по отношению к имин-содержащему цитотоксическому соединению. В некоторых вариантах воплощения используют от приблизительно 1 до приблизительно 10 молярных эквивалентов реагента, способного взаимодействовать с иминами, по отношению к имин-содержащему цитотоксическому соединению. В некоторых вариантах воплощения используют от приблизительно 3 до приблизительно 5 молярных эквивалентов реагента, способного взаимодействовать с иминами, по отношению к имин-содержащему цитотоксическому соединению.

[326] В любом из специфических вариантов воплощения, приведенных здесь, например специфических вариантах воплощения с 1-го по 24-й, бифункциональный сшивающий агент присоединяет цитотоксический агент к агенту, связывающемуся с клетками, посредством простой тиоэфирной связи, и может содержать группу на основе малеимидогруппы или галоацетила, причем бифункциональный сшивающий агент, содержащий группу на основе малеимидогруппы, выбран из: N-сукцинимидил-4-(малеимидометил)циклогексанкарбоксилата (SMCC), N-сукцинимидил-4-(N-малеимидометил)-циклогексан-1-карбокси-(6-амидокапроата) (LC-SMCC), N-сукцинимидилового эфира κ-малеимидоундекановой кислоты (KMUA), N-сукцинимидилового эфира γ-малеимидомасляной кислоты (GMBS), N-гидроксисукцинимидного эфира ε-малеимидокапроновой кислоты (EMCS), м-малеимидобензоил-N-гидроксисукцинимидного эфира (MBS), N-(α-малеимидоацетокси)-сукцинимидного эфира (AMAS), сукцинимидил-6-(β-малеимидопропионамидо)гексаноата (SMPH), N-сукцинимидил-4-(п-малеимидофенил)бутирата (SMPB), N-(п-малеимидофенил)изоцианата (PMPI), N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноата; а бифункциональный сшивающий агент, содержащий группу на основе галоацетила, выбран из: N-сукцинимидил-4-(иодоацетил)-аминобензоата (SIAB), N-сукцинимидилиодоацетата (SIA), N-сукцинимидилбромоацетата (SBA) и N-сукцинимидил-3-(бромоацетамидо)пропионата (SBAP), бис-малеимидополиэтиленгликоля (ВМРЕО), ВМ(РЕО)2, ВМ(РЕО)3, N-(β-малеимидопропилокси)сукцинимидного эфира (BMPS), NHS 5-малеимидовалериановой кислоты, HBVS, гидразида⋅HCl 4-(4-N-малеимидофенил)-масляной кислоты (МРВН), сукцинимидил-(4-винилсульфонил)бензоата (SVSB), дитиобис-малеимидоэтана (DTME), 1,4-бис-малеимидобутана (BMB), 1,4-бисмалеимидил-2,3-дигидроксибутана (BMDB), бис-малеимидогексана (ВМН), бис-малеимидоэтана (ВМОЕ), сульфосукцинимидил 4-(N-малеимидометил)циклогексан-1-карбоксилата (сульфо-SMCC), сульфосукцинимидил(4-иодоацетил)аминобензоата (сульфо-SIAB), м-малеимидобензоил-N-гидроксисульфосукцинимидного эфира (сульфо-MBS), N-(γ-малеимидобутирилокси)сульфосукцинимидного эфира (сульфо-GMBS), N-(ε-малеимидокапроилокси)сульфосукцинимидного эфира (сульфо-EMCS), N-(κ-малеимидоундеканоилокси)сульфосукцинимидного эфира (сульфо-KMUS), сульфосукцинимидил-4-(п-малеимидофенил)бутирата (сульфо-SMPB), СХ1-1, сульфо-Mal и ПЭГn-Mal.

[327] В некоторых вариантах воплощения бифункциональный сшивающий агент выбран из группы, состоящей из SMCC, сульфо-SMCC, BMPS, GMBS, SIA, SIAB, N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноата, бис-малеимидогексана или ВМРЕО.

[328] В любом из вариантов воплощения, например специфических вариантах воплощения с 1-го по 24-й, конъюгат очищают с помощью тангенциальной проточной фильтрации, адсорбционной хроматографии, адсорбционной фильтрации, избирательного осаждения, неабсорбционной фильтрации или их комбинации. Предпочтительно конъюгат очищают с помощью тангенциальной проточной фильтрации и/или адсорбционной хроматографии.

[329] В некоторых вариантах воплощения, например специфических вариантах воплощения с 1-го по 24-й, агент, связывающийся с клетками (СВА), несущий группу, способную взаимодействовать с тиолами, является:

[330] Соединения или конъюгаты, полученные с помощью способов по настоящему изобретению, в частности, включают:

где r является целым числом от 1 до 10, Y является -Н или -SO3M, а М является -Н или фармацевтически приемлемым катионом.

[331] В 25-м специфическом варианте воплощения изобретение обеспечивает способ получения конъюгата следующей формулы:


причем указанный способ включает взаимодействие цитотоксического соединения следующей формулы

с модифицированным СВА следующей формулы, соответственно, при рН от приблизительно 4 до приблизительно 9,



r является целым числом от 1 до 10;

Y является уходящей группой, и является сульфитом (HSO3, HSO2 или солью HSO3-, SO32- или HSO2-, образованной катионом), метабисульфитом (H3S2O5 или солью S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатом (PO3SH3, PO2S2H2, POS3H2, PS4H2 или солью PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложным эфиром тиофосфата (RiO)2PS(ORi), RiS-, RiSO, RiSO2, RiSO3, тиосульфатом (HS2O3 или солью S2O32-, образованной катионом), дитионитом (HS2O4 или солью S2O42-, образованной катионом), фосфородитиоатом (P(=S)(OR)(S)(OH) или его солью, образованной катионом), гидроксамовой кислотой (Rk'C(+O)NOH или солью, образованной катионом), формальдегидсульфоксилатом (HOCH2SO2- или солью HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+) или их смесью, где Ri является линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещен, по меньшей мере, одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri, необязательно, может быть дополнительно замещен заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk' является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом; предпочтительно Y является -SO3M; а М является -Н или фармацевтически приемлемым катионом.

[332] В некоторых вариантах воплощения Y является -SO3M; а М является -Н или фармацевтически приемлемым катионом.

[333] В некоторых вариантах воплощения цитотоксическое соединение получают взаимодействием реагента, способного взаимодействовать с иминами, с имин-содержащим цитотоксическим соединением следующей формулы:

[334] В некоторых вариантах воплощения СВА является huMy9-6.

[335] В 26-м специфическом варианте воплощения изобретение обеспечивает способ получения конъюгата следующей формулы:


причем способ включает взаимодействие СВА с имин-содержащим цитотоксическим соединением, реагентом, способным взаимодействовать с иминами, и бифункциональным сшивающим агентом, содержащим связывающую группу, с образованием конъюгата, где:

имин-содержащее цитотоксическое соединение является:

бифункциональный сшивающий агент является:


, соответственно, и

реагент, способный взаимодействовать с иминами, выбран из: сульфитов (H2SO3, H2SO2 или соли HSO3-, SO32- или HSO2-, образованной катионом), метабисульфита (H2S2O5 или соли S2O52-, образованной катионом), моно-, ди-, три- и тетратиофосфатов (PO3SH3, PO2S2H3, POS3H3, PS4H3 или соли PO3S3-, PO2S23-, POS33- или PS43-, образованной катионом), сложных эфиров тиофосфата ((RiO)2PS(ORi), RiSH, RiSOH, RiSO2H, RiSO3H), различных аминов (гидроксиламина (например, NH2OH), гидразина (например, NH2NH2), NH2O-Ri, Ri'NH-Ri, NH2-Ri), NH2-CO-NH2, NH2-C(=S)-NH2', тиосульфата (H2S2O3 или соли S2O32-, образованной катионом), дитионита (H2S2O4 или соли S2O42-, образованной катионом), фосфородитиоата (P(=S)(ORk)(SH)(OH) или его соли, образованной катионом), гидроксамовой кислоты (RkC(=O)NHOH или соли, образованной катионом), гидразида (RkCONHNH2), формальдегидсульфоксилата (HOCH2SO2H или соли HOCH2SO2-, образованной катионом, например HOCH2SO2-Na+), гликозилированного нуклеотида (например, GDP-маннозы), флударабина или их смеси, где Ri и Ri' независимо являются линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, и замещены по меньшей мере одним заместителем, выбранным из -N(Rj)2, -CO2H, -SO3H и -РО3Н; Ri и Ri', необязательно, могут быть дополнительно замещены заместителем для алкила, описанным здесь; Rj является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода; Rk является линейным, разветвленным или циклическим алкилом, алкенилом или алкинилом, имеющим от 1 до 10 атомов углерода, арилом, гетероциклилом или гетероарилом.

[336] В некоторых вариантах воплощения Y является -SO3M; а М является -Н или фармацевтически приемлемым катионом.

[337] В некоторых вариантах воплощения СВА является huMy9-6.

Цитотоксичность соединений и конъюгатов IN VITRO

[338] Можно выполнить оценку способности цитотоксических соединений и конъюгатов агент, связывающийся с клетками/лекарственное вещество, полученных способами по настоящему изобретению, подавлять пролиферацию различных линий раковых клеток in vitro. Например, для оценки цитотоксичности указанных соединений и конъюгатов можно использовать такие линии клеток, как линия карциномы ободочной кишки человека COLO 205, линия клеток рабдомиосаркомы RH-30 и линия клеток множественной миеломы MOLP-8. Клетки, используемые для оценки, можно подвергать воздействию соединений или конъюгатов в течение 1-5 суток, а фракции выживших клеток измерять путем прямого анализа с помощью известных способов. Затем на основании результатов анализов можно рассчитать значения IC50. В качестве альтернативы или дополнения, в качестве одного из руководств по определению типов рака, которые могут обладать чувствительностью к лечению соединениями или конъюгатами, полученными с помощью способов согласно изобретению, можно использовать скрининг чувствительности линий клеток in vitro, например, описанный в Национальном институте рака США (см. Voskoglou-Nomikos et al., 2003, Clinical Cancer Res. 9: 42227-4239, включенный в настоящий документ посредством ссылки).

[339] Примеры оценки in vitro активности и специфичности по отношению к мишени конъюгатов антитело/цитотоксический агент, полученных с помощью способов по настоящему изобретению, показаны на Фиг.17. Все конъюгаты являются чрезвычайно цитотоксическими по отношению к антиген-положительным раковым клеткам с IC50 в низком диапазоне. Антиген-отрицательные линии клеток остаются жизнеспособными при воздействии этих же конъюгатов. Показано, что направленная специфическая активность индолбензодиазепиновых димеров снижалась в 160 раз при блокировании неконъюгированным антителом huMy9-6 (против CD33) (Фиг.17) и снижалась в 40 раз при блокировании неконъюгированным антителом FOLR1 (антитело против рецептора фолата) (результат не показан). Например, конъюгат huMy9-6-SPDB-1f, несущий аддукты бисульфита, уничтожал антиген-положительные клетки HL60/QC со значением IC50, равным 10,5 пМ, в то время как добавление избытка неконъюгированного антитела huMy9-6 антитело ослабляло цитотоксическое действие (IC50=1,69 нМ), демонстрируя специфичность к антигену (Фиг.17А). Кроме того, конъюгат huMy9-6-SPDB-1f также обладает высокой активностью как к линии клеток HL60/ATCC со значением IC50 21 пМ, так и к линии клеток NB-4 со значением IC50 190 пМ (Фиг.17Б и 17В).

[340] Действие конъюгирования на связывание антител измеряли путем сравнения связывания как неконъюгированного антитела huMy9-6, так и конъюгата huMy9-6-SPDB-1f с линией клеток HL60/QC (Фиг.18). FACS-анализ выявил, что изменения связывающей способности конъюгата со свободными антителами отсутствуют, что указывает на отсутствие нарушений связывания, вызванных конъюгированием цитотоксического агента с антителом.

[341] В одном примере измеряли активность конъюгата "агент, связывающий клетки/цитотоксический агент" in vivo. Бестимусных мышей, несущих опухоли HL60/QC человека, лечили конъюгатом huMy9-6-SPDB-1f и при многократных дозах наблюдали значительный регресс опухоли, в то время как у необработанных мышей наблюдали быстрый рост опухоли (Фиг.19). Активность наблюдалась при дозах 20 мкг/кг, что по меньшей мере в 35 раз ниже, чем максимально переносимая доза.

[342] Действие насыщения иминогрупп на переносимость показано в Таблице 9. Дииминовый конъюгат huFOLR1-лекарственное вещество 1 испытывали при многократных дозах, все из которых были признаны высокотоксичными, причем выжившие оставались только в группе, подвергавшейся воздействию минимальных протестированных доз 50 мкг/кг. В противоположность этому обнаружено, что частично восстановленные моноиминовые конъюгаты huFOLR1-лекарственное вещество 2 и huFOLR1-SPDB-IGN (huFOLR1-SPDB-1f), обладали значительно улучшенной переносимостью, причем конъюгат huFOLR1-SPDB-IGN (huFOLR1-SPDB-1f) демонстрировал 100% выживаемость животных при максимальных протестированных дозах 560 мкг/кг.



[343] Гуманизированное антитело MY9-6 в концентрации 2 мг/мл конъюгировали с 9 молярными эквивалентами 2-NHS-эфира (соединения 2) в течение 3 ч при 25°С в 85% PBS, рН 7,4, содержащем 15% ДМА (объем/объем), а затем очищали на обессоливающей колонке G25 в PBS, рН 7,4, для удаления непрореагировавшего или гидролизованного неконъюгированного лекарственного вещества. Конъюгат диализовали в буфере, состоявшем из 10 мМ гистидина, 250 мМ глицина, буфер с рН 6,5, содержащий 1% сахарозы. На основе УФ-поглощения при 280 и 320 нм и расчета с использованием коэффициентов экстинкции лекарственного вещества и антитела при 280 нм и 320 нм определили, что соотношение лекарственное вещество/антитело (DAR) в составе конъюгата составило DAR 1,4.

[344] Конъюгат анализировали на процентное содержание мономера эксклюзионной хроматографией (SEC) на колонке TSK-Gel G300SWXL (7,8 мм × 300 мм, размер частиц 5 мкм), используя изократическую подвижную фазу - 400 мм перхлорат натрия, 150 мМ калий-фосфатный буфер, рН 7,0, со скоростью 1 мл/мин. Процентное содержание мономера (% мономера) и агрегата определяли путем мониторинга УФ-поглощения всех видов антител при 280 нм и измерения площади под кривой (ППК) каждого пика антитела. Кроме того, определяли процентное содержание (%) 2 лекарственных веществ как в мономере, так и в агрегате путем мониторинга УФ-поглощения всех видов антител при 320 нм и 280 нм и измерения ППК каждого пика антитела. % мономера конъюгата huMy9-6-2, характеризовавшегося значением DAR 1,4, составлял 91%. % 2 в мономере составлял 80%.

[345] Для анализа свободного (неконъюгированного) лекарственного вещества конъюгат экстрагировали ацетоном для удаления белка, высушивали, восстанавливали в подвижной фазе и впрыскивали в ОФ-ВЭЖХ-колонку VYDAC 208ТР С8 (4,6×250 мм, размер частиц 7 мкм), используя линейный градиент от 20% ацетонитрила и 80% деионизированной воды до 100% ацетонитрила, содержащий 0,025% уксусной кислоты, со скоростью 1 мл/мин, в течение 48 мин, и сравнивали со стандартами лекарственное вещество - метиловый эфир. Определили, что процент свободного неконъюгированного лекарственного вещества в конъюгате составил <1% от содержания конъюгированного лекарственного вещества.

[346] Конъюгат huMy9-6-2 с соотношением лекарственное вещество/антитело (DAR) 1,4 анализировали с помощью масс-спектрометрии (МС) после дегликозилирования (Фиг.1А). На масс-спектрограмме конъюгата показано неконъюгированное антитело (D0) в виде самого крупного пика, меньший пик D1 (антитело с 1 присоединенным лекарственным веществом), и значительно меньшие пики D2 и D3 для 2 и 3 лекарственных веществ, присоединенных к антителу. Эффективность конъюгирования была низкой со значением DAR конъюгата, равным 1,4, после конъюгирования с 9-кратным молярным избытком 2-NHS-эфира по сравнению с антителом.


[347] Для конъюгирования 2-NHS-эфира (соединение 2) с использованием бисульфита натрия 2-NHS-эфир (соединение 2) предварительно инкубировали с 0,9 молярного эквивалента бисульфита натрия (свежеприготовленный раствор NaHSO3 в деионизированной воде) в 66% растворе ДМА (диметилацетамида) в воде в течение 30 мин при температуре 25°С. Антитело huMy9-6 в концентрации 2 мг/мл конъюгировали с 9 молярными эквивалентами 2- NHS-эфира (с добавленным NaHSO3) в течение 3 ч при 25°С в 85% PBS, рН 7,4, содержащем 15% ДМА (объем/объем), а затем очищали на обессоливающей колонке G25 в PBS, рН 7,4, для удаления непрореагировавшего или гидролизованного лекарственного вещества. Конъюгат диализовали в буфере, содержавшем 10 мМ гистидина, 250 мМ глицина, 1% сахарозы, рН 6,5.

[348] DAR конъюгата huMy9-6-2, полученного с использованием бисульфита натрия, измеряли с помощью УФ-спектрофотометрии при 280 и 320 нм; рассчитанное значение DAR составило 3,1. % мономера конъюгата составил 95%, а % 2 в мономере составил 91%. На масс-спектрограмме конъюгата, полученного с использованием бисульфита натрия после дегликозилирования показан крупнейший пик D1 с одним присоединенным лекарственным веществом, а также пики D2, D3, D4, D5, D6 для 2-6 лекарственных веществ на антитело (Фиг.1Б).

[349] Конъюгат huMy9-6-2, полученный с использованием бисульфита натрия, демонстрировал значительно большую степень внедрения лекарственного вещества со значением DAR 3,1 по сравнению с конъюгатом, полученным без бисульфита натрия, обладавшим значением DAR 1,4. На масс-спектрограмме конъюгата со значением DAR 3,1, полученного с бисульфитом натрия, показаны пики конъюгата с 1-6 присоединенными лекарственными веществами, причем крупнейший пик соответствует D1 с 1 присоединенным лекарственным веществом. В противоположность этому, на масс-спектрограмме конъюгата со значением DAR 1,4, полученного без бисульфита натрия, показан наиболее высокий пик неконъюгированного антитела (DO) и значительно меньшие пики конъюгатов с присоединенным лекарственным веществом D1, D2 и D3. Процентное содержание лекарственного вещества в мономере для конъюгата huMy9-6-2, полученного с бисульфитом натрия, составило 91%, что было выше, чем 80% лекарственного вещества в мономере для конъюгата huMy9-6-2, полученного без бисульфита натрия. В целом качество конъюгата huMy9-6-2, полученного с использованием бисульфита натрия, таким образом, было значительно выше, чем при традиционной процедуре конъюгирования без бисульфита натрия.

[350] Конъюгирование NHS-эфиров нескольких лекарственных веществ (1, 2, 3 и 4) с антителами проводили в присутствии бисульфита натрия (NaHSO3) и сравнивали с традиционным способом конъюгирования без NaHSO3. Результаты показаны в Таблице 16. Во всех случаях добавление бисульфита натрия при конъюгации позволяло получить конъюгаты со значительно лучшим качеством, повышенным DAR и % лекарственного вещества в мономере, чем конъюгаты, полученные без добавления бисульфита натрия.

Сравнение конъюгирования антител с несколькими NHS-эфирами лекарственных веществ без или с добавлением бисульфита натрия (NaHSO3)
NaHSO3 добавление Тип лекарственного вещества DAR % мономера % лекарственного вещества в мономере
- 2 1,4 91 80,
+ 3,0 95 91
- 3 0,5 95 35
+ 2,5 95 91
- 4 1,0 90 65
+ 3,8 90 84
- 1 1,1 95 40
+ 2,7 92 87

[351] Конъюгат huMy9-6-2, полученный с бисульфитом натрия, демонстрировал аналогичную цитотоксичность in vitro по сравнению с конъюгатом, полученным без бисульфита натрия (Фиг.2). Таким образом, с использованием бисульфита натрия получали конъюгат лучшего качества с повышенным DAR и % лекарственного вещества в мономере без потери цитотоксической активности. Конъюгат антитело против CD22-2, полученный с бисульфитом натрия, демонстрировал аналогичную цитотоксичность in vitro по сравнению с конъюгатом, полученным без бисульфита натрия (Фиг.3).

[352] Конъюгат huMy9-6-2, полученный с использованием бисульфита натрия, анализировали посредством электрофореза в невосстанавливающем ДСН-ПААГ с использованием анализатора геля на чипе. Конъюгат продемонстрировал только полосу интактного антитела; полос тяжелой и легкой цепи не наблюдали, что указывало на непредусмотренное достоинство подхода, заключающееся в том, что добавленный бисульфит натрия не вызывал нежелательного восстановления нативных межцепочечных дисульфидных связей в составе антитела.

[353] 2-NHS-эфир или SPDB-NHS-эфиры 3, 4, 1 и 5 предварительно инкубировали с 0,5-3 молярными эквивалентами бисульфита натрия (свежеприготовленный раствор NaHSO3 в деионизированной воде) в 66-98% растворе ДМА (диметилацетамида) в воде в течение от 15 минут до 4 часов при 25°С. Некоторые из указанных реакционных растворов также оставляли на ночь при 4°С и использовали для конъюгирования через 20 ч.

[354] 2-NHS-эфир в ДМА, обработанный бисульфитом натрия или без добавления бисульфита натрия, анализировали с помощью ВЭЖХ, используя обращенно-фазовую колонку VYDAC C8 с линейным градиентом от 20% ацетонитрила и 80% деионизированной воды до 100% ацетонитрила, содержащим 0,025% уксусную кислоту, при 1 мл/мин, в течение 48 мин. Как показано на фиг.4, исходный 2-NHS-эфир элюировался на ~23 мин. Через 30 мин обработки 0,9 молярными эквивалентами NaHSO3 в 66% растворе ДМА в воде при 25°С большую часть 2-NHS преобразовывали в сульфированную, более полярную форму, элюировавшуюся на ~14 мин. Как ни странно, нежелательного пика сульфированного гидролизованного 2 не наблюдали. Таким образом, наблюдали непредвиденно благоприятную реакцию бисульфита натрия по отношению к присоединению к иминной связи без реакции с NHS-эфиром.

[355] Аналогично, NHS-эфиры лекарственных веществ обрабатывали реагентами, способными взаимодействовать с иминами, не являющимися бисульфитом натрия, перед конъюгированием с антителом. Альтернативный подход к конъюгированию заключался в обработке смеси NHS-эфира лекарственного вещества и антитела бисульфитом натрия или другого реагента, способного взаимодействовать с иминами.


[356] Конъюгат антитело-SPDB-1, соединенный дисульфидной связью, получали с использованием синтезированного 1-SPDB-NHS-эфира (соединения 1с). 1-SPDB-NHS-эфир предварительно обрабатывали 3 молярными эквивалентами бисульфита натрия (используя свежеприготовленный раствор NaHSO3 в воде) в 96-98% растворе ДМА в воде в течение 4-5 ч при 25°С. Раствор 1-SPDB-NHS-эфира, обработанного бисульфитом натрия, в ДМА анализировали, используя колонку VYDAC C8 для обращенно-фазовой ВЭЖХ и линейный градиент 20% ацетонитрила и 80% деионизированной воды, содержащий 0,025% уксусную кислоту, при скорости 1 мл/мин, в течение 48 мин. ОФ-ВЭЖХ-анализ продемонстрировал только желательную реакцию присоединения бисульфита к иминной связи без нежелательной реакции бисульфита с NHS-эфиром.

[357] Для конъюгирования гуманизированное антитело в концентрации 2 мг/мл подвергали взаимодействию с 5-7 молярными эквивалентами 1-SPDB-NHS-эфира (предварительно обработанного NaHSO3) в течение 6 ч при 25°С в 85% водном PBS-буфере, рН 7,4, содержавшем 15% N,N-диметилацетамид (ДМА), а затем очищали фильтрацией через колонку G25 для гель-фильтрации в PBS, рН 7,4, для удаления непрореагировавшего или гидролизованного лекарственного вещества. Конъюгаты гуманизированное антитело-SPDB-1 диализовали в буфере, содержавшем 10 мМ гистидина, 250 мМ глицина, 1% сахарозы, рН 6,5. Измеренное за счет УФ-поглощения при 280 и 320 нм с использованием коэффициентов экстинкции лекарственного вещества и антитела при 280 нм и 320 нм соотношение лекарственное вещество/антитело (DAR) конъюгатов составило 2,2-2,9. Определенное с помощью SEC (эксклюзионной хроматографии) процентное содержание мономера в препарате конъюгата составило 90%. На основе УФ-поглощения пика мономера, полученного с помощью SEC, также продемонстрировали, что пик мономера конъюгата содержал присоединенные молекулы лекарственного вещества. С помощью экстракции ацетоном и обращенно-фазовой ВЭЖХ показано, что % неконъюгированного лекарственного вещества составлял менее 1%.

[358] МС конъюгата дегликозилированное антитело-SPDB-1, полученного с использованием бисульфита натрия, добавленного до конъюгирования, продемонстрировала значительно лучший конъюгат по сравнению с конъюгатами, полученными при конъюгировании без бисульфита натрия (Фиг.5). МС конъюгата, полученного без бисульфита натрия, продемонстрировала среднее соотношения 1,4 1/Ab и молекулы антител, содержавшие до трех присоединенных молекул 1 (Фиг.5А). В противоположность этому, МС конъюгата, полученного с использованием бисульфита натрия, продемонстрировала среднее соотношения 2,5 1/Ab и молекулы антител, содержавшие до семи присоединенных молекул 1 (Фиг.5Б).

[359] Анализ конъюгата антитело-SPDB-1, соединенного дисульфидной связью, полученного с использованием бисульфита натрия, посредством электрофореза в невосстанавливающем ДСН-ПААГ с использованием анализатора геля на чипе продемонстрировал только полосу интактного антитела. Анализ геля на чипе проводили с использованием Agilent Protein 230 Protein Chip и анализировали с помощью Agilent 2300 Bioanalyzer. Полос тяжелой и легкой цепи не наблюдали, что указывало на непредусмотренное достоинство подхода, заключающееся в том, что добавленный бисульфит натрия не вызывал нежелательного восстановления нативных межцепочечных дисульфидных связей в составе антитела (Фиг.6). Наличие присоединенного лекарственного вещества в конъюгате антитело-SPDB-1, полученном с использованием бисульфита натрия, также продемонстрировало, что, как ни странно, дисульфидный линкер в конъюгате был стабилен по отношению к добавленному бисульфиту натрия.


[360] Для получения конъюгата 1f-SPDB-NHS-эфир (соединение 1с, Фиг.7) предварительно инкубировали с 3 молярными эквивалентами бисульфита натрия (свежеприготовленный раствор NaHSO3 в деионизированной воде) в 96% растворе ДМА (диметилацетамида) в воде в течение 5 ч при 25°С, а затем инкубировали в течение ночи при 4°С до конъюгирования. Гуманизированное антитело в концентрации 2-3 мг/мл модифицировали 8 молярными эквивалентами lf-SPDB-NHS-эфира в отсутствие или в присутствии бисульфита натрия (-/+NaHSO3) в течение 4 ч при 25°С в водном 95% буфере, содержавшем 50 мМ HEPES, рН 8,5, и 5% ДМА (объем/объем), а затем очищали оба конъюгата на обессоливающей колонке G25 в PBS, рН 7,4 для удаления непрореагировавшего, гидролизованного лекарственного вещества. Конъюгаты диализовали в буфере, содержавшем 10 мМ гистидина, 250 мМ глицина, 1% сахарозы, рН 6,5. DAR конъюгата измеряли с помощью УФ-спектрофотометрии при 280 и 320 нм. % мономера и % лекарственного вещества на мономер в конъюгате определяли с помощью SEC. Неконъюгированное лекарственное вещество в конъюгате определяли с помощью обращенно-фазовой ВЭЖХ после экстракции ацетоном. Указанные реакции конъюгирования проводили с использованием нескольких гуманизированных антител.


[361] Для конъюгирования лекарственных веществ-тиолов с реакционно-способным дисульфидным линкером, внедренным в антитело, гуманизированное моноклональное антитело в концентрации 8 мг/мл модифицировали 4-6 молярными эквивалентами гетеробифункционального линкера SPDB в течение 1,5 ч при 25°С в 90% водном PBS-буфере, рН 7,5, с 5% ДМА (объем/объем), а затем очищали на обессоливающей колонке G25 в буфере, содержавшем 35 мМ цитрата, 2 мМ ЭДТА, 150 мМ NaCl, рН 5,5 для удаления непрореагировавшего, гидролизованного линкера. LAR (соотношение линкер-антитело) измеряли по УФ-поглощению при 280 и 343 нм без и с добавлением 50 мМ дитиотреитола (для измерения общего содержания антитела и высвобождаемого SPy). SPDB-модифицированное антитело в концентрации 2 мг/мл подвергали взаимодействию с 2 молярными эквивалентами лекарственного вещества-тиола, обработанного бисульфитом натрия, на линкер в течение 2-20 ч при 25°С в 85-90% буфере, содержавшем 50 мМ фосфата калия, 50 мМ NaCl, рН 7,5, а затем очищали на обессоливающей колонке G25 в PBS, рН 7,4 для удаления непрореагировавшего, гидролизованного лекарственного вещества. DAR конъюгата антитело-SPDB-лекарственное вещество измеряли по УФ-поглощению при 280 и 320 нм, а процент мономера и процент лекарственного вещества в мономере в препарате конъюгата определяли с помощью SEC.

Пример 6 Получение huMy9-6-сульфо-SPDB-1 (2-этапный способ)

[362] Реакционную смесь, содержавшую 6 мг/мл антитела huMy9-6 и 9 молярных эквивалентов линкера сульфо-SPDB (рабочий раствор 20 мМ в ДМА), инкубировали в течение 3 ч при 25°С в 50 мМ EPPS-буфере, рН 8. Непрореагировавший линкер удаляли с помощью обессоливающей колонки NAP (Illustra Sephadex G-25 DNA Grade, GE Healthcare); измеренное на основе концентрации антител и ДТТ-высвобожденной концентрации тиопиридина с помощью спектроскопии в УФ и видимой части спектра (ε343 нм=8080 см-1 М-1 для 2-тиопиридона) соотношение линкер-антитело (LAR) составило 3.7.

[363] HuMy9-6, модифицированное сульфо-SPDB, разбавляли до 2 мг/мл в 50 мМ EPPS рН 8,5, 10% объем/объем ДМА, и подвергали взаимодействию с 2 молярными эквивалентами соединения 1d на линкер (рабочий раствор 5 мМ в ДМА, 7,4 эквивалента на антитело) в течение 3 ч при 25°С.

[364] После реакции конъюгат очищали и заменяли буфер на раствор 250 мМ глицина, 10 мМ гистидина, 1% сахарозы, 0,01% твина-20, 50 мкМ бисульфита натрия при рН 6,2 с помощью обессоливающей колонки (G-25 Sephadex, fine grade, GE Healthcare).

[365] Обнаружено, что очищенный конъюгат характеризовался в среднем 2,9 присоединенными молекулами соединения 1 на антитело (согласно спектроскопии в УФ и видимой части спектра с использованием молярных коэффициентов экстинкции ε330 нм=15484 см-1 М-1 и ε280 нм=30115 см-1 М-1 для соединения 1 и ε230 нм=207000 см-1 М-1 для антитела MY9-6), 97,8% мономера (согласно эксклюзионной хроматографии), <1% неконъюгированного соединения 1 (согласно экстракции ацетоном/обращенно-фазовой ВЭЖХ), 60% выходом в расчете на использованное количество антитела, и 18% общим выходом в расчете на использованное количество соединения 1d. Конъюгат, полученный с помощью указанного способа, можно было концентрировать (с помощью устройства на основе кюветы с перемешиванием или устройства центрифужной фильтрации АМИКОН) до >3 мг/мл без осаждения конъюгата.

Пример 7 Получение huMy9-6-SPDB-1

Способ 1 (одноэтапный реагентный способ):

[366] Реакционную смесь, содержащую 2 мг/мл антитела huMy9-6 и 7 молярных эквивалентов 1-SPDB-NHS (предварительно обработанного 5-кратным избытком бисульфита натрия в смеси 90:10 ДМА:вода (объем/объем) в течение 1 ч при 25°С и затем в течение ночи при 4°С) в 50 мМ HEPES (4-(2-гидроксиэтил)-1-пиперазинэтансульфоновая кислота)-буфере, рН 8,5, и 10% (объем/объем) ДМА (N,N-диметилацетамиде) в качестве сорастворителя инкубировали в течение 3 ч при 25°С.

[367] После реакции конъюгат очищали и заменяли буфер на буфер для состава, содержавший 250 мМ глицина, 10 мМ гистидина, 1% сахарозу, 0,01% Твин, 50 мкМ бисульфита натрия, с помощью обессоливающей колонки NAP (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Диализ осуществляли в этом же буфере в течение 4 часов при комнатной температуре, используя кассеты для диализа Slide-a-Lyzer (ThermoScientific 20000 MWCO).

[368] Обнаружено, что очищенный конъюгат характеризовался в среднем 4,0 присоединенными молекулами соединения 1 на антитело (согласно спектроскопии в УФ и видимой части спектра с использованием молярных коэффициентов экстинкции ε330 нм= 15484 см-1 М-1 и ε280 нм=30115 см-1 М-1 для соединения 1 и ε230 нм=207000 см-1 М"1 для антитела MY9-6), 92% мономера (согласно эксклюзионной хроматографии, TSK3000, TOSOH Biosciences), <1% неконъюгированного соединения 1 (согласно экстракции ацетоном/обращенно-фазовой ВЭЖХ), 72% выходом в расчете на использованное количество антитела, 40% общим выходом в расчете на использованное количество 1-SPDB-NHS, и конечной концентрацией белка 1,0 мг/мл.

Способ 2 (двухэтапный способ):

[369] Реакционную смесь, содержавшую 4,8 мг/мл антитела huMy9-6 и 6 молярных эквивалентов линкера SPDB (рабочий раствор 18,5 мМ в этаноле), инкубировали в течение 3 ч при 25° в PBS, рН 7,4. Непрореагировавший линкер удаляли с помощью обессоливающей колонки NAP (Illustra Sephadex G-25 DNA Grade, GE Healthcare); измеренное на основе концентрации антител и ДТТ-высвобожденной концентрации 2-тиопиридона с помощью спектроскопии в УФ и видимой части спектра (ε343 нм=8080 см-1 М-1 для 2-тиопиридона) соотношение линкер-антитело (LAR) составило 4,0.

[370] HuMy9-6, модифицированное SPDB, разбавляли до 2 мг/мл в 50 мМ EPPS рН 8,5, 10% объем/объем ДМА и подвергали взаимодействию с 1,75 молярными эквивалентами соединения 1d на линкер (рабочий раствор 5 мМ в ДМА, 7 эквивалента на антитело) в течение 3 ч при 25°С.

[371] После реакции конъюгат очищали и заменяли буфер на раствор 250 мМ глицина, 10 мМ гистидина, 1% сахарозы, 0,01% твина-20, 50 мкМ бисульфита натрия при рН 6,2 с помощью обессоливающей колонки (Illustra Sephadex G-25 DNA Grade, GE Healthcare).

[372] Обнаружено, что очищенный конъюгат характеризовался в среднем 3,8 присоединенными молекулами соединения 1 на антитело (согласно спектроскопии в УФ и видимой части спектра с использованием молярных коэффициентов экстинкции ε330 нм=15484 см-1 М-1 и ε280 нм=30115 см-1 M-1 для соединения 1 и ε280 нм=207000 см-1 М-1 для антитела MY9-6), 91,6% мономера (согласно эксклюзионной хроматографии, TSK3000, TOSOH Biosciences), <1% неконъюгированного соединения 1 (согласно экстракции ацетоном/обращенно-фазовой ВЭЖХ), 40% выходом в расчете на использованное количество антитела, 22% общим выходом в расчете на использованное количество соединения 1d, и конечной концентрацией белка 0,5 мг/мл.

Пример 8 Получение huMy9-6-CX 1-1-1

Способ 1 (одноэтапный реагентный способ in situ):

[373] В растворе ДМА, содержавшем 1,9 мМ соединения Id, 1 мМ гетеробифункционального линкера СХ1-1 с N-гидроксисукцинимидными (NHS) и малеимидными группами и 20 мМ диизопропилэтиламина (DIPEA), проводили реакцию при комнатной температуре в течение 8 мин. Затем для нейтрализации избытка соединения 1d добавляли 3 мМ малеимидопропионовой кислоты (МРА). Реакционную смесь 1-СХ1-1-NHS хранили в замороженном виде при температуре -80°С и позже после оттаивания добавляли двумя порциями в забуференный раствор huMy9-6 при 25°С (2 мг/мл, 100 мМ ЭППС, рН 8,0, 10% (объем/объем) ДМА); 4,8 молярных эквивалентов на антитело (основываясь на концентрации линкера), а затем, спустя 30 мин, 4,2 эквивалента. После 2-ч реакции конъюгат очищали и заменяли буфер на раствор, содержавший 250 мМ глицина, 10 мМ гистидина, 1% сахарозы, 0,01% Твин-20, 50 мкМ бисульфита натрия при рН 6,2, с помощью обессоливающей колонки (Quick-spin protein, G-25 fine resin, Roche), диализа и, наконец, стерильной фильтрации через 0,22-мкм фильтр.

[374] Обнаружено, что очищенный конъюгат характеризовался в среднем 3,3 присоединенными молекулами соединения 1 на антитело (согласно спектроскопии в УФ и видимой части спектра с использованием молярных коэффициентов экстинкции ε330 нм=15484 см-1 М-1 и ε280 нм=30115 см-1 М-1 для соединения 1 и ε280 нм=207000 см-1 М-1 для антитела MY9-6), 95% мономера (согласно эксклюзионной хроматографии, TSK3000, TOSOH Biosciences), <1% неконъюгированного соединения 1 (согласно экстракции ацетоном/обращенно-фазовой ВЭЖХ), 45% выходом в расчете на использованное количество антитела, 17% общим выходом в расчете на использованное количество соединения 1d, и конечной концентрацией белка 0,7 мг/мл.

Способ 2 (одноэтапный способ):

[375] В забуференный раствор антитела huMy9-6 (2 мг/мл, 50 мМ EPPS, рН 8,5, 8% (объем/объем) ДМА) добавляли 14 молярных эквивалентов соединения 1d (5 мМ рабочий раствор в ДМА), а затем 7 молярных эквивалентов линкера СХ1-1 (15 мМ раствор в этаноле) и инкубировали в течение 3 ч при 25°С.

[376] После реакции конъюгат очищали и заменяли буфер на раствор, содержавший 250 мМ глицина, 10 мМ гистидина, 1% сахарозу, 0,01% Твин-20, 50 мкМ бисульфита натрия при рН 6,2, с помощью обессоливающей колонки (Illustra Sephadex G-25 DNA Grade, GE Healthcare), затем 2 × диализом при 4°C в кассетах для диализа Slide-a-Lyzer (ThermoScientific 20000 MWCO).

[377] Обнаружено, что очищенный конъюгат характеризовался в среднем 3,4 присоединенными молекулами соединения 1 на антитело (согласно спектроскопии в УФ и видимой части спектра с использованием молярных коэффициентов экстинкции ε330 нм=15484 см-1 М-1 и ε280 нм=30115 см-1 М-1 для соединения 1 и ε280 нм=207000 см-1 М-1 для антитела MY9-6), 90% мономера (согласно эксклюзионной хроматографии, TSK3000, TOSOH Biosciences), <1% неконъюгированного соединения 1 (согласно экстракции ацетоном/обращенно-фазовой ВЭЖХ), 44% выходом в расчете на использованное количество антитела, 11% общим выходом в расчете на использованное количество соединения 1d, и конечной концентрацией белка 1,48 мг/мл.

Пример 9 МС-анализ дегликозилированного My9-6-SPDB-1f

[378] My9-6-SPDB-1f получали конъюгированием соединения 1f, содержавшего NHS-эфир, непосредственно с остатками лизина антитела (т.е. согласно одноэтапному реагентному способу, как описано выше), или конъюгированием соединения 1d с антителом, модифицированным дитиопиридином (т.е. согласно двухэтапному способу, как описано выше). Затем проводили масс-спектрометрический (МС) анализ дегликозилированного My9-6-SPDB-1f, как указано выше.

[379] Одноэтапный реагентный способ позволял получить конъюгат с 0-9 модификациями соединения 1f, асимметричным распределением конъюгированного лекарственного вещества и значительным количеством неконъюгированного антитела. С другой стороны, конъюгат, полученный согласно двухэтапному способу, характеризовался МС-профилем с 0-6 модификациями соединения 1f, симметричным распределением конъюгированного лекарственного вещества и очень малым количеством неконъюгированного антитела. См. Фиг.12. Оба конъюгата обладали аналогичным средним соотношением соединение 1f/антитело, составлявшим ~4 согласно спектрометрическому анализу в УФ и видимой части спектра.

Пример 10 Действие рН на двухэтапный синтез My9-6-сульфо-SPDB-1

[380] Данные МС для Му9-6-сульфо-SPDB-1f, полученного с помощью двухэтапного способа при различных рН, показаны на Фиг.13. Вкратце, My9-6-сульфоSPDВ (3,7 линкера/антитело) подвергали взаимодействию с 3 эквивалентами соединения Id на линкер (или приблизительно 11,1 эквивалентами на антитело) в течение 18 ч при рН 6, 7, 8 и 8,5. Данные МС продемонстрировали уменьшение количества непрореагировавшего линкера (сопутствующие пики 260 а.е.м.) при возрастании рН реакционной смеси. Таким образом, оказалось, что рН влияет на реакцию конъюгирования при синтезе конъюгата My9-6-сульфо-SPDB-1f. В частности, для полного взаимодействия соединения Id с линкером сульфо-SPDB, присоединенным к антителу, требуется рН>8.

Пример 11 Действие соотношения соединение/линкер на двухэтапный синтез chKTI-сульфо-SPDB-1

[381] На Фиг.14 показаны данные МС для chKTI-сульфо-SPDB-1, полученного при использовании двухэтапного способа с различными соотношениями соединение 1d/линкер. chKTI-сульфо-SPDB (3,7 линкера/антитело) взаимодействовал с 1,1, 1,3, 1,5 или 2 эквивалентами соединения 1d на линкер в течение 3 ч при 25°С, рН 8,5. МС продемонстрировала уменьшение количества непрореагировавшего линкера (сопутствующие пики 260 а.е.м.) при возрастании эквивалентного количества соединения Id на линкер. Оказалось, что при этих условиях для полного взаимодействия с линкером сульфо-SPDB, присоединенным к антителу, требуется соотношение соединение 1d/линкер>1,3. Увеличение эквивалентного количества соединения Id более 1,5 на линкер привело к увеличению фрагментации антител (14-19%), в то время как 1,1-1,3 молекулы соединения 1d/линкера не вызывали значительной фрагментации антител.

Пример 12 Получение конъюгата антитело-SPDB-лекарственное вещество

[382] Соединение 1 с предварительно обрабатывали 3 молярными эквивалентами бисульфита натрия (используя свежеприготовленный раствор NaHSO3 в воде) в 96-98% растворе ДМА в воде в течение 4-5 ч при 25°С. Для конъюгирования гуманизированное антитело в концентрации 2 мг/мл подвергали взаимодействию с 5-7 молярными эквивалентами соединения 1с (предварительно обработанного NaHSO3) в течение 6 ч при 25°С в 85-90% водном PBS-буфере, рН 7,4, или 50 мМ водном HEPES-буфере, рН 8,5, содержавшем 10-15% N,N-диметилацетамида (ДМА), а затем очищали фильтрацией через колонку G25 для гель-фильтрации в PBS, рН 7,4, для удаления непрореагировавшего или гидролизованного лекарственного соединения. Конъюгаты гуманизированное антитело-SPDB-лекарственное вещество диализовали в буфере, содержавшем 10 мМ гистидина, 250 мМ глицина, 1% сахарозы, рН 6,5. Измеренное за счет УФ-поглощения при 280 и 320 нм с использованием коэффициентов экстинкции лекарственного вещества и антитела при 280 нм (215000 М-1 см-1) и 320 нм (9137 М-1 см-1) соотношение лекарственное вещество/антитело (DAR) конъюгатов составило 2,2-2,9. Определенное с помощью SEC (эксклюзионной хроматографии) при использовании колонки TSK-Gel G300SWXL (7,8 мм × 300 мм, размер частиц 5 мкм) процентное содержание мономера в конъюгатах составило>90%. На основе УФ-поглощения пика мономера, полученного с помощью SEC, также продемонстрировали, что пики мономера конъюгата содержал присоединенные молекулы лекарственного вещества. Для анализа свободного (неконъюгированного) лекарственного вещества конъюгат экстрагировали ацетоном для удаления белка, высушивали, восстанавливали в подвижной фазе, впрыскивали в ОФ-ВЭЖХ-колонку VYDAC 208TP С8 (4,6×250 мм, размер частиц 7 мкм), и сравнивали со стандартами. Определили, что процент свободного лекарственного соединения в конъюгате составил <0,5% от содержания конъюгированного лекарственного соединения.

Получение конъюгата гуманизированное антитело-SPDB-2а:

[383] Гуманизированное антитело в концентрации 8 мг/мл модифицировали 4-6 молярными эквивалентами гетеробифункционального линкера SPDB в течение 1,5 ч при 25°С в 95% PBS, рН 7,4, содержащем 5% ДМА (объем/объем), а затем очищали на обессоливающей колонке G25 в цитратном буфере (35 мМ цитратный буфер, рН 5,5, содержащий 2 мМ ЭДТА, 150 мМ NaCl) для удаления непрореагировавшего линкера. LAR (соотношение линкер-антитело), определяемое путем измерений УФ-поглощения при 280 и 343 нм без и с добавлением 50 мМ дитиотреитола (для измерения общего содержания антитела и дитиотреитол-высвобождаемого SPy), составило 2,7-4,1. SPDB-модифицированное антитело в концентрации 2 мг/мл подвергали взаимодействию с 2 молярными эквивалентами соединения 2а (соли HCl) на присоединенный SPDB в течение 20 ч при комнатной температуре в 85% цитратном буфере, 15% ДМА (объем/объем), а затем очищали на обессоливающей колонке G25 в PBS, рН 7,4, для удаления неконъюгированного лекарственного соединения. DAR конечного конъюгата гуманизированное антитело-SPDB-2a измеряли с помощью УФ-спектрофотометрии при 280 и 350 нм; рассчитанное значение DAR составило ~1,7-2,1. Процентное содержание мономера и присоединенного лекарственного соединения на мономер в конъюгате определяли с помощью ВЭЖХ, используя колонку для SEC (эксклюзионной хроматографии). См. Фиг.16.

Пример 13 Использование ковалентных иминовых реагентов для улучшения характеристик конъюгата антитело/лекарственное вещество (% мономера и лекарственной нагрузки).

[384] Образование аддукта проводили с использованием 5 молярных эквивалентов иминного реагента по отношению к NHS-BMPS-1 в 90% ДМСО/10% PBS, рН 7,4, в течение 4 часов при 25°С. Затем реакционную смесь добавляли к антителу huMy9-6 (4 молярных эквивалента лекарственного вещества, 2 мг/мл, 10% объем/объем ДМСО, 50 мМ HEPES-буфера, рН 8,5, 5 ч, 25°С). Конъюгаты, полученные с использованием гидросульфита натрия, бисульфита натрия или метабисульфита натрия, обладали аналогичным соотношением лекарственное вещество/антитело и процентным содержанием мономера, в то время как конъюгаты, полученные без обработки вспомогательной добавкой, обладали крайне низким уровнем встраивания лекарственного вещества.

Пример 14 Исследование переносимости конъюгатов huFOLR-1 in vivo

[385] Переносимость конъюгатов huFOLR-1 in vivo исследовали на самках мышей CD-1. Животных наблюдали в течение семи дней до начала исследования и признали здоровыми. Мышам вводили однократную в/в инъекцию бисульфит-несущего конъюгата и ежедневно отслеживали у животных потерю массы тела, заболеваемости или смертность. В Таблице 9 показано, что конъюгат huFOLR1-лекарственное вещество 1 переносился только в минимальной протестированной дозе 50 мкг/кг. В противоположность этому обнаружено, что оба моноиминные конъюгата huFOLR1-лекарственное вещество 2 и huFOLR1-SPDB-1f переносились лучше при максимальной переносимой дозе <198 мкг/кг и >560 мкг/кг, соответственно.

Таблица 9. Данные по сравнению переносимости конъюгатов (А) huFOLRl-лекарственное вещество 1, (Б) huFOLRl-лекарственное вещество 2, и (В) huFOLR1-SPDB-1f.

Доза (мкг/кг) % Выживаемость
50 100
100 0
200 0
300 0
400 0
Доза (мкг/кг) % Выживаемость
66 100
132 100
198 50
264 25
Доза (мкг/кг) % Выживаемость
120 100
160 100
200 100
320 100
560 100

Пример 15 Влияние пропиленгликоля на образование состава и конъюгирование

[386] В данном примере продемонстрировано, что при исследуемых реакциях конъюгирования, проводимых в присутствии пропиленгликоля в качестве сорастворителя, не наблюдалось осаждения конъюгатов, и что 40% (и возможно, даже более концентрированный) пропиленгликоль можно использовать без снижения % мономера в полученном конъюгате (в присутствии 2% диметилацетамида - данные не показаны).

[387] Более того, присутствие пропиленгликоля во время очистки приводит к значительному увеличению выхода (Таблица 10).

[388] Не ограничиваясь рамками какой-либо конкретной теории, авторы настоящей заявки полагают, что одним из основных источников проблем при конъюгировании рассматриваемых конъюгатов является гидрофобность, присущая молекулярным компонентам конъюгатов. Это может, по меньшей мере, частично объяснить низкий выход очищенного продукта, и в ряде случаев, аномальные профили распределения массы, наблюдаемые при рассматриваемых реакциях конъюгирования.

[389] Стоит также отметить, что добавление изопропанола при эксклюзионной хроматографии рассматриваемых конъюгатов сильно уменьшает кажущееся количество агрегатов. Это наблюдение показывает, что низкомолекулярные гидрофобные растворители могут повысить растворимость лекарственного вещества и конъюгата по изобретению.

[390] Таким образом, рассматриваемые реакции конъюгирования, этапы очистки после реакции, и/или формирование состава образованных конъюгатов предпочтительно осуществляли в присутствии низкомолекулярных гидрофобных растворителей, например пропиленгликоля (например, 5, 10, 15, 20, 25, 30, 35, 40, 45%).

[391] Антитело-сульфо-SPDB получали в соответствии с ранее описанными способами путем добавления N-гидроксисукцинимидиловой (NHS) сложноэфирной формы сульфо-SPDB к антителу (huMy9-6) в воде, содержащей 3% ДМА и забуференной при рН 8,5, в течение 3 часов. Полученное промежуточное соединение (антитело-сульфо-SPDB) очищали на G25 Sephadex с целью удаления избытка линкера. Количество антитела и линкера оценивали спектроскопией в УФ-видимой области спектра путем измерения оптической плотности при 280 нм в отсутствие восстановителя, а также при 343 нм в присутствии ~50 мМ ДТТ для измерения высвобождения 2-тиопиридина из конъюгированного линкера.

[392] С целью конъюгирования лекарственного вещества антитело-сульфо-SPDB, полученное выше, подвергали взаимодействию при 2 мг/мл антитела с 2-кратным молярным избытком соединения 1d в присутствии указанных сорастворителей и при рН, поддерживаемом на уровне 8,5 с помощью EPPS-буфера (конечная концентрация 60 мМ). Диметилацетамид (SAFC) и пропиленгликоль (Alfa Aesar) использовали в том виде, как они были получены, без дополнительной очистки. Все буферные растворы стерилизовали пропусканием через 0,22-микронный фильтр (Coming), а воду очищали с помощью обратного осмоса/деионизации. Реакционные смеси инкубировали при 25°С в течение 3 ч, а затем очищали, используя одноразовую колонку G25 Sephadex (Nap 25, GE Healthcare) в буфере для состава, состоявшего из 10 мМ гистидина, 250 глицина, 1% сахарозы, 0,01% полисорбата 20, 50 мкМ бисульфита натрия, и забуференного при рН 6,2, а также указанном процентном содержании пропиленгликоля (объем/объем).

[393] Выход реакции и лекарственную нагрузку определяли с помощью спектроскопии поглощения. Все образцы демонстрировали >96% мономера согласно аналитической эксклюзионной хроматографии.

[394] В Таблице 10, приведенной ниже, показан % выхода конъюгирования в зависимости от содержания пропиленгликоля в реакционной смеси или составе. Антитело-сульфо-SPDB-1 получали взаимодействием соединения 1d с антитело-сульфо-SPDB в течение 4 часов при рН 8,5 (неводные компоненты соответствуют указанному) с последующей очисткой на G25 Sephadex.

Таблица 10
все водные компоненты 15% пропиленгликоля
Реакционная смесь 0% пропиленгликоля+ 10% ДМА 59 79
30% пропиленгликоля +2% ДМА S3* 83
*Густой белый осадок наблюдали в верхней части колонки с сефадексом после

ПРИМЕР 16 Получение hyMy9-6-сульфо-SPDB-1d с использованием высокоактивного линкера 4-нитроРу-сульфо-SPDB

[395] Реакционную смесь, содержавшую 6 мг/мл антитела huMy9-6 и 5 молярных эквивалентов высокоактивного линкера N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноата (20 мМ рабочий раствор в этаноле), инкубировали в течение 3 ч при 25°С в 50 мМ EPPS-буфере при рН 8. Непрореагировавший линкер удаляли с помощью обессоливающей колонки NAP (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Измеренное на основе концентрации антител и ДТТ-высвобожденной концентрации нитропиридин-2-тиона с помощью спектроскопии в УФ и видимой части спектра (ε394 нм=14205 см-1 М-1 для 2-тио-4-нитропиридона) соотношение линкер-антитело (LAR) составило приблизительно 2,3.

[396] HuMy9-6, модифицированное линкером, разбавляли до 2 мг/мл в 50 мМ HEPES -буфере при рН 8,5, 10% объем/объем ДМА, и подвергали взаимодействию с 2 молярными эквивалентами соединения 1d на линкер (рабочий раствор 5 мМ в ДМА, 4,6 эквивалента на антитело) в течение 30 мин при 25°С. Завершение реакции обмена дисульфидных связей определяли, отслеживая увеличение оптической плотности при 394 нм с помощью УФ-спектроскопии. После реакции конъюгат очищали и заменяли буфер на раствор 250 мМ глицина, 10 мМ гистидина, 1% сахарозы, 0,01% твина-20, 50 мкМ бисульфита натрия при рН 6,2 с помощью обессоливающей колонки (G-25 Sephadex, fine grade, GE Healthcare).

[397] Обнаружено, что очищенный конъюгат характеризовался в среднем 2,1 присоединенными молекулами 1d на антитело (согласно спектроскопии в УФ и видимой части спектра с использованием молярных коэффициентов экстинкции ε330 нм=15484 см-1 М-1 и ε280 нм=30115 см-1 М-1 для 1d и ε280 нм=207000 см-1 М-1 для huMy9-6), 98% мономера (согласно эксклюзионной хроматографии), <1% неконъюгированного 1d (согласно экстракции ацетоном/обращенно-фазовой ВЭЖХ), 70% выходом белка и 32% общим выходом 1d. См. Фиг.28.

1. Способ получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие модифицированного цитотоксического соединения с модифицированным СВА при pH от приблизительно 4 до приблизительно 9, причем:

а) модифицированный СВА включает остаток бифункционального сшивающего агента, связанный с СВА, а указанный остаток включает связывающую группу и группу, способную взаимодействовать с тиолом, где СВА представляет собой антитело, и модифицированный СВА представлен следующей формулой:

или и

б) модифицированное цитотоксическое соединение включает тиоловую группу и его получают взаимодействием имин-содержащего цитотоксического соединения, несущего тиоловую группу, с реагентом, способным взаимодействовать с иминами, и где имин-содержащее цитотоксическое соединение представлено следующей формулой:


X' представляет собой -Н;

Y' представляет собой -Н или оксогруппу,

W' представляет собой -N(Re)-,

Re представляет собой -(CH2-CH2-O)n-Rk, где Rk является -H, линейным, разветвленным или циклическим алкилом, имеющим от 1 до 6 атомов углерода,

n является целым числом от 1 до 24,

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода,

А и А' являются -О-,

R6 является -OR,

R, в каждом случае, представляет собой линейный или разветвленный алкил, имеющий от 1 до 6 атомов углерода;

G представляет собой -CH-; и

реагент, способный взаимодействовать с иминами, выбран из группы, состоящей из сульфита, метабисульфита и дитионита.

2. Способ по п. 1, дополнительно включающий очистку модифицированного цитотоксического соединения до взаимодействия с модифицированным СВА.

3. Способ по п. 1, отличающийся тем, что модифицированный СВА получают взаимодействием СВА с бифункциональным сшивающим агентом, причем указанный бифункциональный сшивающий агент содержит группу, способную взаимодействовать с тиолами, и группу, способную взаимодействовать с СВА, присоединенные к связывающей группе.

4. Способ по п. 1, отличающийся тем, что модифицированный СВА является:


5. Способ получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие СВА с имин-содержащим цитотоксическим соединением, реагентом, способным взаимодействовать с иминами, и бифункциональным сшивающим агентом, включающим связывающую группу, с образованием конъюгата, где СВА представляет собой антитело, и имин-содержащее цитотоксическое соединение представлено следующей формулой или его фармацевтически приемлемой солью:


X' представляет собой -Н;

Y' представляет собой -Н или оксогруппу,

W' представляет собой -N(Re)-,

Re представляет собой -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным или циклическим алкилом, имеющим от 1 до 6 атомов углерода,

n является целым числом от 1 до 24,

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода,

А и А' являются -О-,

R6 является -OR,

R, в каждом случае независимо, представляет собой линейный или разветвленный алкил, имеющий от 1 до 6 атомов углерода;

G представляет собой -СН-; и

реагент, способный взаимодействовать с иминами, выбран из группы, состоящей из сульфита, метабисульфита и дитионита.

6. Способ по п. 5, отличающийся тем, что СВА приводят в контакт с имин-содержащим цитотоксическим соединением и реагентом, способным взаимодействовать с иминами, с образованием первой смеси; а затем первую смесь приводят в контакт с бифункциональным сшивающим агентом с образованием конъюгата.

7. Способ по п. 6, отличающийся тем, что бифункциональный сшивающий агент приводят в контакт с первой смесью непосредственно после образования первой смеси.

8. Способ по п. 6, дополнительно включающий очистку конъюгата.

9. Способ получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, способ, включающий:

а) взаимодействие модифицированного цитотоксического соединения с бифункциональным сшивающим агентом, включающим связывающую группу, группу, реагирующую с СВА, и группу, способную взаимодействовать с модифицированным цитотоксическим соединением с образованием второго модифицированного цитотоксического соединения, ковалентно связанного с остатком бифункционального сшивающего агента, причем указанный остаток включает связывающую группу и группу, способную реагировать с СВА;

причем модифицированное цитотоксическое соединение получают взаимодействием имин-содержащего цитотоксического соединения с реагентом, способным взаимодействовать с иминами, и где имин-содержащее цитотоксическое соединение представлено следующей формулой или его фармацевтически приемлемой солью:


X' представляет собой -Н;

Y' представляет собой -Н, или оксогруппу;

W' представляет собой -N(Re)-,

Re представляет собой -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным или циклическим алкилом, имеющим от 1 до 6 атомов углерода,

n является целым числом от 1 до 24,

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода,

R, в каждом случае, представляет собой линейный или разветвленный алкил, имеющий от 1 до 6 атомов углерода;

R6 является -OR;

А и А' являются -О-,

G представляет собой -СН-; и

реагент, способный взаимодействовать с иминами, выбран из группы, состоящей из сульфита, метабисульфита и дитионита; и

б) взаимодействие второго модифицированного цитотоксического соединения с СВА посредством группы, способной взаимодействовать с СВА, при pH от приблизительно 4 до приблизительно 9, с образованием конъюгата, где СВА представляет собой антитело.

10. Способ по п. 9, отличающийся тем, что дополнительно включает очистку модифицированного цитотоксического соединения до этапа а).

11. Способ по п. 10, отличающийся тем, что дополнительно включает очистку второго модифицированного цитотоксического соединения до этапа б).

12. Способ по п. 11, отличающийся тем, что реакционную смесь хранят в замороженном виде до оттаивания замороженной смеси и проведения этапа а).

13. Способ по п. 12, отличающийся тем, что дополнительно включает хранение реакционной смеси, полученной на этапе а), в замороженном виде до оттаивания и проведения этапа б).

14. Способ по любому из пп. 1, 5 или 9, отличающийся тем, что R6 является -ОМе.

15. Способ по любому из пп. 1, 5 или 9, отличающийся тем, что Rk является -Н или -Me.

16. Способ по любому из пп. 1, 5 или 9, отличающийся тем, что Rx является -(CH2)p-(CRfRg)-, где каждая из Rf и Rg, независимо, выбрана из -Н или линейного или разветвленного алкила, имеющего от 1 до 4 атомов углерода; а p равен 0, 1, 2 или 3.

17. Способ по п. 16, отличающийся тем, что Rf и Rg являются одинаковыми или различными и выбраны из -Н и -Me; а p равен 1.

18. Способ по любому из пп. 1, 5 или 9, отличающийся тем, что:

как X', так и Y' являются -Н; и

R6 является -ОМе.

19. Способ по любому из пп. 5 или 9, отличающийся тем, что бифункциональный сшивающий агент выбран из:

N-сукцинимидил-4-(малеимидометил)циклогексанкарбоксилата (SMCC), N-сукцинимидил-4-(N-малеимидометил)-циклогексан-1-карбокси-(6-амидокапроата) (LC-SMCC), N-сукцинимидилового эфира κ-малеимидоундекановой кислоты (KMUA), N-сукцинимидилового эфира γ-малеимидомасляной кислоты (GMBS), N-гидроксисукцинимидного эфира ε-малеимидокапроновой кислоты (EMCS), м-малеимидобензоил-N-гидроксисукцинимидного эфира (MBS), N-(α-малеимидоацетокси)-сукцинимидного эфира (AMAS), сукцинимидил-6-(β-малеимидопропионамидо)гексаноата (SMPH), N-сукцинимидил-4-(п-малеимидофенил)бутирата (SMPB), N-(п-малеимидофенил)изоцианата (PMPI), N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноата; N-сукцинимидил-4-(иодоацетил)-аминобензоата (SIAB), N-сукцинимидилиодоацетата (SIA), N-сукцинимидилбромоацетата (SBA) и N-сукцинимидил-3-(бромоацетамидо)пропионата (SBAP), бис-малеимидополиэтиленгликоля (ВМРЕО), ВМ(РЕО)2, ВМ(РЕО)3, N-(β-малеимидопропилокси)сукцинимидного эфира (BMPS), NHS 5-малеимидовалериановой кислоты, HBVS, гидразида⋅HCl 4-(4-N-малеимидофенил)-масляной кислоты (МРВН), сукцинимидил-(4-винилсульфонил)бензоата (SVSB), дитиобис-малеимидоэтана (DTME), 1,4-бис-малеимидобутана (ВМВ), 1,4-бисмалеимидил-2,3-дигидроксибутана (BMDB), бис-малеимидогексана (ВМН), бис-малеимидоэтана (ВМОЕ), сульфосукцинимидил 4-(N-малеимидометил)циклогексан-1-карбоксилата (сульфо-SMCC), сульфосукцинимидил(4-иодо-ацетил)аминобензоата (сульфо-SIAB), м-малеимидобензоил-N-гидроксисульфосукцинимидного эфира (сульфо-MBS), N-(γ-малеимидобутирилокси)сульфосукцинимидного эфира (сульфо-GMBS), N-(ε-малеимидокапроилокси)сульфосукцинимидного эфира (сульфо-EMCS), N-(κ-малеимидоундеканоилокси)сульфосукцинимидного эфира (сульфо-KMUS), сульфосукцинимидил-4-(п-малеимидофенил)бутирата (сульфо-SMPB), СХ1-1, сульфо-Mal, ПЭГn-Mal, N-сукцинимидил-4-(4-нитропиридил-2-дитио)бутаноата, N-сукцинимидил-3-(2-пиридилдитио)пропионата (SPDP), N-сукцинимидил-4-(2-пиридилдитио)пентаноата (SPP), N-сукцинимидил-4-(2-пиридилдитио)бутаноата (SPDB) и N-сукцинимидил-4-(2-пиридилдитио)-2-сульфобутаноата (сульфо-SPDB).

20. Способ по любому из пп. 5 или 9, в котором бифункциональный сшивающий агент представляет собой N-сукцинимидил-4-(2-пиридилдитио)-2-сульфобутаноат (сульфо-SPDB).

21. Способ получения конъюгата, включающего агент, связывающийся с клетками (СВА), конъюгированный с цитотоксическим соединением посредством связывающей группы, способ, включающий взаимодействие второго модифицированного цитотоксического соединения с СВА при pH приблизительно от приблизительно 4 до приблизительно 9, где СВА представляет собой антитело и второе модифицированное цитотоксическое соединение включает:

остаток бифункционального сшивающего агента, связанный с цитотоксическим соединением и включающий связывающую группу и реакционно-способную группу, выбранную из реакционно-способного сложного эфира и группы, способной взаимодействовать с тиолами, и получают взаимодействием реагента, способного взаимодействовать с иминами с модифицированным имин-содержащим цитотоксическим соединением, несущим связывающую и способную взаимодействовать группу, и где модифицированное имин-содержащее цитотоксическое соединение представлено следующей формулой:


X' представляет собой -Н;

Y' представляет собой -Н или оксогруппу,

W' представляет собой -N(Re)-,

Re представляет собой -(CH2-CH2-O)n-Rk, где Rk является -Н, линейным, разветвленным или циклическим алкилом, имеющим от 1 до 6 атомов углерода,

n является целым числом от 1 до 24,

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода,

Zs выбрана из любой из следующих формул:

, и


q является целым числом от 1 до 5; предпочтительно q равен 2;

n является целым числом от 2 до 6; предпочтительно n равен 4;

D является -Н или -SO3M;

А и А' являются -О-,

R, в каждом случае, представляет собой линейный или разветвленный алкил, имеющий от 1 до 6 атомов углерода;

R6 является -OR,

М является -Н или фармацевтически приемлемым катионом; и

G представляет собой -СН-; и

реагент, способный взаимодействовать с иминами, выбран из группы, состоящей из сульфита, метабисульфита и дитионита.

22. Способ по п. 21, отличающийся тем, что дополнительно включает очистку второго цитотоксического соединения до взаимодействия с СВА.

23. Способ по п. 21, отличающийся тем, что R6 является -ОМе, a G является -СН-.

24. Способ по п. 21, отличающийся тем, что Re является -(CH2-CH2-O)2-6-Rk, где Rk является -Н, линейным, разветвленным, циклическим алкилом, имеющим от 1 до 6 атомов углерода.

25. Способ по п. 21, отличающийся тем, что второе модифицированное цитотоксическое соединение, соединенное со связывающей группой посредством присоединенной к ней реакционно-способной группы, является:


или его фармацевтически приемлемой солью, где Y является -SO3M, а М является Н или фармацевтически приемлемым катионом.

26. Способ по п. 21, отличающийся тем, что второе модифицированное цитотоксическое соединение, соединенное со связывающей группой посредством присоединенной к ней реакционно-способной группы, является:


или его фармацевтически приемлемой солью, где Y является -SO3M, а М является -Н или фармацевтически приемлемым катионом.

27. Способ по п. 21, отличающийся тем, что Zs представлена любой из следующих формул:

28. Способ по п. 21, отличающийся тем, что Rk является -Н или -Me.

29. Способ по п. 21, отличающийся тем, что Rx является -(CH2)p-(CRfRg)-, где каждая из Rf и Rg, независимо, выбрана из -Н или линейного или разветвленного алкила, имеющего от 1 до 4 атомов углерода; а p равен 0, 1, 2 или 3.

30. Способ по п. 29, отличающийся тем, что Rf и Rg являются одинаковыми или различными и выбраны из -Н и -Me; а p равен 1.

31. Способ по п. 21, отличающийся тем, что:

как X', так и Y' являются -Н;

R6 является -ОМе; а

Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода.

32. Способ по п. 31, отличающийся тем, что М является -Н, Na+ или K+.

33. Способ по любому из пп. 1, 5, 9 или 21, отличающийся тем, что конъюгат является:


где r является целым числом от 1 до 10, Y является -SO3M, а М является -Н или фармацевтически приемлемым катионом.

34. Способ по п. 33, отличающийся тем, что антитело является huMy9-6.

35. Способ по любому из пп. 1, 5, 9 или 21, отличающийся тем, что конъюгат является:


где r является целым числом от 1 до 10, Y является -SO3M, а М является -Н или фармацевтически приемлемым катионом.

36. Способ по п. 35, отличающийся тем, что антитело является huMy9-6.

37. Способ по любому из пп. 1, 5, 9, 21, 33, 34, 35 или 36, отличающийся тем, что конъюгат включает 1-10 цитотоксических соединений, каждое цитотоксическое соединение присоединено к СВА посредством связывающей группы, и каждые цитотоксические соединения в составе конъюгата одинаковы.

38. Способ по любому из пп. 1, 5, 9, 21, 33, 34, 35 или 36, отличающийся тем, что антитело связывается с клетками-мишенями, выбранными из опухолевых клеток, клеток, инфицированных вирусом, клеток, инфицированных микроорганизмами, клеток, инфицированных паразитами, аутоиммунных клеток, активированных клеток, миелоидных клеток, активированных Т-клеток, В-клеток или меланоцитов; клеток, экспрессирующих CD4, CD6, CD19, CD20, CD22, CD30, CD33, CD37, CD38, CD40, CD44, CD56, ЕрСАМ, CanAg, CALLA или антигены HER-2, антигены Her-3; или клеток, экспрессирующих рецептор инсулиноподобного фактора роста, рецептор эпидермального фактора роста и рецептор фолата.

39. Способ по п. 38, отличающийся тем, что антитело является одноцепочечным антителом, фрагментом антитела, специфически связывающимся с клеткой-мишенью, моноклональным антителом, одноцепочечным моноклональным антителом или фрагментом моноклонального антитела, специфически связывающимся с клеткой-мишенью, химерным антителом, фрагментом химерного антитела, специфически связывающимся с клеткой-мишенью, доменным антителом или фрагментом доменного антитела, специфически связывающимся с клеткой-мишенью.

40. Способ по п. 38, отличающийся тем, что антитело является антителом с модифицированной поверхностью, одноцепочечным антителом с модифицированной поверхностью или фрагментом антитела с модифицированной поверхностью.

41. Способ по п. 38, отличающийся тем, что антитело является моноклональным антителом, одноцепочечным моноклональным антителом или фрагментом моноклонального антитела.

42. Способ по п. 38, отличающийся тем, что антитело является гуманизированным антителом, гуманизированным одноцепочечным антителом или фрагментом гуманизированного антитела.

43. Способ по любому из любому из пп. 1, 5, 9, 21, 33, 34, 35 или 36, отличающийся тем, что реагент, способный взаимодействовать с иминами, является NaHSO3 или KHSO3.

44. Способ по п. 43, отличающийся тем, что используют от приблизительно 0,1 до приблизительно 30 молярных эквивалентов реагента, способного взаимодействовать с иминами, по отношению к имин-содержащему цитотоксическому соединению.

45. Способ по п. 44, отличающийся тем, что используют от приблизительно 1 до приблизительно 10 молярных эквивалентов реагента, способного взаимодействовать с иминами, по отношению к имин-содержащему цитотоксическому соединению.

46. Способ по п. 45, отличающийся тем, что используют от приблизительно 3 до приблизительно 5 молярных эквивалентов реагента, способного взаимодействовать с иминами, по отношению к имин-содержащему цитотоксическому соединению.

47. Способ по любому из пп. 1, 5, 9, 21, 33, 34, 35 или 36, отличающийся тем, что конъюгат очищают с помощью тангенциальной проточной фильтрации, адсорбционной хроматографии, адсорбционной фильтрации, избирательного осаждения, неабсорбционной фильтрации или их комбинации.

48. Способ по п. 47, отличающийся тем, что конъюгат очищают с помощью тангенциальной проточной фильтрации и/или адсорбционной хроматографии.

49. Способ получения конъюгата следующей формулы:


способ, включающий взаимодействие модифицированного цитотоксического соединения следующей формулы

с модифицированным антителом следующей формулы, соответственно, при pH от приблизительно 4 до приблизительно 9,


СВА представляет собой антитело;

r является целым числом от 1 до 10;

Y является -SO3M; и

М является -Н или фармацевтически приемлемым катионом.

50. Способ по п. 49, отличающийся тем, что модифицированное цитотоксическое соединение получают взаимодействием реагента, способного взаимодействовать с иминами, с имин-содержащим цитотоксическим соединением следующей формулы:

51. Способ по п. 50, отличающийся тем, что антитело является huMy9-6.

52. Способ получения конъюгата следующей формулы:


способ, включающий взаимодействие антитела с имин-содержащим цитотоксическим соединением, реагентом, способным взаимодействовать с иминами, и бифункциональным сшивающим агентом, содержащим связывающую группу, с образованием конъюгата, где:

Y является -SO3M; и М является -Н или фармацевтически приемлемым катионом;

имин-содержащее цитотоксическое соединение является:

бифункциональный сшивающий агент является:


соответственно, и

реагент, способный взаимодействовать с иминами, представляет собой сульфит.

53. Способ по п. 52, в котором конъюгат представлен следующей формулой:

или его фармацевтически приемлемой солью, и бифункциональный сшивающий агент представлен следующей формулой:

54. Способ по любому из пп. 52 или 53, отличающийся тем, что антитело является huMy9-6.


Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к иммуногенным системам презентации множественных антигенов, и может быть использовано в медицине. Иммуногенная композиция против одного или более из антигенного полисахарида, пептидного антигена или полипептидного антигена содержит по меньшей мере один антигенный полисахарид, по меньшей мере один пептидный или полипептидный антиген и по меньшей мере одну комплементарную пару аффинных молекул.

Изобретение относится к соединению, выбранному из формулы I, или его стереоизомерам, или фармацевтически приемлемым солям, где R1 представляет собой необязательно замещенный C1-С3 алкил; R2, R3 и R4 независимо выбраны из Н, F, Cl; R5 выбран из (i) необязательно замещенного C6-С20 арила, выбранного из фенила; (ii) необязательно замещенного С5-С20 гетероарила, выбранного из пиразолила, пиридинила, пиримидинила, тетрагидроизохинолинила, 4,5,6,7-тетрагидропиразоло[1,5-а]пиразинила, 6,7-дигидро-4Н-пиразоло[5,1-с][1,4]оксазинила, 4,6,7-тригидропиразоло[3,2-с][1,4]оксазинила, 5,6,7,8-тетрагидро-1,6-нафтиридинила, 2,3-дигидро-1Н-изоиндолила, 4,5,6,7-тетрагидротиазоло[5,4-с]пиридинила; (iii) необязательно замещенного -(C6-С20 арил)-(C3-С20 гетероциклила), где гетероциклил выбран из азетидинила, пиперидинила, морфолино, пиперазинила; (iv) необязательно замещенного -(С5-С20 гетероарил)-(C3-С20 гетероциклила), где гетероарил выбран из пиридинила и пиридазинила и гетероциклил выбран из азетидинила, пирролидинила, пиперидинила, пиперазинила, 1,4-диазепанила, 2,6-диазаспиро[3.3]гептанила, 7,9-диазабицикло[3.3.1]нонанила, гексагидропирроло[3,4-с]пирролила, морфолино; (v) необязательно замещенного -(C5-С20 гетероарил)-(C1-С6 алкила), где гетероарил выбран из пиразолила и пиридинила; или (vi) необязательно замещенного -(C5-С20 гетероарил)-С(=O)-(C3-С20 гетероциклила), выбранного из (пиридинил)-С(=O)-(морфолино); R6 представляет собой Н или C1-С3 алкил; Y1 и Y2 независимо выбраны из CR6 и N; где C1-С3 алкил, C3-С20 гетероциклил, C6-С20 арил и C5-С20 гетероарил необязательно замещены от одной до трех групп, независимо выбранных из D, F, Cl, Br, I, -СН3, -СН2СН3, -СН2СН(СН3)2, -СН2ОН, -СН2СН2ОН, -С(СН3)2ОН, -CH2F, -ОС(O)СН3, -СОСН3, -NHCH3, -N(CH3)2, =O, -ОН, -ОСН3, -OCH2CH2N(CH3)2, -ОР(O)(ОН)2, -СН2ОСН3, циклопропила, азетидинила, 1-(метилазетидин-3-ил)окси, N-метил-N-оксетан-3-иламино, азетидин-1-илметила, оксетанила и морфолино; где группа (а), образованная Z1, Z2, Z3, Z4, Z5, X и NC(O), образует структуры, приведенные в формуле изобретения, и при этом волнистая линия указывает на место присоединения.

Изобретение относится к диспиропирролидиновому производному, представленному общей формулой (1), где кольцо А представляет собой спиросоединенное 4-6-членное насыщенное углеводородное кольцо, которое может содержать один или несколько заместителей, кольцо В представляет собой бензольное кольцо, которое может содержать один или несколько заместителей, или пиридиновое кольцо, которое может содержать один или несколько заместителей, R1 представляет собой арильную группу, которая может содержать один или несколько заместителей, или гетероарильную группу, которая может содержать один или несколько заместителей, R2 представляет собой атом водорода; иR3 представляет собой группу, представленную общими формулами (2), (3) или (4), которое ингибирует взаимодействие между белком Mdm2 и белком p53 и обладает противоопухолевой активностью.

Изобретение относится к конкретным аналогам диазонамида, структуры которых приведены в формуле изобретения. Соединения по изобретению применяют для изготовления фармацевтической композиции, предназначенной для применения в качестве антипролиферативного средства, содержащей терапевтически эффективное количество соединения в единичной лекарственной форме по меньшей мере с одним фармацевтически приемлемым наполнителем.

Изобретение относится к соединениям бензоксазепина формулы I, обладающим ингибирующей активностью киназы PI3, фармацевтической композиции на их основе, их применению и к набору для лечения.

Изобретение относится к соединению, имеющему общую формулу I, или его фармацевтически приемлемой соли, где R1 является Н или (1-6С алкилом); R2 является Н, (1-6С)алкилом, -(1-6С)фторалкилом, -(1-6С)дифторалкилом, -(1-6С)трифторалкилом, -(1-6С)хлоралкилом, -(2-6С)хлорфторалкилом, -(2-6С)хлоргидроксиалкилом, -(1-6С)гидроксиалкилом, -(2-6С)дигидроксиалкилом, -(1-6С алкил)CN, -(1-6С алкил)SO2NH2, -(1-6С алкил)NHSO2(1-3C алкилом), -(1-6С алкил)NH2, -(1-6С алкил)NHC(=O)O(1-4С алкилом), -(1-6С алкил)гетСус1, -(1-6С алкил)гетAr1, гетAr2, гетСус2, -O(1-6С алкилом), который необязательно замещен галогеном, ОН или (1-4С)алкокси, Сус1, -(1-6С алкил)(3-6С циклоалкилом), -(1-6С алкил)(1-4С алкокси), -(1-6С гидроксиалкил)(1-4С алкокси), мостиковым 7-членным циклоалкильным кольцом, необязательно замещенным (1-6С)гидроксиалкилом, или мостиковым 7-8-членным гетероциклическим кольцом, имеющим 1-2 кольцевых атома азота; или NR1R2 образует 4-6-членное азациклическое кольцо, необязательно замещенное одним или более заместителями, независимо выбранными из (1-6С)алкила, ОН, CO2H, (1-3С алкил)CO2H, -O(1-6С алкила) и (1-6С)гидроксиалкила; Y является (i) фенилом, необязательно замещенным одним или более заместителями, независимо выбранными из галогена, (1-4С)алкокси, -CF3 -O(1-4С алкил)гетСус3, -(1-4С алкил)гетСус3, -O(1-4С алкил)O(1-3С алкила) и -O(3-6С дигидроксиалкила), или (ii) пиридилом, где указанный пиридил необязательно замещен одним или более заместителями, независимо выбранными из галогена, -O(1-4С алкила), (1-4С)алкила и NH2, или (iii) пирид-2-он-3-ильным кольцом, необязательно замещенным одним или более заместителями, независимо выбранными из галогена и (1-4С)алкила; X является -СН2-; R3 является Н; каждый из R4 независимо выбран из галогена, -(1-4С)алкила, -ОН и -СН2ОН; и n равен 0, 1 или 2.

Изобретение относится к соединениям формулы (I) и их фармацевтически приемлемым солям. Соединения изобретения могут применяться в качестве терапевтически активных веществ, ингибирующих PDE10A.

Изобретение относится к области органической химии, а именно к новым производным 8-метил-1-фенилимидазо[1,5-a]пиразина формулы I или к его фармацевтически приемлемым солям, где R1: 1-2 группы, независимо выбираемые из водорода, гидрокси, (1-6C)алкокси, галогена; R2: Н или (1-6C)алкил; R3: (R31)(R32)CH-O; или (1-6C)алкокси; или гетероарил, который представляет собой индол, пиррол, индазол, пирролопиридин, тиенопиррол, необязательно замещенный 1-2 группами, выбранными из R34, R35, R36, галогена, гидрокси; R31: (1-5C)алкил, необязательно замещенный одним гидрокси; R32: (1-5C)алкил; R34: (1-6C)алкил; R35: (1-6C)алкокси; R36: водород или (1-6C)алкил; R4: , или R4: (1-4C)алкил, независимо замещенный 1 заместителем, выбираемым из R8, гидрокси; где m, n, r равно 1 или 2; Y: CR5 или N; X: O, CHR6, C(R66)(R67), NR7, C=O; Z: O или Z образует с R9 5-членный гетероциклил, замещенный R91; R5: H или (1-6C)алкил; R6: R61, R62, R63, R65, H, гидрокси; R7: R71, R72, R73, R74, H; R8: имидазол; R9: Н или (1-6C)алкил, необязательно замещенный одним или несколькими атомами фтора; R61: амино(1-4C)алкил, [(1-6C)алкил]амино(1-4C)алкил, (ди)[(1-6C)алкил]амино(1-4C)алкил, [(1-4C)алкилкарбонил]амино(1-4C)алкил, [(1-4C)алкоксикарбонил]амино(1-4C)-алкил; R62: (1-4C)алкилкарбонилокси, (3-6C)циклоалкиламинокарбонилокси; R63: амино, [(1-6C)алкил]амино, (ди)[(1-6C)алкил]амино, [(1-6C)алкокси(2-6C)алкил]амино, [(1-6C)алкил][(1-6C)алкокси(2-6C)алкил]амино, [(1-6C)-алкилкарбонил][(1-6C)алкокси(2-6C)алкил]амино; все алкильные группы в R63 необязательно замещены 2 атомами фтора; R65: N-присоединенный гетероциклил, который представляет собой пиперазин, азетидин, морфолин, необязательно замещенный 1 оксогруппой, или 2 атомами фтора или одной группой R651; R66: [(1-6C)алкил]амино(1-4C)алкил; R67: гидрокси; R71: (1-6C)алкил; R72: (1-4C)алкил, замещенный 1 группой R725; R73: R732карбонил, R733карбонил или R735карбонил; R74: гетероциклил, который представляет собой тетрагидропиран или пиперидин, необязательно замещенный одной группой R741; R91: (1-6C)алкил, замещенный 3 атомами фтора; R651: (1-4C)алкил, (1-4C)алкилкарбонил; R725: (ди)[(1-6C)алкил]-аминокарбонил; R732: (1-4C)алкил, амино(1-4C)алкил, (ди)[(1-6C)алкил]-амино(1-4C)алкил, гидрокси(1-4C)алкил, (1-6C)алкокси(1-4C)алкил; R733: (1-6C)алкокси; R735: амино; R741: (1-4C)алкилкарбонил.

Изобретение относится к области органической химии, а именно к соединению формулы (I), или его таутомеру, или фармацевтически приемлемой соли, где каждый из Ζ1 и Ζ2: N и CR, где по меньшей мере, один из Ζ1 и Ζ2 представляет собой CR, а каждый R: Н, C1-C4 алкил и -N(R3)(R3); W: -O-, -N(C1-C4) алкил и -C(R6)(R6) -, а каждый R6: Н и C1-C4 алкил, или два R6, связанные с одним и тем же атомом углерода, взяты вместе с образованием =O, R1: фенил и гетероцикл, который представляет собой насыщенное или ненасыщенное 5-6-членное моноциклическое кольцо, содержащее 1-3 гетероатома, выбранных из атомов N, S и О, или 8-12-членное бициклическое кольцо, каждый цикл которого выбран из насыщенного, ненасыщенного и ароматического цикла, содержащее 1-2 атома азота, где R1 необязательно замещен одним или более заместителями, независимо выбранными из галогена, C1-C4 алкила, =O, фторзамещенного C1-C2 алкила, -O-R3, -(C1-C4 алкил)-N(R3)(R3), -N(R3)(R3) и -С(О)-N(R3)(R3), R2: фенил и гетероцикл, который представляет собой ненасыщенное 5-6-членное моноциклическое кольцо, содержащее 1-2 гетероатома, выбранных из атомов N и О, или представляет собой дигидробензофуранил, где R2 необязательно замещен 1-2 заместителями, независимо выбранными из галогена, -C≡N, С1-С4 алкила, С1-С2 фторзамещенного алкила, -O-R3, -(C1-C4 алкил)-N(R3)(R3) и -N(R3)(R3); каждый R3: -С1-С4 алкил; или два R3 взяты вместе с атомом азота, с которым они связаны, с образованием 4-8-членного насыщенного гетероцикла, необязательно содержащего один дополнительный гетероатом, выбранный из N и О, где в случае, когда R3 представляет собой алкил, данный алкил необязательно замещен двумя -ОН группами, а когда два R3 взяты вместе с атомом азота, с которым они связаны с образованием 4-8-членного насыщенного гетероцикла, данный насыщенный гетероцикл необязательно замещен по любому атому углерода фтором; и замещен по любому способному к замещению атому азота водородом; p равен 1, 2 или 3; X2 выбирают из -С(=O)-♣, -С(=O)-O-♣, -C(=O)-NH-♣, -S(=O)2-NH-♣ и -С(=O)-NH-CR4R5-♣, где: ♣ представляет собой место, по которому X2 связан с R1; а каждый R4 и R5 представляет собой водород.

Изобретение относится к соединениям формулы (I), (II), (IV) или (V): двойная линия между N и C представляет собой двойную связь, X отсутствует, а Y является Н; W является С=O; каждый из R1, R2, R3, R4 является Н; R5 выбран из групп OR15, где R15 имеет то же определение, что и R; необязательно R5 является связывающей группой или выбран из групп: полипирроловое, полииндолиловое, полиимидазолиловое, полипирроло-имидазолиловое, полипирроло-индолиловое или полиимидазоло-индолиловое звено, необязательно прикрепленное к связывающей группе; R6 является OR или, необязательно, R6 является связывающей группой; Z выбран из групп (СН2)n, где n является 1, 2 или 3, CR15R16, где каждый из R15 и R16 независимо является Н или линейным алкилом, имеющим от 1 до 10 углеродных атомов; R является Н или линейным или разветвленным алкилом, имеющим от 1 до 3 атомов углерода, необязательно замещенным группой -COR11; R11 является Н или -OR14; и R14 является Н или линейным или разветвленным алкилом, имеющим от 1 до 3 атомов углерода; каждый из R1, R2, R3, R4, R1′, R2′, R3′ и R4′ является Н, необязательно любой из R1, R2, R3, R4, R1′, R2′, R3′ или R4′ является связывающей группой, Z выбран из групп (СН2)n, где n является 1, 2 или 3; R6 является OR, или необязательно R6 является связывающей группой; А и А′ являются О, D и D′, одинаковые или различные, и независимо являются линейными или разветвленными алкилами, имеющими от 1 до 10 углеродных атомов; L отсутствует или является фенильной группой, где указанная фенильная группа представляющая собой L, является необязательно замещенной, где заместитель является связывающей группой или выбран из OR7, NR8R9, NRCOR′ или OCOR11; R и R′ независимо являются Н или линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, необязательно замещенным галогеном или группой -COR7; R7, R8, R9 и R11 независимо являются Н или линейным или разветвленным алкилом, имеющим от 1 до 10 атомов углерода, или полиэтиленгликолевым звеном (-ОСН2СН2)n, где n является целым числом от 1 до 10; при условии что это соединение имеет не более одной связывающей группы, которая обеспечивает связь с клеточносвязывающим агентом за счет ковалентной связи, которые обладают антипролиферативной активностью.

Изобретение относится к 2-фурил-6-нитро-1,2,4-триазоло[1,5-а]пиримидин-7-ону. Технический результат: получено новое соединение, которое может применяться при лечении сепсиса.

Изобретение относится к производным 1,2,4-триазоло[1,5-с]пиримидин-2-сульфонамида общей формулы в которой если R1 - Н, то R2 - Н, если R1 - F, то R2 - F, обладающим гербицидной активностью.

Изобретение относится к новому соединению формулы I или его фармацевтически приемлемой соли, которые обладают свойствами ингибитора тирозинкиназы Брутона. Соединения могут быть использованы в качестве терапевтически активного вещества для лечения воспалительного и/или аутоиммунного состояния, выбранного из ревматоидного артрита и астмы.

Изобретение относится к области органической химии, а именно к гетероциклическому соединению формулы (I) или к его энантиомеру, диастереомеру и их смеси и к его фармацевтически приемлемой соли, где А: СН или N; L: связь или С1-2алкил; R1 выбран из водорода, С1-4алкила, гетероарила, -(СН2)nC(O)OR15, -C(O)R15, -C(O)NR16R17, и -S(O)mR15, где каждый из алкила или гетероарила возможно замещен 1-3 группами, выбранными из галогена, гидрокси, циано, С1-2алкила, С1-2алкокси, С3циклоалкила, С6арила, пиридина и -(CH2)nC(O)OR15; R2 или R4 независимо выбран из водорода и C1-2алкила; R или R3 независимо выбран из водорода и галогена; R5 или R6 независимо выбран из водорода и C1-2алкила; R7, R8, R9 или R10 независимо выбран из водорода, С1-2алкила и гидроксиC1-2алкила; R11, R12, R13 или R14 независимо выбран из водорода или R11 и R12 или R13 и R14, взятые вместе, образуют оксогруппу; R15 выбран из С1-4алкила, С3циклоалкила, С2алкенила, С6арила и пиридина, где каждый из алкила, циклоалкила или гетероарила возможно замещен 1-4 группами, выбранными из галогена, гидрокси, циано, С1-4алкокси, С6арила, тетразола, -NR19R20, -S(O)mR18, -NHC(O)OR18 и -NHS(O)mR18; R16 или R17 независимо выбран из водорода, С1-3алкила и гетероарила, где гетероарил возможно замещен одной группой, выбранной из С1-2алкила, гидрокси, С1-2алкокси, С3циклоалкила, гидроксиC1алкила и -OR18; R18 выбран из С1-4алкила и гидроксиС1-4алкила; R19 или R20 независимо выбран из группы, состоящей из водорода; m равен 0, 1 или 2; n равен 0 или 1; р равен 0, 1 или 2; q равен 0 или 1; s равен 1 или 2; и t равен 1 или 2.

Настоящее изобретение относится к замещенным амидным соединениям формулы (I), фармацевтическим композициям, содержащим такие соединения, и применению таких соединений для снижения в плазме крови уровней липидов, таких как холестерин липопротеинов низкой плотности (LDL-холестерин) и триглицериды, и, таким образом, для лечения заболеваний, которые усугубляются вследствие высоких уровней LDL-холестерина и триглицеридов, таких как атеросклероз и сердечно-сосудистые заболевания, у млекопитающих, включая людей.

Изобретение относится к соединению формулы IIB или его фармацевтически приемлемым солям в которой R представляет собой бициклический 9-членный гетероарил, включающий 1, 2, 3 или 4 гетероатома, независимо выбранного(ых) из N, S или О, где указанный гетероарил может быть замещен с помощью одного заместителя, выбранного из группы, состоящей из оксо и галогена; R1 представляет собой -NHR4, и R4 представляет собой 3-10-членный циклоалкил, арил, выбранный из фенила и тетрагидронафталинила, или 9-10-членный гетероарил, содержащий 1 или 2 гетероатома, выбранных из N и О; 3-10-членный циклоалкил; арил, выбранный из фенила и нафталинила; или 5-10-членный моноциклический или бициклический гетероарил, содержащий 1 или 2 гетероатома, выбранных из N, О и S; R2 и R3 представляют собой водород; значения остальных заместителей указаны в формуле изобретения; или где соединение выбрано из группы, состоящей из соединений, представленных в формуле изобретения.

Изобретение относится к соединению, выбранному из формулы I, или его стереоизомерам, или фармацевтически приемлемым солям, где R1 представляет собой необязательно замещенный C1-С3 алкил; R2, R3 и R4 независимо выбраны из Н, F, Cl; R5 выбран из (i) необязательно замещенного C6-С20 арила, выбранного из фенила; (ii) необязательно замещенного С5-С20 гетероарила, выбранного из пиразолила, пиридинила, пиримидинила, тетрагидроизохинолинила, 4,5,6,7-тетрагидропиразоло[1,5-а]пиразинила, 6,7-дигидро-4Н-пиразоло[5,1-с][1,4]оксазинила, 4,6,7-тригидропиразоло[3,2-с][1,4]оксазинила, 5,6,7,8-тетрагидро-1,6-нафтиридинила, 2,3-дигидро-1Н-изоиндолила, 4,5,6,7-тетрагидротиазоло[5,4-с]пиридинила; (iii) необязательно замещенного -(C6-С20 арил)-(C3-С20 гетероциклила), где гетероциклил выбран из азетидинила, пиперидинила, морфолино, пиперазинила; (iv) необязательно замещенного -(С5-С20 гетероарил)-(C3-С20 гетероциклила), где гетероарил выбран из пиридинила и пиридазинила и гетероциклил выбран из азетидинила, пирролидинила, пиперидинила, пиперазинила, 1,4-диазепанила, 2,6-диазаспиро[3.3]гептанила, 7,9-диазабицикло[3.3.1]нонанила, гексагидропирроло[3,4-с]пирролила, морфолино; (v) необязательно замещенного -(C5-С20 гетероарил)-(C1-С6 алкила), где гетероарил выбран из пиразолила и пиридинила; или (vi) необязательно замещенного -(C5-С20 гетероарил)-С(=O)-(C3-С20 гетероциклила), выбранного из (пиридинил)-С(=O)-(морфолино); R6 представляет собой Н или C1-С3 алкил; Y1 и Y2 независимо выбраны из CR6 и N; где C1-С3 алкил, C3-С20 гетероциклил, C6-С20 арил и C5-С20 гетероарил необязательно замещены от одной до трех групп, независимо выбранных из D, F, Cl, Br, I, -СН3, -СН2СН3, -СН2СН(СН3)2, -СН2ОН, -СН2СН2ОН, -С(СН3)2ОН, -CH2F, -ОС(O)СН3, -СОСН3, -NHCH3, -N(CH3)2, =O, -ОН, -ОСН3, -OCH2CH2N(CH3)2, -ОР(O)(ОН)2, -СН2ОСН3, циклопропила, азетидинила, 1-(метилазетидин-3-ил)окси, N-метил-N-оксетан-3-иламино, азетидин-1-илметила, оксетанила и морфолино; где группа (а), образованная Z1, Z2, Z3, Z4, Z5, X и NC(O), образует структуры, приведенные в формуле изобретения, и при этом волнистая линия указывает на место присоединения.

Настоящее изобретение относится к гетероциклилпиридинилпиразольным производным формулы (I), которая приведена ниже, и к их агрохимическим активным солям. В формуле (I) R1-R5, X1, U, Q, W, Y, n, a, b имеют указанные в формуле изобретения значения.

Изобретение относится к новым производным азетидина, обладающим активностью ингибитора растворимой эпоксидгидролазы (sHE). Предложены соединения формулы I: R1-L1-A-L2-R2, их стереоизомеры и фармацевтически приемлемые соли, где А выбран из группы, состоящей из Ia, Ib или Ic, X представляет собой N или CH2, Y представляет собой N, CH2, CH, L1 представляет собой связь, -С(О)-, -SO2- или -(CH2)0-3-NR3-C(O)-; L2 представляет собой связь, -(СН2)1-3-, -NH-C(O)-NH-, -С(О)-, -SO2- или -(СН2)0-3- NR3-C(O)-; R1 представляет собой фенил, где фенил является незамещенным или замещен одним или двумя R5, 6-членный гетероарил с двумя атомами азота в кольце, где остальные кольцевые атомы представляют собой атомы углерода, или адамантил; R2 представляет собой фенил, -(СН2)1-3-фенил, где фенил является незамещенным или замещен одним или двумя R5, или 6-членный гетероарил с двумя атомами азота в кольце, где остальные кольцевые атомы представляют собой атомы углерода; R3 представляет собой атом водорода; R4 представляет собой атом водорода; R5 представляет собой атом галогена, С1-С6-галогеналкил, С1-С6-галогеналкокси или -C(O)OR4.

Настоящее изобретение касается новых соединений общих формул II, III, IV и V, где значения радикалов указаны в описании, или их фармацевтически приемлемой соли, которые могут использоваться в качестве ингибиторов PDK1.

Настоящее изобретение относится к стабилизированной фармацевтической жидкой композиции пеметрекседа. Композиция содержит пеметрексед или его фармацевтически приемлемую соль в качестве активного ингредиента, N-ацетил-L-цистеин и цитрат натрия, где отношение концентраций, соответственно, составляет 1-30 : 0,15 – 2,0 : 1,0 – 15,0.

Изобретение относится к способу получения конъюгата, включающего агент, связывающийся с клетками, конъюгированный с цитотоксическим соединением посредством связывающей группы, причем указанный способ включает взаимодействие модифицированного цитотоксического соединения с модифицированным СВА при pH от приблизительно 4 до приблизительно 9, причем модифицированный СВА включает остаток бифункционального сшивающего агента, связанный с СВА, а указанный остаток включает связывающую группу и группу, способную взаимодействовать с тиолом, где СВА представляет собой антитело, и модифицированный СВА представлен формулами, указанными в формуле изобретения, модифицированное цитотоксическое соединение включает тиоловую группу и его получают взаимодействием имин-содержащего цитотоксического соединения, несущего тиоловую группу, с реагентом, способным взаимодействовать с иминами, и где имин-содержащее цитотоксическое соединение представлено формулой: в которой X представляет собой –Н, Y представляет собой -Н или оксогруппу, W представляет собой -N-, Re представляет собой -n-Rk, где Rk является -H, линейным, разветвленным или циклическим алкилом, имеющим от 1 до 6 атомов углерода, n является целым числом от 1 до 24, Rx является линейным или разветвленным алкилом, имеющим от 1 до 6 атомов углерода, А и А являются -О-, R6 является -OR, R, в каждом случае, представляет собой линейный или разветвленный алкил, имеющий от 1 до 6 атомов углерода, G представляет собой -CH-, и реагент, способный взаимодействовать с иминами, выбран из группы, состоящей из сульфита, метабисульфита и дитионита. Изобретение также относится к иным способам получения конъюгата. Технический результат: предложены новые способы получения конъюгата с использованием реагента, способного взаимодействовать и иминами, для модификации имин-содержащих цитотоксических соединений. 6 н. и 48 з.п. ф-лы, 28 ил., 16 табл., 16 пр.
