Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул

Авторы патента:


Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул
Новые конструкции транспортеров и молекулы-конъюгаты, являющиеся транспортерами карго-молекул

 


Владельцы патента RU 2570632:

Ксижен Инфлемейшн Лтд., (CY)

Изобретение относится к области биотехнологии. Описаны новые конструкции транспортеров общей формулы (I) D1LLLxDm(LLLyDn)a и их варианты. Также раскрыты молекулы-конъюгаты, которые являются транспортерами карго-молекул, прежде всего конъюгаты новых конструкций транспортеров с карго-фрагментом, например, с белками или пептидами, нуклеиновыми кислотами, цитотоксическими агентами, органическими молекулами и т.д. Описаны также фармацевтические композиции, содержащие указанные конъюгаты, и способы лечения и применения с использованием указанных конструкций транспортеров. Предложенная группа изобретений может быть использована в медицине. 6 н. и 12 з.п. ф-лы, 22 ил., 6 табл., 29 пр.

 

Настоящее изобретение относится к новым конструкциям транспортеров общей формулы (I) D1LLLxDm(LLLyDn)a и их вариантам. Настоящее изобретение относится также к молекулам-конъюгатам, которые являются транспортерами переносимой молекулы (карго-молекулы), прежде всего к конъюгатам новых конструкций транспортеров с карго-фрагментом, который представляет собой, например, белки или пептиды, нуклеиновые кислоты, цитотоксические агенты, органические молекулы и т.д. В настоящем изобретении описаны также (фармацевтические) композиции, содержащие указанные конъюгаты, и способы лечения и применения этих конструкций транспортеров.

Методики, позволяющие обеспечивать эффективный перенос представляющей интерес субстанции, такой как нуклеиновые кислоты, белки или цитотоксические агенты, но также и другие (обладающие терапевтической активностью) соединения, из внешней среды в ткань или клетки, прежде всего в ядра клеток, представляют большой интерес в области биотехнологии. Эти методики можно применять для переноса и транслокации нуклеиновых кислот в клетки in vitro и in vivo и, как следствие, для производства белка или пептида, для регуляции генной экспрессии, для индукции цитотоксических или апоптозных действий, для анализа внутриклеточных процессов и для анализа воздействий, обусловленных транспортом широкого разнообразия различных карго-молекул в клетку (или ядро клетки), и т.д.

Одной из важных областей применения указанного переноса представляющей интерес карго-молекулы из внешней среды в ткань или клетку, является генная терапия, в этом случае карго-молекула, как правило, представляет собой нуклеиновую кислоту или ген. Хотя, как известно, в последние десятилетия достигнуты многообещающие результаты в совершенствовании этого метода, применение переноса генов, как правило, ограничено из-за отсутствия у векторов, предназначенных для транспорта генов, способности к эффективному переносу биологически активных карго-молекул в цитоплазму или ядра клеток в организме хозяина, подлежащего лечению, без воздействия на геном хозяина или изменения биологических свойств активной карго-молекулы.

С учетом этого было разработано несколько методик, способствующих более эффективной трансфекции клеток, например, нуклеиновыми кислотами, такими как ДНК или РНК. Трансфекция нуклеиновыми кислотам клеток или тканей пациентов с помощью метода переноса генов представляет собой основной метод молекулярной медицины, и она имеет решающее значение для лечения и предупреждения многочисленных заболеваний.

Репрезентативными примерами методов переноса генов являются общепринятые (физические или физико-химические) методы, такие как копреципитация нуклеиновых кислот с фосфатом кальция или ДЭАЭ-декстраном, метод, который обеспечивает проникновение нуклеиновых кислот в плазматическую мембрану, а затем проникать в клетку и/или ядро. Однако недостатком этого метода является низкая эффективность переноса и высокий процент гибели клеток. Кроме того, указанный метод можно применять только в условиях in vitro или ex vivo, но он не применим в ситуациях in vivo из-за их специфических природных особенностей.

Это же можно отнести к методам, включающим электропорацию in vitro. Электропорация in vitro основана на применении тока высокого напряжения для того, чтобы сделать клеточные мембраны достаточно проницаемыми с целью интродукции в клетку новых нуклеиновых кислот, например, ДНК или РНК. Однако такие методы, как правило, не пригодны для применения in vivo. Кроме того, недостатками этого метода являются также низкая эффективность переноса и высокий процент гибели клеток.

Другие хорошо известные физические или физико-химические методы включают (непосредственную) инъекцию («голых») нуклеиновых кислот или биобаллистический перенос генов. Биобаллистический перенос генов (известный также как бомбардировка биобаллистическими частицами) представляет собой метод, разработанный в Корнельском университете, который позволяет интродуцировать генетический материал в ткани или культуры клеток. Биобаллистический перенос генов, как правило, осуществляют путем нанесения покрытия на поверхность металлических частиц, таких как золотые или серебряные частицы, и бомбардировки этими металлическими частицами, содержащими адсорбированную ДНК, клеток с помощью генной пушки. Аналогично описанным выше методам этот метод можно применять только в условиях in vitro или ex vivo, но, как правило, он не применим в ситуациях in vivo.

Другие методы основаны на транспортных способностях так называемых молекул-транспортеров. В этом контексте предназначенные для применения молекулы-транспортеры, как правило, можно подразделять на вирусные векторы, т.е. молекулы-транспортеры, которые включают вирусные элементы, и невирусные векторы.

Наиболее успешные применяемые в настоящее время стратегии генной терапии основаны на вирусных векторах, таких как аденовирусы, аденоассоциированные вирусы, ретровирусы и вирусы герпеса. Эти вирусные векторы, как правило, применяют для конъюгации родственной вирусу субстанции, обладающей высокой аффинностью к ДНК и нуклеиновой кислоте. Из-за их инфекционных свойств вирусы или вирусные векторы обладают очень высоким уровнем трансфекции. Вирусные векторы, как правило, представляют собой вирусы, генетически модифицированные таким образом, чтобы в трансфектированных клетках не образовывались функциональные инфекционные частицы. Однако в свете указанных мер предосторожности, связанных с безопасностью, существует много проблем, ассоциированных с вирусными векторами, которые связаны с иммуногенностью, цитотоксичностью и инсерционным мутагенезом. Например, нельзя исключать риск неконтролируемого увеличения интродуцированных терапевтически активных генов или вирусных генов, например, из-за возможных случаев рекомбинации. Кроме того, включающие вирусы конъюгаты трудно применять, и их использование, как правило, требует длительного периода подготовки перед осуществлением обработки (см., например, US №5521291).

Хотя невирусные векторы являются менее эффективными, чем вирусные векторы, при их применении в генной терапии; однако многие из них созданы в качестве безопасной альтернативы генной терапии. Некоторые из наиболее распространенных невирусных векторов включают транспортные системы на основе полиэтиленимина, дендримеров, хитозана, полилизина и пептидов, например, многих типов пептидов, которые, как правило, являются катионными по природе и обладают способностью взаимодействовать с нуклеиновыми кислотами, такими как плазмидная ДНК, посредством электростатических взаимодействий.

Для обеспечения успешного введения невирусные векторы, в частности транспортные системы на основе пептидов, должны обладать способностью преодолевать многие барьеры. Такие барьеры включают защиту карго-фрагмента, например, ДНК или других соединений, в процессе транспорта и предупреждают раннее расщепление или метаболизм карго-фрагмента in vivo. В случае нуклеиновых кислот, таких как молекулы ДНК и РНК, невирусные векторы также могут обладать способностью к специфическому введению этих молекул для эффективной экспрессии генов в клетках-мишенях.

Так, касательно нуклеиновых кислот, таких как молекулы ДНК и РНК, известно 4 барьера, которые должны преодолеть невирусные векторы для обеспечения успешного введения гена (см., например, Martin и др., The AAPS Journal, 9 (1), 2007, статья 3). Невирусные векторы должны обладать способностью 1) плотно сжимать и защищать нуклеиновые кислоты, 2) они должны обладать способностью направленно воздействовать на специфические для клеток поверхностные рецепторы, 3) невирусные векторы должны обладать способностью разрушать эндосомальную мембрану и 4) они должны обеспечивать введение карго-молекулы, представляющей собой нуклеиновую кислоту, в ядро и давать возможность транслироваться кодируемой белковой или пептидной последовательности.

Указанные невирусные векторы, прежде всего невирусные векторы, основой которых являются пептиды, обладают преимуществом по сравнению с другими стратегиями, основанными на применении невирусных векторов, состоящим в том, что они, как правило, обладают способностью решать все 4 указанные задачи, однако с различной эффективностью в отношении различных барьеров.

Например, катионные пептиды, богатые оснбвными остатками, такими как лизин и/или аргинин, обладают способностью эффективно конденсировать нуклеиновые кислоты, такие как ДНК, в небольшие компактные частицы, которые могут стабилизоваться в сыворотке. Кроме того, присоединение пептидного лиганда с полиплексом позволяет обеспечивать направленный перенос к специфическим рецепторам и/или специфическим типам клеток. Как отмечалось выше, полиплексы или катионные полимеры, как правило, формируют комплексы с отрицательно заряженными нуклеиновыми кислотами, что приводит к конденсации нуклеиновых кислот и защите этих нуклеиновых кислот от расщепления. Транспорт в клетки с помощью полиплексов (катионных полимеров), как правило, происходит посредством опосредуемого рецептором эндоцитоза. При этом ДНК сшивают с отличной от нее молекулой, такой как трансферрин, например, через полиплекс поли-L-лизин (PLL), который связывается с поверхностным рецептором и инициирует эндоцитоз. Полиплексы (катионные полимеры) включают, например, поли-L-лизин (PLL), хитозан, полиэтиленимин (PEI), полидиметиламиноэтилметакрилат (PD-MAEMA), полиамидоамин (РАМАМ). Известно, что такие действия характерны также для наноплексов (системы на основе наночастиц) или липоплексов (системы на основе липосом). Наноплексы (системы на основе наночастиц), как правило, предусматривают применение полиакрилатов, полиамидов, полистирола, цианакрилатов, полилактата (PLA), сополимера молочной и гликолевой кислоты (PLGA) и т.д. Липоплексы или липосомные системы, как правило, предусматривают применение катионных липидов, которые обладают способностью имитировать клеточную мембрану. При этом положительно заряженный остаток липида взаимодействует с отрицательно заряженным остатком нуклеиновой кислоты и тем самым может обеспечивать слияние с клеточной мембраной. Липоплексы или липосомные системы включают, например, DOTMA, DOPE, DOSPA, DOTAP, DC-Chol, EDMPC и т.д.

В этом контексте опосредуемый рецептором эндоцитоз также широко используется в экспериментальных системах, предназначенных для направленного введения карго-молекул, таких как нуклеиновые кислоты или терапевтические агенты, в клетки. В процессе опосредуемого рецептором эндоцитоза содержащие карго-молекулу комплексы либо избирательно интернализируются рецепторами, локализованными в клеточной мембране, которые являются специфическими для карго-молекулы, либо специфическими антителами, локализованными в компонентах мембраны. Эндоцитозная активность описана для многих рецепторов, включая IgG-Fc, рецепторы соматостатина, инсулина, IGF-I и -II, трансферрина, EGF, GLP-1, VLDL или интегрина и т.д.

Различные пептидные или белковые последовательности всесторонне протестированы в отношении их применения в методах переноса генов с помощью опосредуемого рецептором эндоцитоза. Важно отметить, что выделение пептидных последовательностей, которые контролируют эффективный опосредуемый рецептором эндоцитоз, в значительной степени усовершенствовалось в результате применения методов фагового дисплея. Фаговые дисплейные библиотеки представляют собой чрезвычайно эффективные инструменты, которые являются практически неограниченными источниками молекулярных вариантов, включая модификации встречающихся в естественных условиях лигандов или карго-фрагментов клеточных рецепторов и коротких пептидов. Подобные библиотеки инъецировали также непосредственно мышам и успешно выделяли пептидные последовательности, которые обладали 13-кратной селективностью в отношении головного мозга и почки.

Пропротеинконвертазы могут служить примером пептидных или белковых последовательностей, которые можно применять для транспорта молекул в клетки. Пропротеинконвертазы являются примером рецептора клеточной поверхности, который интернализируется в результате опосредуемого рецептором эндоцитоза. Установлено, что эти белки ответственны за превращение предшественников пептидных гормонов, нейропептидов и многих других белков в их биологически активные формы. Все сайты расщепления семейства пропротеинконвертаз характеризуются наличием консенсусной последовательности R-X-X-R. Пропротеинконвертазы млекопитающих можно подразделить на 3 группы на основе их распределения в тканях. Фурин, РАСЕ4, РС5/РС6 и LPCIPC7/PC8/SPC7 экспрессируются в широком разнообразии тканей и клеточных линий. В отличие от этого, экспрессия РС2 и РС1/РС3 ограничена нейроэндокринными тканями, такими как панкреатические островки, гипофиз, мозговое вещество надпочечников и многие области головного мозга. Экспрессия РС4 в значительной степени ограничена тестикулярными сперматогенными клетками. Специфические для нейроэндокринной ткани конвертазы РС2 и РС1/РС3 главным образом локализованы в секреторных гранулах. Опубликованы также данные о том, что РС5/РС6А локализованы в секреторных гранулах. Кроме того, имеются косвенные данные, которые позволяют предположить, что часть молекул пропротеинконвертаз присутствует на клеточной поверхности, и было установлено, что фурин циркулирует между TGN (транс-сеть аппарата Гольджи) и клеточной поверхностью. Взятые в совокупности эти свойства свидетельствуют о том, что Пропротеинконвертазы транспортируют внеклеточные лиганды во внутриклеточное пространство.

Представляют интерес также так называемые транслокаторные белки или домены белковой трансдукции (PTD). Пептидные последовательности, выведенные из транслокаторных белков или доменов белковой трансдукции (PTD), как правило, обладают способностью осуществлять избирательный лизис эндосомальной мембраны в ее кислотном окружении, приводя к высвобождению полиплекса в цитоплазму. Транслокаторные белки рассматриваются в качестве группы пептидов, обладающих способностью осуществлять транспорт макромолекул между клетками (транслокаторные белки), к ним относятся белок ТАТ вируса ВИЧ-ЦВИЧ), белок гена antennapedia (Drosophila antennapedia), VP22 HSV (вирус герпеса простого), FGF или лактоферрин и т.д. В отличие от этого домены белковой трансдукции (PTD) рассматриваются в качестве группы пептидов, которые обладают способностью направлять белки и пептиды, ковалентно связанные с этими последовательностями, в клетку через мембрану (Leifert и Whitton: Translocatory proteins and protein transduction domains: a critical analysis of their biological effects and the underlying mechanisms, Molecular Therapy, т.8, №1, 2003). Общей для транслокаторных белков, а также для PTD является основная область, которая рассматривается как основной элемент, ответственный за транспорт слитых пептидов, поскольку она обладает способностью связывать полианионы, такие как нуклеиновые кислоты. Не вдаваясь в теорию, можно предположить, что PTD действуют подобно катионным трансфектирующим реагентам, используя зависящий от рецептора ненасыщаемый адсорбтивный эндоцитоз. PTD, как правило, сшивают с белками или пептидами для того, чтобы оказывать воздействие или повышать CTL-ответ при введении вакцины на основе пептида (см. Melikov и Chernomordik, Arginine-rich cell penetrating polypeptides: from endosomal uptake to nuclear delivery, Cell. Mol. Life Sci., 2005).

К сожалению, основанные на пептидах системы транспортеров подвержены протеолитическому расщеплению in vivo пептидазами, что приводит к образованию укороченных последовательностей транспортеров (и/или карго-молекул). Указанные пептидазы можно подразделять на экзопептидазы и эндопептидазы, оба эта фермента обладают способностью катализировать расщепление белков на пептидные фракции меньшего размера и даже на индивидуальные аминокислоты посредством процесса, известного как протеолиз. В этом контексте к эндопептидазам, как правило, относят протеолитические пептидазы, которые разрушают пептидные связи неконцевых аминокислот (т.е. внутри молекулы). Эндопептидазы, как правило, обладают специфичностью в отношении определенных аминокислот.Примерами эндопептидаз являются, например, трипсин, химотрипсин, эластаза, термолизин, пепсин и эндопептидаза V и т.д. Трипсин, как известно, осуществляет расщепление после Arg или Lys, но, если за ними не следует Pro. Химотрипсин, как известно, осуществляет расщепление после Phe, Trp или Tyr, но, если за ними не следует Pro. Химотрипсин осуществляет расщепление более медленно после Asn, His, Met или Leu. Эластаза осуществляет расщепление после Ala, Gly, Ser или Val, но, если за ними не следует Pro. Термолизин представляет собой термостабильную эндопротеазу, которая осуществляет расщепление перед Ile, Met, Phe, Trp, Tyr или Val, но если перед ними не расположен Pro. Термолизин иногда осуществляет расщепление после Ala, Asp, His или Thr. Пепсин, как известно, осуществляет расщепление перед Leu, Phe, Trp или Tyr, но если перед ними не расположен Pro. И, наконец, эндопептидаза V8, как известно, осуществляет расщепление после Glu. В отличие от эндопептидаз экзопептидазы представляет собой ферменты, которые катализируют удаление аминокислоты с конца полипептидной цепи и, таким образом, расщепляют конец указанной полипептидной цепи. Экзопептидазы можно подразделять на основе их сайта расщепления на аминопептидазы и карбоксипептидазы. Аминопептидазы, как правило, представляют собой цинк-зависимые ферменты, и они продуцируются железами тонкого кишечника. Аминопептидазы, как правило, отщепляют индивидуальную аминокислоту от аминоконца пептидной или белковой последовательности. Карбоксипептидазы, как правило, представляют собой ферменты, которые гидролизуют карбоксиконец (С-конец) пептидной связи. У людей, животных и растений присутствует несколько типов карбоксипептидаз с различными функциями от катаболизма до созревания белков, которые представляют собой пищеварительные ферменты, присутствующие в соке поджелудочной железы, которые отщепляют индивидуальную аминокислоту от карбоксильного конца пептида. Конкретным примером является карбоксипептидаза N (CPN), плазматическая цинксодержащая металлопротеаза, состоящая из двух малых субъединиц, которые обладают ферментативной активностью, и двух больших субъединиц, которые защищают фермент от расщепления. CPN отщепляет карбоксиконцевые аминокислоты аргинин и лизин от биологически активных пептидов, таких как анафилоксины, кинины и фибринопептиды системы комплемента.

Для модификации протеолитического расщепления основанных на пептидах систем транспортеров, указанных выше, основанные на пептидах системы транспортеров могут состоять полностью из D-аминокислот, образуя тем самым «ретро-инвертированные пептидые последовательности». Понятие «ретро-инвертированные (пептидные) последовательности» относится к изомеру линейной пептидной последовательности, в котором направление последовательности изменено на противоположное и хиральность каждого аминокислотного остатка является инвертированной (см., например, Jameson и др., Nature, 368, 1994, cc.744-746; Brady и др., Nature, 368, 1994, cc.692-693). Преимуществом объединения D-энантиомерных аминокислот и обратного синтеза состоит в том, что положения карбонильных и аминогрупп в каждой амидной связи меняются местами, при этом положение групп боковой цепи на каждом альфа-атоме углерода сохраняется. В результате конформационного изменения встречающихся в естественных условиях L-энантиомерных аминокислот пептидной последовательности основанного на пептиде транспортера на D-энантиомерные аминокислоты риск протеолитического расщепления in vivo элиминируется, что является преимуществом и обусловливает высокую эффективность в отношении трансфекции карго-фрагмента в клетку. В отличие от этого, понятие «обратная последовательность» относится к последовательности, в которой направление последовательности является обратным (но хиральность каждого аминокислотного остатка не является инвертированной) (например, D-Arg-L-Arg-L-Arg→L-Arg-L-Arg-D-Arg).

Однако, несмотря на эффективность «работы» в качестве молекулы-транспортера, как указано выше, конформационное изменение встречающихся в естественных условиях L-энантиомерных аминокислот пептидной последовательности основанного на пептиде транспортера на D-энантиомерные аминокислоты влечет за собой риск доминирующего накопления этих транспортеров в клетке в течение всего времени жизни клетки или даже в течение более длительного периода времени в (окружающей) ткани или организме. Таким образом, указанные транспортеры даже, если прикрепленная карго-молекула отщепляется или метаболизируется к тому времени, могут сохраняться в клетке и принимать участие в дальнейших меж - и внутриклеточных процессах, приводя к неизвестным и нежелательным побочным действиям.

Таким образом, в данной области существует необходимость в создании альтернативных невирусных молекул-транспортеров, предпочтительно основанных на пептидах систем транспортеров, указанных выше, которые не обладают указанным нежелательным накоплением в клетке или ткани, но при этом могут эффективно переносить карго-фрагменты в клетки.

Вышеуказанная задача решается с помощью объектов изобретения, представленных в прилагаемой формуле изобретения, прежде всего с помощью новой конструкции транспортеров и их конъюгатов (молекула-конъюгат, являющаяся транспортером карго-молекулы), описанных в формуле изобретения. Вышеуказанная задача решается также с помощью способов и вариантов применения новой конструкции транспортера и его конъюгатов, описанных в формуле изобретения.

Таким образом, согласно первому объекту настоящего изобретения задача решается с помощью новой конструкции транспортера, которая содержит или состоит по меньшей мере из одной последовательности общей формулы (I) (SEQ IDNO:I):

D1LLLxDm(LLLyDn)a

в которой:

D обозначает D-аминокислоту;

L обозначает L-аминокислоту;

а обозначает 0-3, предпочтительно 0-2, более предпочтительно 0, 1, 2 или 3, еще более предпочтительно 0, 1 или 2 и наиболее предпочтительно 1;

l, m и n каждый независимо друг от друга обозначает 1 или 2, предпочтительно 1;

x и y каждый независимо друг от друга обозначает 0, 1 или 2, предпочтительно 1.

В контексте настоящего описания понятие «конструкция транспортера» относится к состоящему из аминокислот соединению, которое обладает способностью к транслокации через биологические мембраны. В контексте настоящего описания понятие «переносящая (обеспечивающая перенос) последовательность» (или «последовательность транспортера») относится к последовательности аминокислот, которая обеспечивает транслокацию через биологические мембраны. Таким образом, конструкции транспортеров, предлагаемые в настоящем изобретении, содержат переносящую последовательность, которая обеспечивает транслокацию конструкции транспортера через биологические мембраны. Таким образом, новые конструкции транспортеров общей формулы (I) позволяют эффективно осуществлять и могут обеспечивать транспорт карго-фрагментов, например, белков или пептидов, нуклеиновых кислот или небольших органических молекул, антигенов, цитотоксических агентов и т.д. в организм, ткань, клетку (например, подлежащую лечению), клеточный субкомпартмент и/или в ядро клетки.

Предпочтительно предлагаемая в изобретении конструкция транспортера общей формулы (I) является достаточно стабильной, не расщепляясь протеазами до транспорта карго-фрагмента в его область-мишень. С другой стороны, предлагаемые в изобретении конструкции транспортеров общей формулы (I) не обладают длительной устойчивостью в клетке и могут расщепляться протеазами в течение приемлемого периода времени, что позволяет избегать отрицательных побочных действий, таких как нежелательное накопление нового предлагаемого в изобретении транспортера или его конъюгата в клетке. При создании изобретения неожиданно было установлено, что указанные благоприятные свойства можно придавать обеспечивающей перенос последовательности, прежде всего любой обеспечивающей перенос последовательности, известной в данной области, только с помощью предлагаемой в изобретении схемы (в контексте настоящего описания обозначена также как D-/L-cxeмa) указанной выше общей формулы (I), конкретного содержания и положения D-аминокислот в чередовании с конкретным содержанием L-аминокислот, как указано в общей формуле (I). Такая предлагаемая в изобретении D-/L-схема позволяет специалисту в данной области определять персистентность in vivo или in vitro предлагаемой в изобретении новой конструкции транспортера, описанной выше, в клетке, которая точно является достаточной, поскольку представляет собой промежуток времени, достаточно длинный для гарантии введения и проникновения предлагаемой в изобретении новой конструкции транспортера в клетку или ядро, до расщепления предлагаемой в изобретении новой конструкции транспортера протеазами в приемлемый промежуток времени. Такая персистентность in vivo или in vitro предлагаемой в изобретении новой конструкции транспортера в клетке фактически зависит от конкретного содержания и положения D-аминокислот в чередовании с конкретным содержанием L-аминокислот, как указано в общей формуле (I). Кроме того, конструкция транспортера, отличающаяся предлагаемой в изобретении D-/L-схемой, указанной выше в общей формуле (I), является достаточно короткой для того, чтобы избегать стерических помех, связанных с карго-фрагментом, в предлагаемой в изобретении новой конструкции транспортера, входящей в описанную ниже молекулу-конъюгат, которая является транспортером карго-молекулы. Это обеспечивает также эффективную стоимость получения таких предлагаемых в изобретении новых конструкций транспортеров. Кроме того, можно легко получать конъюгат являющегося транспортером пептида или белка указанной выше общей формулы (I) либо с белками или пептидами, нуклеиновыми кислотами, такими как молекулы ДНК и РНК, либо с цитотоксическими агентами или даже небольшими органическими молекулами и т.д.

Согласно указанной выше общей формуле (I) предлагаемая в изобретении новая конструкция транспортера содержит L-аминокислоты и D-аминокислоты согласно конкретной D-/L-cxeмe, представленной в общей формуле (I).

В контексте настоящего изобретения L-аминокислоты, обозначенные также как L-энантиомерные аминокислоты, предпочтительно представляют собой аминокислоты, выбранные из встречающихся в естественных условиях аминокислот или их производных. Встречающиеся в естественных условиях аминокислоты, как правило, выбирают из стандартных (протеиногенных) аминокислот, таких как аланин, аргинин, аспарагин, аспарагиновая кислота, цистеин, глутамин, глутаминовая кислота, глицин, гистидин, изолейцин, лейцин, лизин, метионин, фенилаланин, пролин, серин, треонин, триптофан, тирозин и валин, а также из нестандартных аминокислот, таких как орнитин, цитруллин, гомоцистеин, S-аденозилметионин, гидроксипролин, селеноцистеин, пирролизин, лантионин, 2-аминоизомасляная кислота, дегидроаланин, гамма-аминомасляная кислота и т.д.

Производные указанных L-аминокислот или L-энантиомерных аминокислот, как правило, представляют собой любое встречающееся в естественных условиях или не встречающееся в естественных условиях производное этих аминокислот, включая (но, не ограничиваясь только ими), указанные выше аминокислоты, содержащие пост-трансляционные модификации или синтетические модификации, включая ацетилирование (на N-конце пептидной последовательности, на остатках лизина и т.д.), деацетилирование, алкилирование, например, метилирование, этилирование и т.д. (предпочтительно на остатках лизина или аргинина в пептидной последовательности), деалкилирование, например, деметилирование, деэтилирование и т.д., амидирование (предпочтительно на С-конце пептидной последовательности), формилирование, гамма-карбоксилирование, глутамилирование, гликозилирование (предпочтительно на остатках аспарагина, лизина, гидроксилизина, серина или треонина и т.д. в пептидной последовательности), добавление гема или фрагмента гема, гидроксилирование, йодирование, изопренилирование, включающее добавление изопреноидного остатка, такого как фарнезил или геранилгераниол и т.д.), липоилирование (присоединение функциональной группы липоата), например, пренилирование, образование GPI-якоря, включая миристоилирование, фарнезилирование, геранилгераниолирование и т.д., окисление, фосфорилирование (например, на остатках серина, тирозина, треонина или гистидина и т.д. в пептидной последовательности), сульфатацию (например, тирозина), селеноилирование, сульфатирование и т.д.

Производные L-аминокислот включают также (но, не ограничиваясь только ими) модифицированные L-аминокислоты, которые модифицированы путем интродукции одной из следующих меток:

(I) радиоактивные метки, т.е. радиоактивное фосфорилирование или радиоактивная метка, представляющая собой радиоактивную/радиоактивный серу, водород, углерод, азот и т.д.;

(II) окрашивающие вещества (например, дигоксигенин и т.д.);

(III) флуоресцентные группы (например, флуоресцеин, родамин, флуорохромные белки, описанные ниже и т.д.);

(IV) хемолюминесцентные группы;

(V) комбинация меток, состоящая из двух или большего количества меток, указанных в подпунктах (I)-(IV).

Наиболее предпочтительными примерами производных L-аминокислот являются (но, не ограничиваясь только ими) АМС (аминометилкумарин), дабцил (диметиламинофенилазобензоил), дансил (диметиламинонафталинсульфонил), FAM (карбоксифлуоросцеин), Мса (метоксикумаринацетил), Хап (ксантил), Abu (аминомасляная кислота), бета-Ala (бета-аланин), E-Ahx (6-аминокапроновая кислота), альфа-Aib (альфа-аминоизомасляная кислота), Ams (аминосерин), Cha (циклогексиламин), Dab (диаминомасляная кислота), Hse (гомосерин). Hyp (гидроксипролин), Mpr (меркаптопропионовая кислота), Nal (нафтилаланин), Nva (норвалин), Огп (орнитин), Phg (фенилглицин), Sar (саркозин), Sec (селеноцистеин), ТЫ (тиенилаланин) и т.д.

Кроме того, L-энантиомерные аминокислоты, выбранные для предлагаемой в изобретении конструкции транспортера, можно выбирать из конкретных комбинаций вышеуказанных L-энантиомерных аминокислот или их производных. Такие комбинации могут включать 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 или даже большее количество вышеуказанных L-энантиомерных аминокислот или их производных. Возможны также комбинации между любыми вышеуказанными L-энантиомерными аминокислотами или их производными и любыми из вышеуказанных D-энантиомерных аминокислот или их производных в контексте понятий общей формулы (I) или любых подформул, указанных в настоящем описании. Указанные конкретные комбинации аминокислот могут отличаться более высокой или более низкой стабильностью при воздействии пептидаз и поэтому могут представлять собой дополнительную возможность придания in vivo или in vitro предлагаемой в изобретении новой конструкции транспортера, указанной выше, более высокой или более низкой стабильности. Например, предлагаемая в изобретении новая конструкция транспортера может содержать дипептидную последовательность Arg-Lys в D- и/или L-форме (т.е. либо в виде D-энантиомерных аминокислот, либо L-энантиомерных аминокислот, либо смешанных D- и L-энантиомерных аминокислот), предпочтительно в L-форме, которая обладает пониженной стабильностью при воздействии пептидаз, и поэтому их можно применять для дестабилизации пептидной последовательности предлагаемой в изобретении новой конструкции транспортера и тем самым для снижения ее времени полужизни in vivo до требуемого уровня.

В контексте настоящего изобретения D-аминокислоты, обозначенные также как D-энантиомерные аминокислоты, предпочтительно обозначают ненативные (непротеиногенные) «ретро-инвертированные» аминокислоты, где эти ненативные (непротеиногенные) «ретро-инвертированные» аминокислоты предпочтительно выведены из встречающихся в естественных условиях L-аминокислот и/или их производных, как указано выше. В этом контексте понятие «ретро-инвертированные» относится к изомеру встречающейся в естественных условиях L-аминокислоты, как она определена выше (и к полученным из нее пептидамв), в котором хиральность остатка встречающейся в естественных условиях L-аминокислоты является инвертированной с образованием соответствующей D-аминокислоты (см., например, Jameson и др., Nature, 368, 1994, cc.744-746; Brady и др., Nature, 368, 1994, cc.692-693). Другими словами, в пептидных связях D-аминокислот положения карбонильной и аминогрупп меняются местами, при этом положение групп боковых цепей на каждом альфа-атоме углерода сохраняется прежним. Таким образом, D-аминокислоты можно встраивать в пептидную последовательность, которая состоит или содержит L-аминокислоты, и при этом можно конъюгировать с L-аминокислотами, как указано выше, с помощью методов, известных в данной области. Такие методы известны и включают, например (но, не ограничиваясь только ими) методы жидкофазного синтеза пептидов или методы твердофазного синтеза пептидов, например, методы твердофазного синтеза пептидов согласно методу Меррифилда, твердофазный синтез пептидов с использованием трет-Вос, твердофазный синтез пептидов с использованием, Fmoc, твердофазный синтез пептидов с использованием ВОР (гексафторфосфат бензотриазол-1-илокси-трис(диметиламино)фосфония) и т.д. Содержание D-аминокислот в предлагаемых в изобретении новых конструкциях транспортеров, которые имеют D-/L-схему общей формулы (I), обеспечивает дополнительное разнообразие ценных свойств. Например, такие новые конструкции транспортеров проникают в клетку более эффективно и являются более стабильными (прежде всего in vivo) и отличаются пониженной иммуногенностью по сравнению с конструкциями транспортеров на основе соответствующих L-аминокислотных последовательностей. Однако они не являются столь же персистентными в клетке, что и конструкции транспортеров, состоящие полностью из D-аминокислот, в частности, из-за того, что практически все расщепляющие ферменты, типа протеаз или пептидаз, расщепляют пептидные связи между смежными L-аминокислотами. Следовательно, пептиды, состоящие из D-энантиомерных аминокислот и L-энантиомерных аминокислот, обладают более значительной устойчивостью к быстрому протеолитическому расщеплению, не накапливаясь в клетке благодаря отсутствию расщепления протеазами.

Указанная выше предлагаемая в изобретении новая конструкция транспортера общей формулы (I) предпочтительно содержит L-аминокислоты и D-аминокислоты или их производные, указанные выше. Такие производные могут входить в состав полной предлагаемой в изобретении новой конструкции транспортера в количестве примерно 0%, примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80%, примерно 90% или даже примерно 100%. Другими словами, предлагаемая в изобретении новая конструкция транспортера может содержать примерно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 или даже большее количество таких производных, при этом максимальное количество возможных производных ограничено, естественно, максимальным количеством аминокислот, входящих в указанную выше предлагаемую в изобретении новую конструкцию транспортера общей формулы (I).

Согласно указанной выше общей формулы (I) предлагаемая в изобретении новая конструкция транспортера содержит определенную D-/L-схему L-аминокислот и D-аминокислот, что обозначено целыми числами а, l, m, n, x и y.

Согласно указанному выше определению общей формулы (I) а обозначает символ, определяющий количество повторов подгруппы (LLLyD), как она определена в общей формуле (I) D1LLLxDm(LLLyDn)a. Согласно указанному выше определению а можно выбирать из любого числа от 0 до 3, предпочтительно от 0 до 2, более предпочтительно от 0 до 1, или его можно выбирать из индивидуальных значений 0, 1, 2 или 3, еще более предпочтительно из индивидуальных значений 0, 1 или 2 и наиболее предпочтительно а=1. В зависимости от конкретного количества повторов (а=0, 1, 2 или 3) предлагаемая в изобретении новая конструкция транспортера общей формулы (I) D1LLLxDm(LLLyDn)a может содержать или состоять по меньшей мере из одной из следующих подформул (Ia)-(Id):

(Ia): D1LLLxDm (SEQ ID NO:2);

(Ib): D1LLLxDmLLLyDn (SEQ ID NO:3);

(Ic): D1LLLxDmLLLyDnLLLyDn (SEQ ID NO:4) или

(Id): D1LLLxDmLLLyDnLLLyDnLLLyDn (SEQ ID NO:5).

Кроме того, согласно указанному выше определению общей формулы (I) символы l, m и n обозначают целые числа, определяющие количество D-аминокислот в общей формуле (I), но также и в подформулах (Ia)-(Id), как они определены в настоящем описании. Целые числа в качестве l, m и n можно выбирать независимо друг от друга. Это относится, в частности, к символу п, который может встречаться несколько раз в общей формуле (I) или подформулах (Ia)-(Id), как они определены в настоящем описании, т.е., если п встречается несколько раз, то каждый п можно выбирать независимо друг от друга. Согласно указанному выше целые числа l, m и n каждый независимо друг от друга можно выбирать из любого числа от 1 до 2, или можно выбирать из индивидуальных значений 1 или 2, еще более предпочтительно l, m и/или n=1.

Кроме того, согласно указанному выше определению общей формулы (I) x и у обозначают целые числа, определяющие количество L-аминокислот в общей формуле (I), но также и в подформулах (Ia)-(Id), как они определены в настоящем описании. Целые числа в качестве х и у можно выбирать независимо друг от друга. Согласно указанному выше целые числа х и у каждый независимо друг от друга можно выбирать из любого числа от 0 до 2, предпочтительно от 0 до 1, или можно выбирать из индивидуальных значений 0, 1 или 2, еще более предпочтительно из индивидуальных значений 0 или 1 и наиболее предпочтительно х и/или y=1.

Согласно одному конкретному предпочтительному варианту осуществления изобретения задача, положенная в основу настоящего изобретения, решается с помощью новой конструкции транспортера, которая содержит или состоит по меньшей мере из одной последовательности конкретной подформулы (Ie):

DLLLD(LLLD)a(SEQ ID NO:6);

в которой D, L и а имеют значения, указанные выше для общей формулы (I) или подформул (Ia)-(Id).

Согласно другому конкретному предпочтительному варианту осуществления изобретения задача, положенная в основу настоящего изобретения, решается с помощью новой конструкции транспортера, которая содержит или состоит по меньшей мере из одной последовательности конкретной подформулы (If):

DLLLDLLLD (SEQ ID NO:7);

в которой dhl имеют значения, указанные выше для общей формулы (I) или подформул (Ia)-(Id).

Предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или соответствующую любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), прежде всего конструкции транспортеров, содержащие новую D-/L-схему, можно использовать в сочетании или применять в виде любой предназначенной для переноса последовательности, известной в данной области, при этом выбранное количество смежных аминокислот этих обеспечивающих перенос последовательностей определяется количеством аминокислот, указанным в общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If). Указанные обеспечивающие перенос последовательности, как правило, направляют транспорт карго-фрагмента в клетку или ядро или также конкретную область-мишень, и они могут включать (но, не ограничиваясь только ими) транслокаторные белки, указанные выше, например, выведенные из ТАТ БИЧ (ВИЧ), например, нативные белки, такие, например, как белок ТАТ (например, описанный в U.S. №5804604 и U.S. №5674980, каждый из которых включен в настоящее описание в качестве ссылки) например, выведенные из ТАТ ВИЧ (ВИЧ), VP22 HSV (вирус герпеса простого) (описанные, например, в WO 97/05265; Elliott и O'Hare, Cell 88, 1997, cc.223-233), невирусные белки (Jackson и др., Proc. Natl. Acad. Sci. USA 89, 1992, cc.10691-10695), обеспечивающие перенос последовательности, выведенные из гена antennapedia, прежде всего из Drosophila antennapedia (например, последовательность-носитель из antennapedia), FGF, лактоферрин и т.д., или выведенные из основных пептидов, например, пептидов, состоящих из 5-15 аминокислот, предпочтительно 10-12 аминокислот и содержащих по меньшей мере 80%, более предпочтительно 85% или даже 90% основных аминокислот, таких, например, как аргинин, лизин и/или гистидин, или их можно выбирать из богатых аргинином пептидных последовательностей, таких как R9, R8, R7, R6, R5 и т.д., из VP22, из выведенных из PTD-4 белков или пептидов, из RGD-K16, из выведенных из РЕРТ1/2 или РЕРТ1/2 белков или пептидов, из выведенных из SynB3 или SynB3 белков или пептидов, из ингибиторов PC, из выведенных из Р21 белков или пептидов или из выведенных из JNKI белков или пептидов. Кроме того, в качестве указанных в настоящем описании обеспечивающих перенос последовательностей применяют варианты, фрагменты и производные одного из нативных белков.

Конкретные примеры обеспечивающих перенос последовательностей, которые являются основой новой конструкции транспортера, соответствующих общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены в настоящем описании, можно выбирать из (но, не ограничиваясь только ими) так называемых обеспечивающих проникновение в клетку ТАТ-последовательностей, выведенных из основных обеспечивающих перенос последовательностей белка ТАТ ВИЧ-1. Предпочтительно основные обеспечивающие перенос последовательности белка ТАТ ВИЧ-1 могут включать последовательности из белка ТАТ человеческого вируса иммунодефицита ВИЧ-1, которые описаны, например, в U.S. №№5804604 и 5674980, каждый из которых включен в настоящее описании в качестве ссылки. В этом контексте полноразмерный белок ТАТ ВИЧ-1 имеет 86 аминокислотных остатков [SEQ ID NO:8], кодируемых двумя экзонами гена ТАТ ВИЧ. Аминокислоты 1-72 ТАТ кодируются экзоном 1, а аминокислоты 73-86 кодируются экзоном 2. Полноразмерный белок ТАТ отличается наличием основной области, которая содержит два остатка лизина и шесть аргинина (аминокислоты 49-57), и богатой цистеином области, которая содержит семь остатков цистеина (аминокислоты 22-37). Основная область (т.е. аминокислоты 49-57), вероятно, является важной для ядерной локализации (Ruben 8.и др., J. Virol. 63, 1989, cc.1-8; Hauber J. и др., J. Virol. 63, 1989, cc.1181-1187). Богатая цистеином область опосредует формирование связанных металлом димеров in vitro (Frankel A.D. и др., Science 240, 1988, cc.70-73; Frankel A.D. и др., Proc. Natl. Acad. Sci USA 85, 1988, cc.6297-6300) и имеет решающее значение для его активности в качестве трансактиватора (Garcia J. А. и др., ЕМВО J. 7, 1988, с.3143; Sadaie M.R. и др., J. Virol. 63, 1989, c.1). Также как и в других регуляторных белках, N-концевая область может принимать участие в защите от внутриклеточных протеаз (Bachmair А. и др., Cell 56, 1989, cc.1019-1032). Предпочтительные обеспечивающие перенос ТАТ-последовательности, применяемые в сочетании с общей формулой (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), предпочтительно отличаются присутствием аминокислотной последовательности основной области ТАТ (аминокислоты 49-57 встречающегося в естественных условиях белка ТАТ); отсутствием аминокислотной последовательности богатой цистеином области ТАТ (аминокислоты 22-36 встречающегося в естественных условиях белка ТАТ) и отсутствием кодируемого экзоном 2 карбоксиконцевого домена ТАТ (аминокислоты 73-86 встречающегося в естественных условиях белка ТАТ).

Согласно более предпочтительному варианту осуществления настоящего изобретения обеспечивающие перенос последовательности, которые являются основой новой конструкции транспортера, соответствующие общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, можно выбирать из аминокислотной последовательности, которая содержит остатки 48-57 или 49-57 ТАТ, и наиболее предпочтительно последовательности ТАТ, представленной в любой из SEQ ID NO:8-14, или из генерической последовательности ТАТ NH2-Xnb-RKKRRQRRR-Xnb-COOH (L-генерик-ТАТ (s)) [SEQ ID NO:16] и/или XXXXRKKRRQ RRRXXXX (L-генерик-TAT) [SEQ ID NO:15]. В этом контексте X каждый, как правило, обозначает аминокислотный остаток, предпочтительно выбранный из любого (встречающегося в естественных условиях) аминокислотного остатка, представленного в настоящем описании. Кроме того, Xnb каждый можно выбирать из аминокислотного остатка, представленного в настоящем описании, где n (число повторений X) обозначает 0-5, 5-10, 10-15, 15-20, 20-30. Предпочтительно Xnb обозначает состоящий из смежных пептидных остатков участок, полученный из SEQ ID NO:8 (ТАТ (1-86)). В альтернативном варианте обеспечивающие перенос последовательности, которые являются основой новой конструкции транспортера, соответствующие общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, можно выбирать, например, из пептида, содержащего аминокислотную последовательность NH2-GRKKRRQRRR-COOH (L-TAT (s1a)) [SEQ ID NO:17] или аминокислотную последовательность NH2-RKKRRQRRR-COOH (L-TAT (s1b))[SEQ ID NO:18].

Специалисту в данной области должно быть очевидно, что фразы типа «последовательность, соответствующая общей формуле (I) или соответствующая любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If)» можно использовать в сочетании или применять в виде конкретной (обеспечивающей перенос) последовательности, или последовательности, которая является основой пептидной конструкции транспортера общей формулы (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If) и т.д., служат для иллюстрации того, что заявляемая последовательность отличается определенными характеристиками касательно:

I) последовательности остатков боковых цепей, характерных для конкретных аминокислот, и

II) последовательности D- и L-аминокислот в указанной последовательности.

Так, в приведенном в качестве иллюстрации примере: если подформулу (If) используют в сочетании или применяют к ТАТ (1-86) (SEQ ID NO:8), то последовательность остатков боковых цепей (I) представлена в SEQ ID NO:8. Однако эта заявляемая последовательность не является полностью-L-аминокислотной последовательностью, но содержит в определенном положении мотив подформулы (If). Примером этого варианта осуществления изобретения является следующая последовательность (D-аминокислоты обозначены прописными буквами, L-аминокислоты обозначены заглавными буквами):

MEPVDPRLEP WKHPGSQPKT ACTNCYCKKC CFHCQVCFIT
KALGISYGrK KRrQRRrPPQ GSQTHQVSLS KQPTSQSRGD
PTGPKE.

Поскольку SEQ ID NO:8 состоит из 86 аминокислот, естественно, существует несколько дополнительных возможностей локализации мотива подформулы (If) в этой последовательности. Также должно быть очевидно, что в конкретных вариантах осуществления изобретения последовательность может содержать более одного мотива общей формулы и/или ее подформул.

Наиболее предпочтительными примерами обеспечивающих перенос последовательностей, которые являются основой новой конструкции транспортера, соответствующих общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, могут являться (но, не ограничиваясь только ими) последовательности или их части, представленные ниже в таблице 1, или любые их фрагменты или варианты, или производные (если они сохраняют способность осуществлять транслокацию через биологическую мембрану).

Таблица 1
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
ТАТ(1-86) 8 86 MEPVDPRLEP WKHPGSQPKT ACTNCYCKKC CFHCQVCFIT KALGISYGRK KRRQRRRPPQ GSQTHQVSLS KQPTSQSRGD PTGPKE
ТАТ(37-72) 9 36 CFITKALGIS YGRKKRRQRR RPPQGSQTHQ VSLSKQ
TAT(37-58) 10 22 CFITKALGIS YGRKKRRQRR RP
TAT(38-58)GGC 11 24 FITKALGISY GRKKRRQRRR PGGC
TAT CGG(47-58) 12 15 CGGYGRKKRR QRRRP
TAT(47-58)GGC 13 15 YGRKKRRQRR RPGGC
TAT(1-72) MutCys/Ala72 14 56 MEPVDPRLEP WKHPGSQPKT AFITKALGIS YGRKKRRQRR RPPQGSQTHQ VSLSKQ
L-генерик-ТАТ 15 17 XXXXRKKRRQRRRXXXX (NH2-XXXXRKKRRQRRRXXXX-COOH)
L-генерик-ТАТ (s) 16 11 NH2-Xnb-RKKRRQRRR-Xnb-COOH
L-TAT(s1a) 17 10 GRKKRRQRRR (NH2-GRKKRRQRRR-COOH)
L-TAT(s1b) 18 9 RKKRRQRRR (NH2-GRKKRRQRRR-COOH)
L-TAT(s1c) 19 11 YDRKKRRQRRR
r3-L-TAT 20 9 rKKRrQRRr
r3-L-TATi 21 9 rRRQrRKKr
βA-r3-L-tat 22 9 βA-rKKRrQRRr
βА-r3-L-TATi 23 9 βA-rRRQrRKKr
FITC-βа-r3-L-тат 24 9 FITC-βA-rKKRrQRRr
FITC-βA-r3-L-TATi 25 9 FITC-βA-rRRQrRKKr
TAT(s2-1) 26 9 rAKRrQRRr
TAT(s2-2) 27 9 rKARrQRRr
TAT(s2-3) 28 9 rKKArQRRr
TAT(s2-4) 29 9 rKKRrARRr
TAT(s2-5) 30 9 rKKRrQARr
TAT(s2-6) 31 9 rKKRrQRAr
TAT(s2-7) 32 9 rDKRrQRRr
TAT(s2-8) 33 9 rKDRrQRRr
TAT(s2-9) 34 9 rKKDrQRRr
TAT(s2-10) 35 9 rKKRrDRRr
TAT(s2-11) 36 9 rKKRrQDRr
TAT(s2-12) 37 9 rKKRrQRDr
TAT(s2-13) 38 9 rEKRrQRRr
TAT(s2-14) 39 9 rKERrQRRr
TAT(s2-15) 40 9 rKKErQRRr
TAT(s2-16) 41 9 rKKRrERRr
TAT(s2-17) 42 9 rKKRrQERr
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
TAT(s2-18) 43 9 rKKRrQREr
TAT(s2-19) 44 9 rFKRrQRRr
TAT(s2-20) 45 9 rKFRrQRRr
TAT(s2-21) 46 9 rKKFrQRRr
TAT(s2-22) 47 9 rKKRrFRRr
TAT(s2-23) 48 9 rKKRrQFRr
TAT(s2-24) 49 9 rKKRrQRFr
TAT(s2-25) 50 9 rRKRrQRRr
TAT(s2-26) 51 9 rKRRrQRRr
TAT(s2-27) 52 9 rKKKrQRRr
TAT(s2-28) 53 9 rKKRrRRRr
TAT(s2-29) 54 9 rKKRrQKRr
TAT(s2-30) 55 9 rKKRrQRKr
TAT(s2-31) 56 9 rHKRrQRRr
TAT(s2-32) 57 9 rKHRrQRRr
TAT(s2-33) 58 9 rKKHrQRRr
TAT(s2-34) 59 9 rKKRrHRRr
TAT(s2-35) 60 9 rKKRrQHRr
TAT(s2-36) 61 9 rKKRrQRHr
TAT(s2-37) 62 9 rIKRrQRRr
TAT(s2-38) 63 9 rKIRrQRRr
TAT(s2-39) 64 9 rKKIrQRRr
TAT(s2-40) 65 9 rKKRrIRRr
TAT(s2-41) 66 9 rKKRrQIRr
TAT(s2-42) 67 9 rKKRrQRIr
TAT(s2-43) 68 9 rLKRrQRRr
TAT(s2-44) 69 9 rKLRrQRRr
TAT(s2-45) 70 9 rKKLrQRRr
TAT(s2-46) 71 9 rKKRrLRRr
TAT(s2-47) 72 9 rKKRrQLRr
TAT(s2-48) 73 9 rKKRrQRLr
TAT(s2-49) 74 9 rMKRrQRRr
TAT(s2-50) 75 9 rKMRrQRRr
TAT(s2-51) 76 9 rKKMrQRRr
TAT(s2-52) 77 9 rKKRrMRRr
TAT(s2-53) 78 9 rKKRrQMRr
TAT(s2-54) 79 9 rKKRrQRMr
TAT(s2-55) 80 9 rNKRrQRRr
TAT(s2-56) 81 9 rKNRrQRRr
TAT(s2-57) 82 9 rKKNrQRRr
TAT(s2-58) 83 9 rKKRrNRRr
TAT(s2-59) 84 9 rKKRrQNRr
TAT(s2-60) 85 9 rKKRrQRNr
TAT(s2-61) 86 9 rQKRrQRRr
TAT(s2-62) 87 9 rKQRrQRRr
TAT(s2-63) 88 9 rKKQrQRRr
TAT(s2-64) 89 9 rKKRrKRRr
TAT(s2-65) 90 9 rKKRrQQRr
TAT(s2-66) 91 9 rKKRrQRQr
TAT(s2-67) 92 9 rSKRrQRRr
TAT(s2-68) 93 9 rKSRrQRRr
TAT(s2-69) 94 9 rKKSrQRRr
TAT(s2-70) 95 9 rKKRrSRRr
TAT(s2-71) 96 9 rKKRrQSRr
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
TAT(s2-72) 97 9 rKKRrQRSr
TAT(s2-73) 98 9 rTKRrQRRr
TAT(s2-74) 99 9 rKTRrQRRr
TAT(s2-75) 100 9 rKKTrQRRr
TAT(s2-76) 101 9 rKKRrTRRr
TAT(s2-77) 102 9 rKKRrQTRr
TAT(s2-78) 103 9 rKKRrQRTr
TAT(s2-79) 104 9 rVKRrQRRr
TAT(s2-80) 105 9 rKVRrQRRr
TAT(s2-81) 106 9 rKKVrQRRr
TAT(s2-82) 107 9 rKKRrVRRr
TAT(s2-83) 108 9 rKKRrQVRr
TAT(s2-84) 109 9 rKKRrQRVr
TAT(s2-85) 110 9 rWKRrQRRr
TAT(s2-86) 111 9 rKWRrQRRr
TAT(s2-87) 12 9 rKKWrQRRr
TAT(s2-88) 13 9 rKKRrWRRr
TAT(s2-89) 14 9 rKKRrQWRr
TAT(s2-90) 15 9 rKKRrQRWr
TAT(s2-91) 16 9 rYKRrQRRr
TAT(s2-92) 17 9 rKYRrQRRr
TAT(s2-93) 18 9 rKKYrQRRr
TAT(s2-94) 19 9 rKKRrYRRr
TAT(s2-95) 120 9 rKKRrQYRr
TAT(s2-96) 121 9 rKKRrQRYr
r3R6 122 9 rRRRrRRRr
L-R9 123 9 RRRRRRRRR
L-R8 124 8 RRRRRRRR
L-R7 125 7 RRRRRRR
L-R6 126 6 RRRRRR
L-R5 127 5 RRRRR
PTD-4 128 11 YARAAARQARA
PTD-4 (вариант 1) 129 11 WARAAARQARA
PTD-4 (вариант 2) 130 11 WARAQRAAARA
L-P1 пенетратин 131 16 RQVKVWFQNRRMKWKK
D-P1 пенетратин 132 16 KKWKMRRNQFWVKVQR
JNKI, «наилучший подбор» 133 17 WKRAAARKARAMSLNLF
JNKI, «наилучший подбор» (вариант 1) 134 17 WKRAAARAARAMSLNLF
трансцитозная последовательность MDCK 135 9 RYRGDLGRR
YKGL 136 4 YKGL
r3 (генерик) 252 9 rXXXrXXXr

Конкретными примерами обеспечивающих перенос последовательностей, которые являются основой новой конструкции транспортера, соответствующих общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, могут являться последовательности, представленные в настоящем описании, например, в таблице 1, которые отличаются тем, что они имеют последовательность, обратную этой конкретной последовательности, т.е. у них порядок расположения аминокислот в последовательности от N- к С-концу является обратным.

Конкретными предпочтительными примерами обеспечивающих перенос последовательностей, которые являются основой новой конструкции транспортера, соответствующих общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, могут являться фрагменты или варианты указанных выше последовательностей (при условии, что они сохраняют способность осуществлять транслокацию через биологическую мембрану). В этом конкретном контексте варианты и/или фрагменты указанных обеспечивающих перенос последовательностей предпочтительно содержат или состоят из пептидной последовательности, длина которой составляет по меньшей мере 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% или 85%, предпочтительно по меньшей мере 90%, более предпочтительно по меньшей мере 95% и наиболее предпочтительно по меньшей мере 99% от всей длины нативной последовательности указанной обеспечивающей перенос последовательности. Кроме того, фрагмент указанной обеспечивающей перенос последовательности может содержать также эпитопы (которые обозначают также как «антигенные детерминанты») полноразмерной обеспечивающей перенос последовательности. Эпитопы в контексте настоящего изобретения, как правило, представляют собой фрагменты, локализованные на наружной поверхности (нативной) белковой или пептидной последовательности, указанной в настоящем изобретении, предпочтительно состоят из 5-15 аминокислот, более предпочтительно состоят из 5-12 аминокислот, еще более предпочтительно состоят из 6-9 аминокислот, которые могут распознаваться антителами, т.е. находятся в их исходной форме.

В этом конкретном контексте под «фрагментом» обеспечивающей перенос последовательности, указанной выше, в частности, представленной в таблице 1 или 3, предпочтительно подразумевается ее укороченная последовательность, т.е. аминокислотная последовательность, которая на N-конце, С-конце и/или внутри последовательности укорочена по сравнению с аминокислотной последовательностью нативной последовательности.

Под «вариантом» обеспечивающей перенос последовательности или ее фрагмента, как они определены выше и, в частности, представлены в таблице 1 или 3, предпочтительно подразумевается последовательность, при этом аминокислотная последовательность варианта отличается от нативной обеспечивающей перенос последовательности или ее фрагмента, указанных в настоящем описании, одной или несколькими мутацией(ями), такой(ими) как одна или несколько замен (или при необходимости инсерцией и/или делеций) аминокислот. Предпочтительно варианты обеспечивающей перенос последовательности, указанной выше в настоящем описании, обладают такой же биологической функцией или специфической активностью, что и полноразмерная нативная последовательность, т.е. способностью осуществлять транспорт в клетки и ядро. Более предпочтительно вариант обеспечивающей перенос последовательности, указанной выше в настоящем описании, может включать примерно 1-50, 1-20, еще более предпочтительно 1-10 и наиболее предпочтительно 1-5, 4, 3, 2 или 1 изменение аминокислот в пределах указанных выше значений. Варианты обеспечивающей перенос последовательности, указанной выше в настоящем описании, могут содержать консервативные аминокислотные замены. Консервативные аминокислотные замены могут включать замены аминокислотных остатков на синонимические аминокислотные остатки, которые обладают в достаточной степени сходными физико-химическими свойствами, что должно сохранять биологическую активность молекулы (см., например, Grantham R., Science 185, 1974, cc.862-864). Специалистам в данной области должно быть очевидно, что аминокислоты можно также встраивать и/или изымать путем делеций из указанных выше последовательностей без изменения их функции, в частности, если инсерции и/или делеций затрагивают лишь несколько аминокислот, например, менее 20 и предпочтительно менее 10, и что недопустимо удалять или заменять аминокислоты, которые имеют решающее значение для функциональной активности. Консервативные аминокислотные замены предпочтительно представляют собой замены, в которых аминокислоты, относящиеся к одному и тому же классу аминокислот (основные аминокислоты, кислые аминокислоты, полярные аминокислоты и т.д.), заменяют друг на друга. В частности, они представляют собой аминокислоты, которые имеют алифатические боковые цепи, положительно или отрицательно заряженные боковые цепи, ароматические группы в боковых цепях аминокислот, боковые цепи, которых могут обеспечивать образование водородных связей, например, боковые цепи с гидроксильной функцией. Это означает, что, например, аминокислоту с полярной боковой цепью заменяют на другую аминокислоту с подобной полярной боковой цепью или, например, аминокислоту, отличающуюся гидрофобной боковой цепью заменяют на другую аминокислоту с подобной гидрофобной боковой цепью (например, серии (треонин) на треонин (серии) или лейцин (изолейцин) на изолейцин (лейцин)). Предпочтительные синонимические аминокислотные остатки, которые представляют собой остатки, отнесенные к одной и той же группе, и которые, как правило, можно заменять друг на друга путем консервативных аминокислотных замен, приведены в таблице 2.

Таблица 2
Предпочтительные группы синонимических аминокислотных остатков
Аминокислота Синонимический остаток
Ser Ser, Thr, Gly, Asn
Arg Arg, Gln, Lys, Glu, His
Leu He, Phe, Tyr, Met, Val, Leu
Pro Gly, Ala, (Thr), Pro
Thr Pro, Ser, Ala, Gly, His, Gln, Thr
Ala Gly, Thr, Pro, Ala
Val Met, Tyr, Phe, He, Leu, Val
Gly Ala, (Thr), Pro, Ser, Gly
Ile Met, Tyr, Phe, Val, Leu, Ile
Phe Trp, Met, Tyr, Ile, Val, Leu, Phe
Tyr Trp, Met, Phe, Ile, Val, Leu, Tyr
Cys Ser, Thr, Cys
His Glu, Lys, Gln, Thr, Arg, His
Gln Glu, Lys, Asn, His, (Thr), Arg, Gln
Asn Gln, Asp, Ser, Asn
Lys Glu, Gln, His, Arg, Lys
Asp Glu, Asn, Asp
Glu Asp, Lys, Asn, Gln, His, Arg, Glu
Met Phe, He, Val, Leu, Met
Trp Trp

Длина обеспечивающих перенос последовательностей, применяемых в конструкции транспортера, указанной выше, т.е. количество смежных аминокислот, выбранных из любой из обеспечивающих перенос последовательностей, указанных выше, в конкретном варианте осуществления изобретения может определяться количеством аминокислот в общей формуле (I) или в любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше. Таким образом, длина (последовательности) предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), может отличаться от длины приведенных в качестве примеров обеспечивающих перенос последовательностей, представленных в настоящем описании, например, в таблице 1 или 3, или представленных в целом в настоящем описании. Другими словами, длина конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, может определять длину аминокислотной последовательности, которая может быть получена из обеспечивающей перенос последовательности, представленной в настоящем описании, при условии, что аминокислотную последовательность выводят из фрагмента смежных аминокислот указанной обеспечивающей перенос последовательности. Например, если длина конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, составляет 9 аминокислот, то последовательность, пригодную в качестве конструкции транспортера, получают из 9 смежных аминокислот обеспечивающей перенос последовательности, представленной выше в настоящем описании, причем, выбранную аминокислотную последовательность можно выводить из любого положения или участка указанной обеспечивающей перенос последовательности. Это же относится к любой другой длине, которая определяется общей формулой (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше. Подразумевается также, что согласно некоторым вариантам осуществления изобретения обеспечивающая перенос последовательность конструкции транспортера, предлагаемой в настоящем изобретении, состоит из менее чем 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 40, 30, 20 и/или менее чем 10 аминокислот.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемая в изобретении новая конструкция транспортера, соответствующая общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), содержит или состоит по меньшей мере из одного варианта и/или фрагмента указанных выше последовательностей. Предпочтительно эти варианты и/или фрагменты сохраняют биологическую активность предлагаемых в изобретении новых конструкций транспортеров, соответствующих общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше. Функциональную активность фрагментов или вариантов можно оценивать с помощью различных анализов, например, по эффективности трансфекции, правильной экспрессии белков, кодируемых карго-молекулами, представляющими собой нуклеиновые кислоты, или с помощью биофизических методов, например, с помощью спектроскопии, компьютерного моделирования, структурного анализа и т.д. В частности, предлагаемые в изобретении новые конструкции транспортеров, соответствующие общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, или их варианты и/или фрагменты можно исследовать с помощью анализа гидрофильности (см., например, Норр и Woods, Proc Natl Acad Sci USA 78, 1981, cc.3824-3828), который можно использовать для идентификации гидрофобных и гидрофильных областей пептидов, что позволяет создавать субстраты для экспериментальных исследований. Для идентификации областей предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, или их вариантов и/или фрагментов можно осуществлять также анализ вторичной структуры, с помощью которого определяют специфические структурные мотивы (см., например, Chou и Fasman, Biochem 13, 1974, cc.222-223). Для осуществления манипуляций, трансляции, предсказания вторичной структуры, определения профилей гидрофильности и гидрофобности, предсказания и создания открытых рамок считывания и определения гомологии последовательностей можно использовать компьютерные пакеты программ, существующие в данной области. Можно применять также другие методы структурного анализа, в том числе, например, рентгеновскую кристаллографию (см., например, Engstrom, Biochem Exp Biol 11, 1974, cc.7-13), масс-спектроскопию и газовую хроматографию (см., например, methods in protein science, изд-во J. Wiley and Sons, New York, NY, 1997). Можно применять также компьютерное моделирование (см., например, Computer Graphics and Molecular Modeling, в: Current Communications in Molecular Biology, под ред. Fletterick и Zoller, изд-во Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1986).

Аналогично этому, предлагаемая в изобретении новая конструкция транспортера, соответствующая общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, содержит или состоит по меньшей мере из одного варианта (и/или фрагмента) указанных выше конструкций транспортеров. В контексте настоящего изобретения варианты (и/или фрагменты) указанных новых конструкций транспортеров могут иметь последовательность, идентичную их нативной конструкции транспортера, соответствующие общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), по меньшей мере на 70%, 80% или 85%, предпочтительно по меньшей мере на 90%, более предпочтительно по меньшей мере на 95% и наиболее предпочтительно по меньшей мере на 99% по всей длине нативной конструкции транспортера, указанной выше.

Под «фрагментом» предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, предпочтительно подразумевается ее укороченная последовательность, т.е. аминокислотная последовательность новой конструкции транспорта, которая на N-конце, С-конце и/или внутри последовательности укорочена по сравнению с аминокислотной последовательностью нативной последовательности, например, нативной предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше.

«Вариант» предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, предпочтительно содержит или состоит из последовательности, где последовательность варианта конструкции транспортера отличается от нативной последовательности конструкции транспортера, указанной в настоящем описании, одной или несколькими мутацией(ями), такой(ими) как одна или несколько замен (или при необходимости инсерцией и/или делеций) аминокислот. Предпочтительно варианты указанных предлагаемых в изобретении конструкций транспортеров обладают в основном такой же биологической функцией или специфической активностью, что и полноразмерные нативные предлагаемые в изобретении конструкции транспортеров, описанные выше. Предпочтительно вариант предлагаемых в изобретении конструкций транспортеров может включать примерно 1-50, 1-20, предпочтительно 1-10 и наиболее предпочтительно 1-5, 4, 3, 2 или 1 изменение аминокислот в пределах указанных выше значений. Такие изменения могут содержать среди прочего указанные выше модификации аминокислот, указанную выше интродукцию меток в аминокислоты, замену аминокислоты на любую из (модифицированных или меченых) аминокислот, упомянутых в настоящем описании, делеций или инсерции аминокислот. Указанные в настоящем описании варианты предпочтительно содержат также консервативные аминокислотные замены, предпочтительно уже указанные выше.

Для определения процента идентичности двух аминокислотных последовательностей, прежде всего аминокислотной последовательности предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, или любой другой аминокислотной последовательности, представленной в настоящем описании, аминокислотные последовательности можно выравнивать с целью дальнейшего сравнения друг с другом. При этом, например, можно встраивать бреши в последовательность первой аминокислотной последовательности и можно сравнивать с компонентом в соответствующем положении второй аминокислотной последовательности. Если в этом положении в первой аминокислотной последовательности находится тот же компонент, что и в этом же положении во второй аминокислотной последовательности, то две последовательности являются идентичными в этом положении. Процент идентичности двух последовательностей является функцией количества идентичных положений, деленной на общее количество положений. Это же, естественно, применимо также к нуклеотидным последовательностям. В указанном выше контексте подразумевается, что аминокислотная последовательность, имеющая последовательность, «характеризующуюся идентичностью последовательности», составляющей например, по меньшей мере 95% с запрашиваемой аминокислотной последовательностью, предлагаемой в настоящем изобретении, означает, что последовательность рассматриваемой аминокислотной последовательности идентична запрашиваемой последовательности за исключением того, что рассматриваемая аминокислотная последовательность может включать вплоть до 5 аминокислотных изменений на каждые 100 аминокислот запрашиваемой аминокислотной последовательности. Другими словами, для получения аминокислотной последовательности, идентичной по меньшей мере на 95% запрашиваемой аминокислотной последовательности, вплоть до 5% (5 из 100) аминокислотных остатков в рассматриваемой последовательности могут быть встроены или заменены на другую аминокислоту или удалены в результате делеции, предпочтительно в рамках приведенных выше определений вариантов или фрагментов. Это же, естественно, применимо также к нуклеотидным последовательностям.

Для последовательностей (аминокислотных или нуклеотидных), не имеющих точного соответствия друг другу, можно определять «% идентичности» первой последовательности относительно второй последовательности. В целом, метод заключается в том, что эти две подлежащие сравнению последовательности выравнивают (подвергают сравнительному анализу), добиваясь максимальной корреляции между последовательностями. Эта процедура может включать встраивание «брешей» в одну или обе последовательности для повышения степени выравнивания (эффективности сравнительного анализа первичной структуры последовательностей). Затем % идентичности можно определять по всей длине каждой подлежащей сравнению последовательности (так называемый глобальный сравнительный анализ первичной структуры), что является более приемлемым для последовательностей, имеющих одинаковую или близкую длину, или для более коротких участков определенной длины (так называемый локальный сравнительный анализ первичной структуры), что является наиболее приемлемым для последовательностей, имеющих разную длину.

Методы сравнения идентичности и гомологии двух или большего количества последовательностей хорошо известны в данной области. Процент идентичности двух последовательностей можно определять, например, с помощью математического алгоритма. Предпочтительным примером математического алгоритма, который можно применять, является (но, не ограничиваясь только им) алгоритм, описанный у Karlin и др., PNAS USA, 90, 1993, cc.5873-5877. Указанный алгоритм входит в семейство программ BLAST, например, в программу BLAST или NBLAST (см. также у Altschul и др., J. Mol. Biol. 215, 1990, cc.403-410 или Altschul др., Nucleic Acids Res, 25, 1997, cc.3389-3402), которые доступны на домашней странице NCBI на сайте в сети Интернет ncbi.nlm.nih.gov) и FASTA (Pearson, Methods Enzymol. 183, 1990, cc.63-98; Pearson и Lipman, Proc. Natl. Acad. Sci. U.S.A. 85, 1988, cc.2444-2448.). С помощью этих программ можно идентифицировать последовательности, идентичные в определенной степени другим последовательностям. Кроме того, для определения % идентичности двух полинуклеотидов и % идентичности и % гомологии двух полипептидных последовательностей можно использовать пакет программ анализа последовательностей Wisconsin Sequence Analysis Package, версия 9.1 (Devereux и др., Nucleic Acids Res. 12, 1984, cc.387-395), например, программы BESTFIT и GAP. В программе BESTFIT использован алгоритм «локальной гомологии» (Smith и Waterman, J. Mol. Biol. 147, 1981, cc.195-197), и она позволяет находить одну характеризующуюся наиболее высоким уровнем сходства область в двух последовательностях.

Согласно наиболее предпочтительному варианту осуществления изобретения предлагаемая в изобретении новая конструкция транспортера, как она указана выше, содержит соединение подформулы (If) DLLLDLLLD (SEQ ID NO:7), как указано выше, при этом последовательность транспортера выбирают из любой из указанных (конкретных) последовательностей, еще более предпочтительно из следующих последовательностей:

Таблица 3
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
r3-L-TAT 20 9 rKKRrQRRr
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
r3-L-TATi 21 9 rRRQrRKKr
βA-r3-L-TAT 22 9 βA-rKKRrQRRr
βA-r3-L-TATi 23 9 βA-rRRQrRKKr
FITC-βA-r3-L-TAT 24 9 FITC-βA-rKKRrQRRr
FITC-AA-r3-L-TATi 25 9 FITC-βA-rRRQrRKKr
TAT(s2-1) 26 9 rAKRrQRRr
TAT(s2-2) 27 9 rKARrQRRr
TAT(s2-3) 28 9 rKKArQRRr
TAT(s2-4) 29 9 rKKRrARRr
TAT(s2-5) 30 9 rKKRrQARr
TAT(s2-6) 31 9 rKKRrQRAr
TAT(s2-7) 32 9 rDKRrQRRr
TAT(s2-8) 33 9 rKDRrQRRr
TAT(s2-9) 34 9 rKKDrQRRr
TAT(s2-10) 35 9 rKKRrDRRr
TAT(s2-11) 36 9 rKKRrQDRr
TAT(s2-12) 37 9 rKKRrQRDr
TAT(s2-13) 38 9 rEKRrQRRr
TAT(s2-14) 39 9 rKERrQRRr
TAT(s2-15) 40 9 rKKErQRRr
TAT(s2-16) 41 9 rKKRrERRr
TAT(s2-17) 42 9 rKKRrQERr
TAT(s2-18) 43 9 rKKRrQREr
TAT(s2-19) 44 9 rFKRrQRRr
TAT(s2-20) 45 9 rKFRrQRRr
TAT(s2-21) 46 9 rKKFrQRRr
TAT(s2-22) 47 9 rKKRrFRRr
TAT(s2-23) 48 9 rKKRrQFRr
TAT(s2-24) 49 9 rKKRrQRFr
TAT(s2-25) 50 9 rRKRrQRRr
TAT(s2-26) 51 9 rKRRrQRRr
TAT(s2-27) 52 9 rKKKrQRRr
TAT(s2-28) 53 9 rKKRrRRRr
TAT(s2-29) 54 9 rKKRrQKRr
TAT(s2-30) 55 9 rKKRrQRKr
TAT(s2-31) 56 9 rHKRrQRRr
TAT(s2-32) 57 9 rKHRrQRRr
TAT(s2-33) 58 9 rKKHrQRRr
TAT(s2-34) 59 9 rKKRrHRRr
TAT(s2-35) 60 9 rKKRrQHRr
TAT(s2-36) 61 9 rKKRrQRHr
TAT(s2-37) 62 9 rIKRrQRRr
TAT(s2-38) 63 9 rKIRrQRRr
TAT(s2-39) 64 9 rKKIrQRRr
TAT(s2-40) 65 9 rKKRrIRRr
TAT(s2-41) 66 9 rKKRrQIRr
TAT(s2-42) 67 9 rKKRrQRIr
TAT(s2-43) 68 9 rLKRrQRRr
TAT(s2-44) 69 9 rKLRrQRRr
TAT(s2-45) 70 9 rKKLrQRRr
TAT(s2-46) 71 9 rKKRrLRRr
TAT(s2-47) 72 9 rKKRrQLRr
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
TAT(s2-48) 73 9 rKKRrQRLr
TAT(s2-49) 74 9 rMKRrQRRr
TAT(s2-50) 75 9 rKMRrQRRr
TAT(s2-51) 76 9 rKKMrQRRr
TAT(s2-52) 77 9 rKKRrMRRr
TAT(s2-53) 78 9 rKKRrQMRr
TAT(s2-54) 79 9 rKKRrQRMr
TAT(s2-55) 80 9 rNKRrQRRr
TAT(s2-56) 81 9 rKNRrQRRr
TAT(s2-57) 82 9 rKKNrQRRr
TAT(s2-58) 83 9 rKKRrNRRr
TAT(s2-59) 84 9 rKKRrQNRr
TAT(s2-60) 85 9 rKKRrQRNr
TAT(s2-61) 86 9 rQKRrQRRr
TAT(s2-62) 87 9 rKQRrQRRr
TAT(s2-63) 88 9 rKKQrQRRr
TAT(s2-64) 89 9 rKKRrKRRr
TAT(s2-65) 90 9 rKKRrQQRr
TAT(s2-66) 91 9 rKKRrQRQr
TAT(s2-67) 92 9 rSKRrQRRr
TAT(s2-68) 93 9 rKSRrQRRr
TAT(s2-69) 94 9 rKKSrQRRr
TAT(s2-70) 95 9 rKKRrSRRr
TAT(s2-71) 96 9 rKKRrQSRr
TAT(s2-72) 97 9 rKKRrQRSr
TAT(s2-73) 98 9 rTKRrQRRr
TAT(s2-74) 99 9 rKTRrQRRr
TAT(s2-75) 100 9 rKKTrQRRr
TAT(s2-76) 101 9 rKKRrTRRr
TAT(s2-77) 102 9 rKKRrQTRr
TAT(s2-78) 103 9 rKKRrQRTr
TAT(s2-79) 104 9 rVKRrQRRr
TAT(s2-80) 105 9 rKVRrQRRr
TAT(s2-81) 106 9 rKKVrQRRr
TAT(s2-82) 107 9 rKKRrVRRr
TAT(s2-83) 108 9 rKKRrQVRr
TAT(s2-84) 109 9 rKKRrQRVr
TAT(s2-85) 110 9 rWKRrQRRr
TAT(s2-86) 111 9 rKWRrQRRr
TAT(s2-87) 112 9 rKKWrQRRr
TAT(s2-88) 113 9 rKKRrWRRr
TAT(s2-89) 114 9 rKKRrQWRr
TAT(s2-90) 115 9 rKKRrQRWr
TAT(s2-91) 116 9 rYKRrQRRr
TAT(s2-92) 117 9 rKYRrQRRr
TAT(s2-93) 118 9 rKKYrQRRr
TAT(s2-94) 119 9 rKKRrYRRr
TAT(s2-95) 120 9 rKKRrQYRr
TAT(s2-96) 121 9 rKKRrQRYr
r3R6 122 9 rRRRrRRRr
L-R9 123 9 RRRRRRRRR

В приведенной выше таблице подформула (If) DLLLDLLLD (SEQ ID NO:7) относится к указанным выше новым конкретным последовательностям, т.е. новой предлагаемой в изобретении конструкции транспортера, как она определена выше, содержащим 9 аминокислот, где D-энантиомерные аминокислоты обозначены прописными буквами и L-энантиомерные аминокислоты обозначены заглавными буквами.

В конкретном варианте осуществления изобретения конструкция транспортера содержит или состоит по меньшей мере из одной из последовательности, представленной в виде rXXXrXXXr (SEQ ID NO:252), в которой

r обозначает D-энантиомерный аргинин;

Х обозначает любую из L-аминокислот;

и в которой Х каждый может быть выбран индивидуально и независимо от любых других X, присутствующих в SEQ ID NO:252. Предпочтительно по меньшей мере 4 из 6 обозначенных Х L-аминокислот в SEQ ID NO:252 обозначают К или R. В другом варианте осуществления изобретения конструкция транспортера, предлагаемая в настоящем изобретении, содержит или состоит из последовательности rX1X2X3rX4X5X6r (SEQ ID NO:252), в которой X) обозначает K, X2 обозначает K, Х3 обозначает R и Х4, Х5 и Х6 обозначают любую L-аминокислоту, выбранную независимо друг от друга. Аналогично этому, конструкция транспортера, предлагаемая в настоящем изобретении, может содержать или состоять из последовательности rX1X2X3rX4X5X6r (SEQ ID NO:252), в которой Х4 обозначает Q, Х5 обозначает R, Х6 обозначает R и X1, Х2, и Х3 обозначают любую L-аминокислоту, выбранную независимо друг от друга. Предлагаемая в изобретении конструкция транспортера может содержать также или состоять из последовательности rX1X2X3rX4X5X6r (SEQ ID NO:252), в которой один, два, три, четыре, пять или шесть аминокислотных остатков Х выбирают из группы, в которой: X) обозначает K, Х2 обозначает K, Х3 обозначает R, Х4 обозначает Q, Х5 обозначает R, Х6 обозначает R, а остальные аминокислотные остатки X, которые не выбраны из указанной выше группы, могут представлять собой любую L-аминокислоту, и их выбирают независимо друг от друга. Кроме того, X1 предпочтительно обозначает Y и/или Х4 предпочтительно обозначает K или R. Аналогичные положения относятся к обратным последовательностям указанных выше последовательностей и вариантов SEQ ID NO:252.

При создании изобретения неожиданно было установлено, что наличие тирозина (Y) в положении 2 представленной выше формулы (I) не только значительно повышает поглощение, но также существенно увеличивает внутриклеточную концентрацию после инокуляции в течение 25 ч. Это обнаружено прежде всего для конструкций транспортеров, которые содержат обеспечивающую перенос последовательность, выведенную из белка ТАТ БИЧ-1, приведенную в таблице 1, в которой Y находится в положении 2, которая предпочтительно состоит из 9 ак и отличается присутствием консенсусной последовательности rXXXrXXXr (SEQ ID NO:252). Таким образом, согласно наиболее предпочтительному варианту осуществления настоящего изобретения предлагаемая в изобретении новая конструкция транспортера, указанная выше, содержит конструкцию транспортера общей формулы (I), указанной выше, или еще более предпочтительно подформулы (If), указанной выше, где последовательность транспортера используют в сочетании или применяют в виде обеспечивающей перенос последовательности, выведенной из белка ТАТ ВИЧ-1, который несет тирозин (Y) в положении 2 выведенной из ТАТ последовательности. Еще более предпочтительно последовательность транспортера используют в сочетании или применяют в виде обеспечивающей перенос последовательности, выведенной из белка ТАТ ВИЧ-1, который несет тирозин (Y) в положении 2 выведенной из ТАТ последовательности, где конструкция транспортера общей формулы (I), указанной выше, или подформулы (If), указанной выше, предпочтительно состоит из 9 ак и имеет консенсусную последовательность rXXXrXXXr (SEQ ID NO:252), в которой D-энантиомерные аминокислоты обозначены прописными буквами, a L-энантиомерные аминокислоты обозначены заглавными буквами). Наиболее предпочтительно последовательность транспортера используют в сочетании или применяют в виде обеспечивающей перенос последовательности, выведенной из белка ТАТ ВИЧ-1, где конструкция транспортера общей формулы (I), указанной выше, или подформулы (If), указанной выше, предпочтительно состоит из 9 ак и содержит консенсусную последовательность rXXXrXXXr (SEQ ID NO:252), и обеспечивающую перенос последовательность выбирают из последовательности TAT(s2-91) (SEQ ID NO:116).

Предлагаемые в изобретении новые конструкции транспортеров, соответствующие общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они описаны выше, могут содержать также по меньшей мере одну модификацию, предпочтительно на их концах, либо на С-, либо на N-конце, либо на обоих концах. С-конец предпочтительно можно модифицировать

с помощью амидной модификации, а N-конец можно модифицировать с

помощью любой приемлемой NH2-защитной группы, например, путем ацилирования, или любой другой модификации, уже описанной выше для L-аминокислот и D-аминокислот. Такие модификации включают также интродукцию указанных выше меток.

Предлагаемые в изобретении новые конструкции транспортеров, соответствующие общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они описаны выше, можно получать или создавать с помощью методов, хорошо известных в данной области, например, путем химического синтеза или методов генной инженерии.

Таким образом, согласно второму объекту настоящего изобретения задача решается с помощью предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго молекулы, содержащей в качестве компонента (А) предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они описаны выше, в качестве компонента (Б) эффекторную молекулу, например, выбранную из белков или пептидов, таких как терапевтически активные белки и пептиды, ингибиторов протеинкиназ, прежде всего ингибиторов протеинкиназы, такой как аминоконцевая киназа с-Jun, или факторы, антигенов, антител, проапоптозных факторов, протеаз, участвующих в патологических состояниях, предпочтительно ингибиторов пептидных протеаз, ВН3-доменов белков «ВН3-только», или выбранную из нуклеиновых кислот, siPHK, антисмысловых РНК или из цитотоксических агентов, малых органических молекул и т.д.

В контексте настоящего изобретения терапевтически активный белок или пептид, который можно применять в качестве эффекторной молекулы для компонента (Б) молекулы-конъюгата, являющейся транспортером карго-молекулы, предлагаемой в изобретении, можно выбирать из группы, включающей (но, не ограничиваясь только ими) белки, которые обладают способностью стимулировать или ингибировать трансдукцию сигнала в клетке, например, цитокины, антитела и др. Таким образом, терапевтически активные белки могут содержать цитокины класса I семейства цитокинов, которые имеют 4 позиционно консервативных остатка цистеина (СССС) и содержат консервативную последовательность-мотив Trp-Ser-X-Trp-Ser (WSXWS; SEQ ID NO:253), где X обозначает неконсервативную аминокислоту. К цитокинам класса I семейства цитокинов относится подсемейство GM-CSF, например, IL-3, IL-5, GM-CSF, подсемейство IL-6, например, IL-6, IL-11, IL-12, или подсемейство IL-2, например, IL-2, IL-4, IL-7, IL-9, IL-15 и др., или цитокины IL-1 альфа, IL-1бета, IL-10 и др. Терапевтически активные белки могут содержать также цитокины класса II семейства цитокинов, которые также имеют 4 позиционно консервативных остатка цистеина (СССС; SEQ ID NO:254), но не содержат консервативную последовательность-мотив Trp-Ser-X-Trp-Ser (WSXWS; SEQ ID NO:253). К цитокинам класса II семейства цитокинов относятся, например, IFN-альфа, IFN-бета, IFN-гамма и др. Терапевтически активные белки могут содержать также цитокины из семейства факторов некроза опухолей, например, TNF-альфа, TNF-бета и др., или цитокины из семейства хемокинов, которые содержат 7 трансмембранных спиралей (доменов) и взаимодействуют с G-белком, например, IL-8, MIP-1, RANTES, CCR5, CXR4 и др., или специфические для цитокинов рецепторы, такие как TNF-RI, TNF-RII, CD40, OX40 (CD134), Fas, или их фрагменты или варианты. Предпочтительно указанные фрагменты, а также варианты характеризуются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одной из белковых или пептидных последовательностей, представленной выше. В этом контексте фрагменты и варианты предпочтительно представляют собой описанные выше для компонента (А) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы.

Терапевтически активные белки, которые можно применять в качестве эффекторной молекулы, которая представляет собой компонент (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, можно выбирать также из любых из следующих белков: 0ATL3, 0FC3, 0РА3, 0PD2, 4-1BBL, 5Т4, 6Ckine, 707-AP, 9D7, А2М, АА, AAAS, ААСТ, AASS, АВАТ, АВСА1, АВСА4, АВСВ1, АВСВ11, АВСВ2, АВСВ4, АВСВ7, АВСС2, АВСС6, АВСС8, ABCD1, ABCD3, ABCG5, ABCG8, ABL1, АВО, ABR ACAA1, АСАСА, ACADL, ACADM, ACADS, ACADVL, ACAT1, ACCPN, АСЕ, ACHE, АСНМ3, АСНМ1, ACLS, ACPI, ACTA1, АСТС, ACTN4, ACVRL1, AD2, ADA, ADAMTS13, ADAMTS2, ADFN, ADH1B, ADH1C, ADLDH3A2, ADRB2, ADRB3, ADSL, AEZ, AFA, AFD1, AFP, AGA, AGL, AGMX2, AGPS, AGS1, AGT, AGTR1, AGXT, AH02, AHCY, AHDS, AHHR, AHSG, AIC, AIED, AIH2, AIH3, AIM-2, AIPL1, AIRE, AK1, ALAD, ALAS2, ALB, HPG1, ALDH2, ALDH3A2, ALDH4A1, ALDH5A1, ALDH1A1, ALDOA, ALDOB, ALMS1, ALPL, ALPP, ALS2, ALX4, AMACR, AMBP, AMCD, AMCD1, AMCN, AMELX, AMELY, AMGL, АМН, AMHR2, AMPD3, AMPD1, AMT, ANC, ANCR, ANK1, ANOP1, AOM, APOA4, APOC2, АРОС3, АР3В1, АРС, аРКС, АРОА2, APOA1, АРОВ, АРОС3, APOC2, APOE, APOH, APP, APRT, APS1, AQP2, AR, ARAF1, ARG1, ARHGEF12, ARMET, ARSA, ARSB, ARSC2, ARSE, ART-4, ARTC1/m, ARTS, ARVD1, ARX, AS, ASAH, ASAT, ASD1, ASL, ASMD, ASMT, ASNS, ASPA, ASS, ASSP2, ASSP5, ASSP6, AT3, ATD, ATHS, ATM, ATP2A1, ATP2A2, ATP2C1, ATP6B1, ATP7A, ATP7B, ATP8B1, ATPSK2, ATRX, ATXN1, ATXN2, ATXN3, AUTS1, AVMD, AVP, AVPR2, AVSD1, AXIN1, AXIN2, AZF2, B2M, B4GALT7, B7H4, BAGE, BAGE-1, BAX, BBS2, BBS3, BBS4, BCA225, BCAA, BCH, BCHE, BCKDHA, BCKDHB, BCL10, BCL2, BCL3, BCL5, BCL6, BCPM, BCR. BCR/ABL, BDC, BDE, BDMF, BDMR, BEST1, бета-катенин/m, BF, BFHD, BFIC, BFLS, BFSP2, BGLAP, BGN, BHD, BHR1, BING-4, BIRC5, BJS, BLM, BLMH, BLNK, BMPR2, BPGM, BRAF, BRCA1, BRCA1/m, BRCA2, BRCA2/m, BRCD2, BRCD1, BRDT, BSCL, BSCL2, BTAA, BTD, ВТК, BUB1, BWS, BZX, COL2A1, COL6A1, C1NH, C1QA, C1QB, C1QG, CIS, C2, СЗ, С4А, C4B, C5, C6, C7, C7orf2, C8A, C8B, C9, CA125, CA15-3/CA 27-29, CA195, CA19-9, CA72-4, CA2, CA242, CA50, CABYR, CACD, CACNA2D1, CACNA1A, CACNA1F, CACNA1S, CACNB2, CACNB4, CAGE, CA1, CALB3, CALCA, CALCR, CALM, CALR, CAM43, CAMEL, CAP-1, CAPN3, CARD15, CASP-5/m, CASP-8, CASP-8/m, CASR, CAT, CATM, CAV3, CB1, CBBM, CBS, CCA1, CCAL2, CCAL1, CCAT, CCL-1, CCL-11, CCL-12, CCL-13, CCL-14, CCL-15, CCL-16, CCL-17, CCL-18, CCL-19, CCL-2, CCL-20, CCL-21, CCL-22, CCL-23, CCL-24, CCL-25, CCL-27, CCL-3, CCL-4, CCL-5, CCL-7, CCL-8, CCM1, CCNB1, CCND1, CCO, CCR2, CCR5, CCT, CCV, CCZS, CD1, CD19, CD20, CD22, CD25, CD27, CD27L, cD3, CD30, CD30, CD30L, CD33, CD36, CD3E, CD3G, CD3Z, CD4, CD40, CD40L, CD44, CD44v, CD44v6, CD52, CD55, CD56, CD59, CD80, CD86, CDAN1, CDAN2, CDAN3, CDC27, CDC27/m, CDC2L1, CDH1, CDK4, CDK4/m, CDKN1C, CDKN2A, CDKN2A/m, CDKN1A, CDKN1C, CDL1, CDPD1, CDR1, CEA, CEACAM1, CEACAM5, CECR, CECR9, CEPA, CETP, CFNS, CFTR, CGF1, CHAC, CHED2, CHED1, CHEK2, CHM, CHML, CHR39C, CHRNA4, CHRNA1, CHRNB1, CHRNE, CHS, CHS1, CHST6, CHX10, CIAS1, CIDX, CKN1, CLA2, CLA3, CLA1, CLCA2, CLCN1, CLCN5, CLCNKB, CLDN16, CLP, CLN2, CLN3, CLN4, CLN5, CLN6, CLN8, C1QA, C1QB, C1QG, C1R, CLS, CMCWTD, CMDJ, CMD1A, CMD1B, CMH2, MH3, CMH6, CMKBR2, CMKBR5, CML28, CML66, CMM, CMT2B, CMT2D, CMT4A, CMT1A, CMTX2, CMTX3, C-MYC, CNA1, CND, CNGA3, CNGA1, CNGB3, CNSN, CNTF, COA-1/m, COCH, COD2, COD1, COH1, COL10A, COL2A2, COL11A2, COL17A1, COL1A1, COL1A2, COL2A1, COL3A1, COL4A3, COL4A4, COL4A5, COL4A6, COL5A1, COL5A2, COL6A1, COL6A2, COL6A3, COL7A1, COL8A2, COL9A2, COL9A3, COL11A1, COL1A2, COL23A1, COL1A1, COLQ, COMP, COMT, CORDS, CORD1, COX10, COX-2, CP, CPB2, CPO, CPP, CPS1, CPT2, CPT1A, CPX, CRAT, CRB1, CRBM, CREBBP, CRH, CRHBP, CRS, CRV, CRX, CRYAB, CRYBA1, CRYBB2, CRYGA, CRYGC, CRYGD, CSA, CSE, CSF1R, CSF2RA, CSF2RB, CSF3R, CSF1R, CST3, CSTB, CT, CT7, CT-9/BRD6, CTAA1, CTACK, CTEN, CTH, CTHM, CTLA4, CTM, CTNNB1, CTNS, CTPA, CTSB, CTSC, CTSK, CTSL, CTS1, CUBN, CVD1, CX3CL1, CXCL1, CXCL10, CXCL11, CXCL12, CXCL13, CXCL16, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CYB5, CYBA, CYBB, CYBB5, CYFRA21-1, CYLD, CYLD1, CYMD, CYP11B1, CYP11B2, CYP17, CYP17A1, CYP19, CYP19A1, CYP1A2, CYP1B1, CYP21A2, CYP27A1, CYP27B1, CYP2A6, CYP2C, CYP2C19, CYP2C9, CYP2D, CYP2D6, CYP2D7P1, CYP3A4, CYP7B1, CYPB1, CYP11B1, CYP1A1, CYP1B1, CYRAA, D40, DAD1, DAM, DAM-10/MAGE-B1, DAM-6/MAGE-B2, DAX1, DAZ, DBA, DBH, DBI, DBT, DCC, DC-CK1, DCK, DCR, DCX, DDB 1, DDB2, DDIT3, DDU, DECR1, DEK-CAN, DEM, DES, DF, DFN2, DFN4, DFN6, DFNA4, DFNA5, DFNB5, DGCR, DHCR7, DHFR, DHOF, DHS, DIA1, DIAPH2, DIAPH1, DIH1, DIO1, DISCI, DKC1, DLAT, DLD, DLLS, DLX3, DMBT1, DMD, DM1, DMPK, DMWD, DNAI1, DNASE1, DNMT3B, DPEP1, DPYD, DPYS, DRD2, DRD4, DRPLA, DSCR1, DSG1, DSP,. DSPP, DSS, DTDP2, DTR, DURS1, DWS, DYS, DYSF, DYT2, DYT3, DYT4, DYT2, DYT1, DYX1, EBAF, EBM, EBNA, EBP, EBR3, EBS1, ECA1, ECB2, ECE1, ECGF1, ECT, ED2, ED4, EDA, EDAR, ECA1, EDN3, EDNRB, EEC1, EEF1A1L14, EEGV1, EFEMP1, EFTUD2/m, EGFR, EGFR/Her1, EGI, EGR2, EIF2AK3, eIF4G, EKV, El IS, ELA2, ELF2, ELF2M, ELK1, ELN, ELONG, EMD, EML1, EMMPRIN, EMX2, ENA-78, ENAM, ENDS, ENG, EN01, ENPP1, ENUR2, ENUR1, EOS, EP300, EPB41, EPB42, EPCAM, EPD, EphA1, EphA2, EphA3, эфринA2, эфринA3, EPHX1, EPM2A, EPO.EPOR, EPX, ERBB2, ERCC2 ERCC3, ERCC4, ERCC5, ERCC6, ERVR, ESR1, ETFA, ETFB, ETFDH, ETM1, ETV6-AML1, ETV1, EVC, EVR2, EVR1, EWSR1, EXT2, EXT3, EXT1, EYA1, EYCL2, EYCL3, EYCL1, EZH2, F10, F11, F12, F13A1, F13B, F2, F5, F5F8D, F7, F8, F8C. F9, FABP2, FACL6, FAH, FANCA, FANCB, FANCC, FANCD2, FANCF, FasL, FBN2, FBN1, FBP1, FCG3RA, FCGR2A, FCGR2B, FCGR3A, FCHL, FCMD, FCP1, FDPSL5, FECH, FEO, FEOM1, FES, FGA. FGB, FGD1, FGF2, FGF23, FGF5, FGFR2, FGFR3, FGFR1, FGG, FGS1, FH, FIC1, FIH, F2, FKBP6, FLNA, FLT4, FMO3, FMO4, FMR2, FMR1, FN, FN1/m, FOXC1, FOXE1, FOXL2, FOXO1A, FPDMM, FPF, Fra-1, FRAXF, FRDA, FSHB, FSHMD1A, FSHR, FTH1, FTHL17, FTL, FTZF1, FUCA1, FUT2, FUT6, FUT1, FY, G250, G250/CAIX, G6PC, G6PD, G6PT1, G6PT2, GAA, GABRA3, GAGE-1, GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7b, GAGE-8, GALC, GALE, GALK1, GALNS, GALT, GAMT, GAN, GAST, GASTRIN17, GATA3, GATA, GBA, GBE, GC, GCDH, GCGR, GCH1, GCK, GCP-2, GCS1, G-CSF, GCSH, GCSL, GCY, GDEP,GDF5, GDI1, GDNF, GDXY, GFAP, GFND, GGCX, GGT1, GH2, GH1, GHR, GHRHR, GHS, GIF, GINGF, GIP, GJA3, GJA8, GJB2, GJB3, GJB6, GJB1, GK, GLA, GLB, GLB1, GLC3B, GLC1B, GLC1C, GLDC, GLI3, GLP1, GLRA1, GLUD1, GM1 (fuc-GMl), GM2A, GM-CSF, GMPR, GNAI2, GNAS, GNAT1, GNB3, GNE, GNPTA, GNRH, GNRH1, GNRHR, GNS, GnT-V, gp100, GP1BA, GP1BB, GP9, GPC3, GPD2, GPDS1, GPI, GP1BA, GPN1LW, GPNMB/m, GPSC, GPX1, GRHPR, GRK1, GROα, GROβ, GROγ, GRPR, GSE, GSM1, GSN, GSR, GSS, GTD, GTS, GUCA1A, GUCY2D, GULOP, GUSB, GUSM, GUST, GYPA, GYPC, GYS1, GYS2, HOKPP2, HOMG2, HADHA, HADHB, HAGE, HAGH, HAL, HAST-2, HB 1, HBA2, HBA1, HBB, HBBP1, HBD, HBE1, HBG2, HBG1, HBHR, HBP1, HBQ1, HBZ, HBZP, HCA, HCC-1, HCC-4, HCF2, HCG, HCL2, HCL1, HCR, HCVS, HD, HPN, HER2, HER2/NEU, HERS, HERV-K-MEL, HESX1, HEXA, HEXB, HF1, HFE, HF1, HGD, HHC2, HHC3, HHG, HK1 HLA-A, HLA-A*0201-R170I, HLA-A11/m, HLA-A2/m, HLA-DPB1 HLA-DRA, HLCS, HLXB9, HMBS, HMGA2, HMGCL, HMI, HMN2, HMOX1, HMS1 HMW-MAA, HND, HNE, HNF4A, HOAC, HOMEOBOX NKX 3.1, HOM-TES-14/SCP-1, HOM-TES-85, HOXA1 HOXD13, HP, HPC1, HPD, HPE2, HPE1, HPFH, HPFH2, HPRT1, HPS1, HPT, HPV-E6, HPV-E7, HR, HRAS, HRD, HRG, HRPT2, HRPT1, HRX, HSD11B2, HSD17B3, HSD17B4, HSD3B2, HSD3B3, HSN1, HSP70-2M, HSPG2, HST-2, HTC2, HTC1, hTERT, HTN3, HTR2C, HVBS6, HVBS1, HVEC, HV1S, HYAL1, HYR, 1-309, IAB, IBGC1, IBM2, ICAM1, ICAM3, iCE, ICHQ, ICR5, ICR1, ICS 1, IDDM2, IDDM1, IDS, IDUA, IF, DIFNa/b, DIFNGR1, IGAD1, IGER, IGF-1R, IGF2R, IGF1, IGH, IGHC, IGHG2, IGHG1, IGHM, IGHR, IGKC, IHG1, IHH, IKBKG, IL1, IL-1 RA, IL10, IL-11, IL12, IL12RB1, IL13, IL-13Rα, IL-15, IL-16, IL-17, IL18, IL-1a, IL-1α, IL-lb, IL-1β, IL1RAPL1, IL2, IL24, IL-2R, IL2RA, IL2RG, IL3, IL3RA, IL4, IL4RJL4R, IL-5, IL6, IL-7, IL7R, IL-8, IL-9, незрелый рецептор ламинина, IMMP2L, INDX, INFGR1, INFGR2, INFα, IFNINFγ, INS, INSR, INVS, IP-10, IP2, IPF1, IP1, IRF6, IRS1, ISCW, ITGA2, ITGA2B, ITGA6, ITGA7, ITGB2, ITGB3, ITGB4, ITIH1, ITM2B, IV, IVD, JAG1, JAK3, JBS, JBTS1, JMS, JPD, KALI, KAL2, KALI, KLK2, KLK4, KCNA1, KCNE2, KCNE1, KCNH2, KCNJ1, KCNJ2, KCNJ1, KCNQ2, KCNQ3, KCNQ4, KCNQ1, KCS, KERA, KFM, KFS, KFSD, KHK, ki-67, KIAA0020, KIAA0205, KIAA0205/m, KIF1B, KIT, KK-LC-1, KLK3, KLKBI, KM-HN-1, KMS, KNG, KNO, K-RAS/m, KRAS2, KREV1, KRT1, KRT10, KRT12, KRT13, KRT14, KRT14L1, KRT14L2, KRT14L3, KRT16, KRT16L1, KRT16L2, KRT17, KRT18, KRT2A, KRT3, KRT4, KRT5, KRT6 A, KRT6B, KRT9, KRTHB1, KRTHB6, KRT1, KSA, KSS, KWE, KYNU, LOH19CR1, L1CAM, LAGE, LAGE-1, LALL, LAMA2, LAMA3, LAMB3, LAMB1, LAMC2, LAMP2, LAP, LCA5, LCAT, LCCS, LCCS 1, LCFS2, LCS1, LCT, LDHA, LDHB, LDHC, LDLR, LDLR/FUT, LEP, LEWISY, LGCR, LGGF-PBP, LGI1, LGMD2H, LGMD1A, LGMD1B, LHB, LHCGR, LHON, LHRH, LHX3, LIF, LIG1, LIMM, LIMP2, LIPA, LIPA, LIPB, LIPC, LIVIN, L1CAM, LMAN1, LMNA, LMX1B, LOLR, LOR, LOX, LPA, LPL, LPP, LQT4, LRP5, LRS 1, LSFC, LT-β, LTBP2, LTC4S, LYL1, XCL1, LYZ, M344, MA50, MAA, MADH4, MAFD2, MAFD1, MAGE, MAGE-A1, MAGE-A10, MAGE-A12, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A9, MAGEB1, MAGE-B10, MAGE-B16, MAGE-B17, MAGE-B2, MAGE-B3, MAGE-B4, MAGE-B5, MAGE-B6, MAGE-C1, MAGE-C2, MAGE-C3, MAGE-D1, MAGE-D2, MAGE-D4, MAGE-E1, MAGE-E2, MAGE-F1, MAGE-H1, MAGEL2, MGB1, MGB2, MAN2A1, MAN2B1, MANBA, MANBB, MAOA, MAOB, MAPK8IP1, MAPT, MART-1, MART-2, MART2/m, MAT1A, MBL2, MBP, MBS1, MC1R, MC2R, MC4R, MCC, MCCC2, MCCC1, MCDR1, MCF2, MCKD, MCL1, MC1R, MCOLN1, MCOP, MCOR, MCP-1, MCP-2, MCP-3, MCP-4, MCPH2, MCPH1, MCS, M-CSF, MDB, MDCR, MDM2, MDRV, MDS 1, ME1, ME1/m, ME2, ME20, ME3, MEAX, MEB, MEC CCL-28, MECP2, MEFV, MELANA, MELAS, MEN1 MSLN, MET, MF4, MG50, MG50/PXDN, MGAT2, MGAT5, MGC1 MGCR, MGCT, MGI, MGP, MHC2TA, MHS2, MHS4, MIC2, MIC5, MIDI, MIF, MIP, MIP-5/HCC-2, MITF, MJD, MKI67, MKKS, MKS1, MLH1, MLL, MLLT2, MLLT3, MLLT7, MLLT1, MLS, MLYCD, MMA1a, MMP 11, MMVP1, MN/CA IX-антиген, MNG1, MN1, MOC31, MOCS2, MOCS1, MOG, MORC, MOS, MOV18, MPD1, MPE, MPFD, MPI, MPIF-1, MPL, MPO, MPS3C, MPZ, MRE11A, MROS, MRP1, MRP2, MRP3, MRSD, MRX14, MRX2, MRX20, MRX3, MRX40, MRXA, MRX1, MS, MS4A2, MSD, MSH2, MSH3, MSH6, MSS, MSSE, MSX2, MSX1, MTATP6, MTC03, MTCO1, MTCYB, MTHFR, MTM1. MTMR2, MTND2, MTND4, MTND5, MTND6, MTND1, MTP, MTR, MTRNR2, MTRNR1, MTRR,MTTE, MTTG, MTTI, MTTK, MTTL2, MTTL1, MTTN, MTTP, MTTS1, MUC1,MUC2, MUC4, MUC5AC, MUM-1, MUM-1/m, MUM-2, MUM-2/m, MUM-3, MUM-3/m, MUT, мутант p21 ras, MUTYH, MVK, MX2, MXI1, MY05A, MYB, MYBPC3, MYC, MYCL2, MYH6, MYH7, MYL2, MYL3, MYMY, MY015A, MY01G, MY05A, MY07A, MYOC, MH03HH/m, MYP2, MYP1, NA88-A, N-ацетилглюкозаминилтрансфераза-V, NAGA, NAGLU, NAMSD, NAPB, NAT2, NAT, NBIA1, NBS1, NCAM, NCF2, NCF1, NDN, NDP, NDUFS4, NDUFS7, NDUFS8, NDUFV1, NDUFV2, NEB, NEFH, NEM1, Neo-PAP, neo-PAP/m, NEU1, NEUROD1, NF2, NF1, NFYC/m, NGEP, NHS, NKS1, NKX2E, NM, NME1, NMP22, NMTC, NODAL, NOG, NOS3, NOTCH3, NOTCH1, NP, NPC2, NPC1, NPHL2, NPHP1, NPHS2, NPHS1, NPM/ALK, NPPA, NQ01, NR2E3, NR3C1, NR3C2, NRAS, NRAS/m, NRL, NROB1, NRTN, NSE, NSX, NTRK1, NUMA1, NXF2, NY-CO1, NY-ES01, NY-ESO-B, NY-LU-12, ALDOA, NYS2, NYS4, NY-SAR-35, NYS1, NYX, OA3, OA1, OAP, OASD, OAT, OCA1, OCA2, OCD1, OCRL, OCRL1, OCT, ODDD, ODT1, OFC1, OFD1, OGDH, OGT, OGT/m, OPA2, OPA1, OPD1, OPEM, OPG, OPN, OPN1LW, OPN1MW, OPN1SW, OPPG, OPTB1, TTD, ORM1, ORP1, OS-9, OS-9/m, OSM LIF, OTC, OTOF, OTSC1, OXCT1, OYTES1, P15, P190 MINOR BCR-ABL, P2RY12, P3, P16, P40, P4HB, P-501, P53, P53/m, P97, PABPN1, PAFAH1B1, PAFAH1P1, PAGE-4, PAGE-5, PAH, PAI-1, PAI-2, PAK3, PAP, PAPPA, PARK2, PART-1, PATE, PAX2, PAX3, PAX6, PAX7, PAX8, PAX9, PBCA, PBCRA1, PBT, PBX1, PBXP1, PC, PCBD, PCCA, PCCB, PCK2, PCK1, PCLD, PCOS1, PCSK1, PDB1, PDCN, PDE6A, PDE6B, PDEF, PDGFB, PDGFR, PDGFRL, PDHA1, PDR, PDX1, PECAM1, PEE1, PEO1, PEPD, PEX10, PEX12, PEX13, PEX3, PEX5, PEX6, PEX7, PEX1, PF4, PFBI, PFC, PFKFB1, PFKM, PGAM2, PGD, PGK1, PGK1P1, PGL2, PGR, PGS, PHA2A, PHB, PHEX, PHGDH, PHKA2, PHKA1, PHKB, PHKG2, PHP, PHYH, PI, PI3, PIGA, PIM1-KINASE, PIN1, PIP5K1B, PITX2, PITX3, PKD2, PKD3, PKD1, PKDTS, PKHD1, PKLR, PKP1, PKU1, PLA2G2A, PLA2G7, PLAT, PLEC1, PLG, PLI, PLOD, PLP1, PMEL17, PML, PML/RARa, PMM2, PMP22, PMS2, PMS1, PNKD, PNLIP, POF1, POLA, POLH, POMC, PON2, PON1, PORC, POTE, POU1F1, POU3F4, POU4F3, POU1F1, PPAC, PPARG, PPCD, PPGB, PPH1, PPKB, PPMX, PPOX, PPP1R3A, PPP2R2B, PPT1, PRAME, PRB, PRB3, PRCA1, PRCC, PRD, PRDX5/m, PRF1, PRG4, PRKAR1A, PRKCA, PRKDC, PRKWNK4, PRNP, PROC, PRODH, PROM1, PROP1, PROS1, PRST, PRP8, PRPF31, PRPF8, PRPH2, PRPS2, PRPS1, PRS, PRSS7, PRSS1, PRTN3, PRX, PSA, PSAP, PSCA, PSEN2, PSEN1, PSG1, PSGR, PSM, PSMA, PSORS1, PTC, PTCH, PTCH1, PTCH2, PTEN, PTGS1, PTH, PTHR1, PTLAH, PTOS1, PTPN12, PTPNI 1, PTPRK, PTPRK/m, PTS, PUJO, PVR, PVRL1, PWCR, PXE, PXMP3, PXR1, PYGL, PYGM, QDPR, RAB27A, RAD54B, RAD54L, RAG2, RAGE, RAGE-1, RAG1, RAP1, RARA, RASA1, RBAF600/m, RB1, RBP4, RBP4, RBS, RCA1, RCAS1, RCCP2, RCD1, RCV1, RDH5, RDPA, RDS, RECQL2, RECQL3, RECQL4, REG1A, REHOBE, REN, RENBP, RENS1, RET, RFX5, RFXANK, RFXAP, RGR, RHAG, RHAMM/CD168, RHD, RHO, Rip-1, RLBP1, RLN2, RLN1, RLS, RMD1, RMRP, ROM1, ROR2, RP, RP1, RP14, RP17, RP2, RP6, RP9, RPD1, RPE65. RPGR, RPGRIP1, RP1, RP10, RPS19, RPS2, RPS4X, RPS4Y, RPS6KA3, RRAS2, RS1, RSN, RSS, RU1, RU2, RUNX2,RUNX1, RWS, RYR1, S-100, SAA1, SACS, SAG, SAGE, SALL1, SARDH, SART1, SART2, SART3, SAS, SAX1, SCA2, SCA4, SCA5, SCA7, SCA8, SCA1, SCC, SCCD, SCF, SCLC1, SCN1A, SCN1B, SCN4A, SCN5A, SCNN1A, SCNN1B, SCNN1G, SCO2, SCP1, SCZD2, SCZD3, SCZD4, SCZD6, SCZD1, SDF-1α/SDHA, SDHD, SDYS, SEDL, SERPENA7, SERPINA3, SERPINA6, SERPINA1, SERPINC1, SERPIND1, SERPINE1, SERPINF2, SERPING1, SERPINI1, SFTPA1, SFTPB, SFTPC, SFTPD, SGCA, SGCB, SGCD, SGCE, SGM1, SGSH, SGY-1, SH2D1A, SHBG, SHFM2, SHFM3, SHFM1, SHH, SHOX, SI, SIAL, SIALYL LEWISX, SIASD, S11, SIM1, SIRT2/m, SIX3, SJS1, SKP2, SLC10A2, SLC12A1, SLC12A3, SLC17A5, SLC19A2, SLC22A1L, SLC22A5, SLC25A13, SLC25A15, SLC25A20, SLC25A4, SLC25A5, SLC25A6, SLC26A2, SLC26A3, SLC26A4, SLC2A1, SLC2A2, SLC2A4, SLC3A1, SLC4A1, SLC4A4,SLC5A1, SLC5A5, SLC6A2, SLC6A3,SLC6A4,SLC7A7, SLC7A9, SLC11A1, SLOS, SMA, SMAD1, SMAL, SMARCB1, SMAX2, SMCR, SMCY, SM1, SMN2, SMN1, SMPD1, SNCA, SNRPN, SOD2, SOD3, SOD1, SOS1, SOST, SOX9, SOX10, Sp17, SPANXC, SPG23, SPG3A, SPG4, SPG5A, SPG5B, SPG6, SPG7, SPINK1, SPINK5, SPPK, SPPM, SPSMA, SPTA1, SPTB, SPTLC1, SRC, SRD5A2, SRPX, SRS, SRY, βhCG, SSTR2, SSX1, SSX2 (HOM-MEL-40/SSX2), SSX4, ST8, STAMP-1, STAR, STARP1, STATH, STEAP, STK2, STK11, STn/KLH, STO, STOM, STS, SUOX, SURF1, SURVIVIN-2B, SYCP1, SYM1, SYN1, SYNS1, SYP, SYT/SSX, SYT-SSX-1, SYT-SSX-2, TA-90, TAAL6, TACSTD1, TACSTD2, TAG72, TAF7L, TAF1, TAGE, TAG-72, TALI, TAM, TAP2, TAP1, TAPVR1, TARC, TARP, TAT, TAZ, TBP, TBX22, TBX3, TBX5, TBXA2R, TBXAS1, TCAP, TCF2, TCF1, TCIRG1, TCL2, TCL4, TCL1A, TCN2, TCOF1, TCR, TCRA, TDD, TDFA, TDRD1, TECK, TECTA, TEK, TEL/AML1, TELAB1, TEX15, TF, TFAP2B, TFE3, TFR2, TG, TGFA, TGF-β, TGFBI, TGFB1, TGFBR2, TGFBRE, TGFβ, TGFβRII, TGIF, TGM-4, TGM1, TH, THAS, THBD, THC, THC2, THM, THPO, THRA, THRB, TIMM8A, TIMP2, TIMP3, TIMP1, TITF1, TKCR, TKT, TLP, TLR1, TLR10, TLR2, TLR3, TLR4, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLX1, TM4SF1, TM4SF2, TMC1, TMD, TMIP, TNDM, TNF, TNFRSF11A, TNFRSF1A, TNFRSF6, TNFSF5, TNFSF6, TNFα, TNFβ, TNNI3, TNNT2, TOC, TOP2A, TOP1, TP53, TP63, TPA, TPBG, TPI, TPI/m, ТРИ, ТРМЗ, TPM1, TPMT, TPO, TPS, TPTA, TRA, TRAG3, TRAPPC2, TRC8, TREH, TRG, TRH, TRIM32, TRIM37, TRP1, TRP2, TRP-2/6b, TRP-2/INT2, Trp-p8, TRPS1, TS, TSC2, TSC3, TSC1, TSG101, TSHB, TSHR, TSP-180, TST, TTGA2B, TTN, TTPA, TTR, TU M2-PK, TULP1, TWIST, TYH, TYR, TYROBP, TYROBP, TYRP1, TYS, UBE2A, UBE3A, UBE1, UCHL1, UFS, UGT1A, ULR, UMPK, UMPS, UOX, UPA, UQCRC1, URO5, UROD, UPK1B, UROS, USH2A, USH3A, USH1A, USH1C, USP9Y, UV24, VBCH, VCF, VDI, VDR, VEGF, VEGFR-2, VEGFR-1, VEGFR-2/FLK-1, VHL, VIM, VMD2, VMD1, VMGLOM, VNEZ, VNF, VP, VRNI, VWF, VWS, WAS, WBS2, WFS2, WFS1, WHCR, WHN, WISP3, WMS, WRN, WS2A, WS2B, WSN, WSS, WT2, WT3, WT1, WTS, WWS, XAGE, XDH, XIC, XIST, XK, XM, XPA, XPC, XRCC9, XS, ZAP70, ZFHX1B, ZFX, ZFY, ZIC2, ZIC3, ZNF145, ZNF261, ZNF35, ZNF41, ZNF6, ZNF198, ZWS1, или их фрагментов или вариантов. Предпочтительно указанные фрагменты, а также варианты характеризуются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одним из белков или пептидов или с одной из белковых или пептидных последовательностей, представленной выше. В этом контексте определение фрагментов и вариантов аналогично применяемому выше для компонента (А) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы.

Эффекторные молекулы, которые можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, можно выбирать также из числа ингибиторов протеинкиназ, в частности ингибиторов такой протеинкиназы, как аминоконцевая киназа c-Jun, т.е. из ингибиторов JNK. Как правило, ингибитор JNK, который можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, можно выводить из человеческой или крысиной последовательности IB1 (инсулинсвязывающий белок 1), предпочтительно из аминокислотной последовательности, представленной в или кодируемой любой из следующих последовательностей: SEQ ID NO:137 (в которой представлена крысиная последовательность кДНК IB1 и предсказанная аминокислотная последовательность), SEQ ID NO:138 (в которой представлена крысиная белковая последовательность IB1, кодируемая экзон-интронным стыком гена rIB1 - донор сайта сплайсинга), SEQ ID NO:139 (в которой представлена белковая последовательность IB1 из Homo sapiens) или SEQ ID NO:140 (в которой представлена последовательность кДНК IB1 из Homo sapiens), более предпочтительно из аминокислотной последовательности, представленной в или кодируемой любой из следующих последовательностей: SEQ ID NO; 139 (в которой представлена белковая последовательность IB1 из Homo sapiens) или SEQ ID NO:140 (в которой представлена последовательность кДНК IB1 из Homo sapiens), или из любых их фрагментов или вариантов. Определение фрагментов и вариантов представлено выше. В этом контексте определение фрагментов и вариантов аналогично применяемому выше для компонента (А) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы. Предпочтительно общая длина последовательности ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, составляет менее 150 аминокислотных остатков, более предпочтительно 5-150 аминокислотных остатков, более предпочтительно 10-100 аминокислотных остатков, еще более предпочтительно 10-75 аминокислотных остатков и наиболее предпочтительно 10-50 аминокислотных остатков, например, 10-30, 10-20 или 10-15 аминокислотных остатков. Более предпочтительно указанную последовательность ингибитора JNK и вышеуказанные диапазоны можно выбирать из любой из представленных в настоящем описании последовательностей ингибитора JNK, еще более предпочтительно из аминокислотной последовательности, представленной в SEQ ID NO:139, или кодируемой SEQ ID NO:140, еще более предпочтительно из области, состоящей из нуклеотидов 420-980 SEQ ID NO:140 или аминокислот 105-291 SEQ ID NO:139, и наиболее предпочтительно из области, простирающейся между нуклеотидами 561 и 647 SEQ ID NO:140 или аминокислотами 152 и 180 SEQ ID NO:139.

Согласно конкретному варианту осуществления изобретения последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, как правило, связывается с JNK и/или ингибирует активацию по меньшей мере одного активируемого JNK фактора транскрипции, например, c-Jun или ATF2 (см., например, SEQ ID NO:147 и SEQ ID NO:148 соответственно), или Elk1.

Аналогично этому, последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, предпочтительно содержит или состоит по меньшей мере из одной из аминокислотных последовательностей, представленных в любой из SEQ ID NO:137-220, или их фрагмента, производного или варианта. Более предпочтительно последовательность ингибитора JNK, которую можно применять согласно настоящему описанию, может содержать 1, 2, 3, 4 или даже большее количество копий аминокислотной последовательности, представленной в SEQ ID NO:137-220, или их варианта, фрагмента или производного. Если они присутствуют в количестве более одной копии, то эти аминокислотные последовательности, представленные в SEQ ID NO:137-220, или их варианты, фрагменты или производные, которые можно применять согласно настоящему описанию, могут быть непосредственно связаны друг с другом без какой-либо линкерной последовательности или через линкерную последовательность, содержащую 1-10, предпочтительно 1-5 аминокислот. Аминокислоты, образующие линкерную последовательность, предпочтительно выбирают из глицина или пролина в качестве аминокислотных остатков. Более предпочтительно эти аминокислотные последовательности, представленные в SEQ ID NO:137-220, или их фрагменты, варианты или производные, которые можно применять согласно настоящему описанию, могут быть отделены друг от друга шарниром, состоящим из двух, трех или большего количества остатков пролина.

Последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, может состоять из L-аминокислот, D-аминокислот или их комбинации. Предпочтительно последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, содержат по меньшей мере 1 или даже 2, предпочтительно по меньшей мере 3, 4 или 5, более предпочтительно по меньшей мере 6, 7, 8 или 9 и даже еще более предпочтительно по меньшей мере 10 или большее количество D- и/или L-аминокислот, при этом D- и/или L-аминокислоты могут располагаться в последовательности ингибитора JNK, которую можно применять согласно настоящему описанию, в виде блока, не в виде блока или в виде другой структуры.

Согласно одному из предпочтительных вариантов осуществления изобретения последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, может состоять только из L-аминокислот. Последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, могут также содержать или состоять по меньшей мере из одной «нативной последовательности ингибитора JNK», которая представлена в SEQ ID NO:141 или SEQ ID NO:143. В этом контексте понятие «нативная или нативная(ые) последовательность(и) ингибитора(ов) JNK» относится к неизмененным последовательностям ингибиторов JNK, представленным в любой из SEQ ID NO:141 или SEQ ID NO:143, которые полностью состоят из L-аминокислот.

Таким образом, последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, может содержать или состоять по меньшей мере из одной (нативной) аминокислотной последовательности NH2-Xnb-Xna-RPTTLXLXXXXXXXQD-Xnb-COOH (L-IB-генерик (s)) (SEQ ID NO:143) и/или JNK-связывающего домена (JBD) IB1 XRPTTLXLXXXXXXXQDS/TX (L-IB (генерик) (s)) (SEQ ID NO:151). В контексте настоящего описания Х каждый обозначает аминокислотный остаток, предпочтительно выбранный из любого (нативного) аминокислотного остатка. Xna обозначает, как правило, один аминокислотный остаток, предпочтительно представляющий собой любой аминокислотный остаток кроме серина или треонина, где n (количество повторений X) обозначает 0 или 1. Кроме того, Xnb каждый может представлять собой любой аминокислотный остаток, где n (количество повторений X) обозначает число от 0 до 5, от 5 до 10, от 10 до 15, от 15 до 20, от 20 до 30 или более, при условии, что, если n (количество повторений X) обозначает 0 в Xna, то Xnb не должен нести серии или треонин на С-конце, для того, чтобы избегать присутствия серина или треонина в указанном положении. Предпочтительно Xna представляет собой состоящий из смежных пептидных остатков фрагмент, выведенный из SEQ ID NO:141 или SEQ ID NO:143. Xna и Xnb могут представлять собой либо D-, либо L-аминокислоты. Кроме того, последовательность ингибитора JNK, которую можно применять согласно настоящему описанию, может содержать или состоять по меньшей мере из одной (нативной) аминокислотной последовательности, выбранной из группы, включающей JNK-связывающий домен IB1 DTYRPKRPTTLNLFPQVPRSQDT (L-IB1) (SEQ ID NO:149). Более предпочтительно последовательность ингибитора JNK, которую можно применять согласно настоящему описанию, может содержать также или состоять по меньшей мере из одной (нативной) аминокислотной последовательности NH2-RPKRPTTLNLFPQVPRSQD-COOH (L-IB1(s)) (SEQ ID NO:141). Кроме того, последовательность ингибитора JNK, которую можно применять согласно настоящему описанию, может содержать или состоять по меньшей мере из одной (нативной) аминокислотной последовательности, выбранной из группы, включающей JNK-связывающий домен IB1 L-IB1(s1) (NH2-TLNLFPQVPRSQD-COOH, SEQ ID NO:153); L-IB1(s2) (NH2-TTLNLFPQVPRSQ-COOH, SEQ ID NO:154); L-IB1(s3) (NH2-PTTLNLFPQVPRS-COOH, SEQ ID NO:155); L-IB1(s4) (NH2-RPTTLNLFPQVPR-COOH. SEQ ID NO:156); L-IB1(s5) (NH2-KRPTTLNLFPQVP-COOH, SEQ ID NO:

157); L-IB1(s6) (NH2-PKRPTTLNLFPQV-COOH, SEQ ID NO:158); L-IB1(s7) (NH2-RPKRPTTLNLFPQ-COOH, SEQ ID NO:159); L-IB1(s8) (NH2-LNLFPQVPRSQD-COOH, SEQ ID NO:160); L-IB1(s9) (NH2-TLNLFPQVPRSQ-COOH, SEQ ID NO:161); L-IB1(s10) (NH2-TTLNLFPQVPRS-COOH, SEQ ID NO:162); L-IB1(s11) (NH2-PTTLNLFPQVPR-COOH, SEQ ID NO:163); L-IB1(s12) (NH2-RPTTLNLFPQVP-COOH, SEQ ID NO:164); L-IB1(s13) (NH2-KRPTTLNLFPQV-COOH, SEQ ID NO:165); L-IB1(s14) (NH2-PKRPTTLNLFPQ-COOH, SEQ ID NO:166); L-IB1(s15) (NH2-RPKRPTTLNLFP-COOH, SEQ ID NO:167); L-IB1(s16) (NH2-NLFPQVPRSQD-COOH, SEQ ID NO:168); L-IB1(s17) (NH2-LNLFPQVPRSQ-COOH, SEQ ID NO:169); L-IB1(s18) (NH2-TLNLFPQVPRS-COOH, SEQ ID NO:170); L-IB1(s19) (NH2-TTLNLFPQVPR-COOH, SEQ ID NO:171); L-IB1(s20) (NH2-PTTLNLFPQVP-COOH, SEQ ID NO:172); L-IB1(s21) (NH2-RPTTLNLFPQV-COOH, SEQ ID NO:173); L-IB1(s22) (NH2-KRPTTLNLFPQ-COOH, SEQ ID NO:174); L-IB1(s23) (NH2-PKRPTTLNLFP-COOH, SEQ ID NO:175); L-IB1(s24) (NH2-RPKRPTTLNLF-COOH, SEQ ID NO:176); L-IB1(s25) (NH2-LFPQVPRSQD-COOH, SEQ ID NO:177); L-IB1(s26) (NH2-NLFPQVPRSQ-COOH, SEQ ID NO:178); L-IB1(s27) (NH2-LNLFPQVPRS-COOH, SEQ ID NO:179); L-IB1(s28) (NH2-TLNLFPQVPR-COOH, SEQ ID NO:180); L-IB1(s29) (NH2-TTLNLFPQVP-COOH, SEQ ID NO:181); L-IB1(s30) (NH2-PTTLNLFPQV-COOH, SEQ ID NO:182); L-IB1(s31) (NH2-RPTTLNLFPQ-COOH, SEQ ID NO:183); L-IB1(s32) (NH2-KRPTTLNLFP-COOH, SEQ ID NO:184); L-IB1(s33) (NH2-PKRPTTLNLF-COOH, SEQ ID NO:185); и L-IB1(s34) (NH2-RPKRPTTLNL-COOH, SEQ ID NO:186).

Кроме того, последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, может содержать или состоять по меньшей мере из одной (нативной) аминокислотной последовательности, выбранной из группы, включающей (длинный) JNK-связывающий домен (JBDs) IB1 PGTGCGDTYRPKRPTTLNLFPQVPRSQDT (IB1-длинный) (SEQ ID NO:145), (длинный) JNK-связывающий домен IB2 IPSPSVEEPHKHRPTTLRLTTLGAQDS (1 В2-длинный) (SEQ ID NO:146), JNK-связывающий домен c-Jun GAYGYSNPKILKQSMTLNLADPVGNLKPH (c-Jun) (SEQ ID NO:147), JNK-связывающий домен ATF2 TNEDHLAVHKHKHEMTLKFGPARNDSVIV (ATF2) (SEQ ID NO:148). В этом контексте сравнительный анализ продемонстрировал наличие частично консервативной состоящей из 8 аминокислот последовательности, а дополнительное сравнение JBDs IB1 и IB2 продемонстрировало наличие двух блоков из семи и трех аминокислот, высококонсервативных для двух последовательностей.

Согласно другому предпочтительному варианту осуществления изобретения последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, может частично или полностью состоять из D-аминокислот.Более предпочтительно эти последовательности ингибиторов JNK, состоящие из D-аминокислот, представляют собой ненативные последовательности описанных выше (нативных) последовательностей ингибиторов JNK в D-ретро-инвертированной форме. Понятие «ретро-инвертированные последовательности» относится к изомеру линейной пептидной последовательности, в котором направление последовательности изменено на противоположное и хиральность каждого аминокислотного остатка является инвертированной (см., например, Jameson и др.. Nature, 368, 1994, сс.744-746; Brady и др., Nature, 368, 1994, сс.692-693). Преимущество объединения применения D-энантиомеров и обратного синтеза состоит в том, что положения карбонильных и аминогрупп в каждой амидной связи меняются местами, при этом положение групп боковой цепи на каждом альфа-атоме углерода сохраняется. Если специально не указано иное, предполагается, что любая L-аминокислотная последовательность или пептид, которую/который можно применять согласно настоящему изобретению, может быть превращена/превращен в D-ретро-инвертированную последовательность или пептид путем синтеза последовательности или пептида, обратной/обратного относительно нативной L-аминокислотной последовательности или пептида.

Таким образом, последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, может содержать или состоять по меньшей мере из одной D-ретро-инвертированной последовательности, соответствующей аминокислотной последовательности NH2-Xnb-DQXXXXXXXLXLTTPR-Xna-Xnb-COOH (D-IB1-генерик (s)) (SEQ ID NO:144) и/или XS/TDQXXXXXXXLXLTTPRX (D-IB (генерик)) (SEQ ID NO:152). В контексте настоящего описания X, Xna и Xnb имеют указанные выше значения (предпочтительно обозначают D-аминокислоты), где Xnb предпочтительно обозначает состоящий из смежных остатков фрагмент, полученный из SEQ ID NO:142 или SEQ ID NO:144. Кроме того, последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, могут содержать или состоять по меньшей мере из одной D-ретро-инвертированной последовательности, соответствующей аминокислотной последовательности, которая содержит JNK-связывающий домен (JBDs) IB1 TDQSRPVQPFLNLTTPRKPRYTD (D-IB1) (SEQ ID NO:150). Более предпочтительно последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, могут содержать или состоять по меньшей мере из одной D-ретро-инвертированной последовательности, соответствующей аминокислотной последовательности, NH2-DQSRPVQPFLNLTTPRKPR-COOH (D-IB1(s)) (SEQ ID NO:142). Кроме того, последовательности ингибитора JNK, которые можно применять согласно настоящему описанию, могут содержать или состоять по меньшей мере из одной D-ретро-инвертированной последовательности, соответствующей аминокислотной последовательности, которая содержит JNK-связывающий домен (JBDs) IB1 D-IB1(s1) (NH2-QPFLNLTTPRKPR-COOH, SEQ ID NO:187); D-IB1 (s2) (NH2-VQPFLNLTTPRKP-COOH, SEQ ID NO:188); D-IB1 (s3) (NH2-PVQPFLNLTTPRK-COOH, SEQ ID NO:189); D-IB1 (s4) (NH2-RPVQPFLNLTTPR-COOH, SEQ ID NO:190); D-IB1(s5) (NH2-SRPVQPFLNLTTP-COOH, SEQ ID NO:191); D-IB1(s6) (NH2-QSRPVQPFLNLTT-COOH, SEQ ID NO:192); D-IB1(s7) (NH2-DQSRPVQPFLNLT-COOH, SEQ ID NO:193); D-IB1 (s8) (NH2-PFLNLTTPRKPR-COOH, SEQ ID NO:194); D-IB1 (s9) (NH2-QPFLNLTTPRKP-COOH. SEQ ID NO:195); D-IB1(s10) (NH2-VQPFLNLTTPRK-COOH, SEQ ID NO:196); D-IB1(s11) (NH2-PVQPFLNLTTPR-COOH, SEQ ID NO:197); D-IB1(s12) (NH2-RPVQPFLNLTTP-COOH, SEQ ID NO:198); D-IB1(s13) (NH2-SRPVQPFLNLTT-COOH. SEQ ID NO:199); D-IB1(s14) (NH2-QSRPVQPFLNLT-COOH, SEQ ID NO:200); D-IB1(s15) (NH2-DQSRPVQPFLNL-COOH, SEQ ID NO:201); D-IB1(s16) (NH2-FLNLTTPRKPR-COOH, SEQ ID NO:202); D-IB1(s17) (NH2-PFLNLTTPRKP-COOH, SEQ ID NO:203); D-IB1(s18) (NH2-QPFLNLTTPRK-COOH, SEQ ID NO:204); D-IB1(s19) (NH2-VQPFLNLTTPR-COOH, SEQ ID NO:205); D-IB1(s20) (NH2-PVQPFLNLTTP-COOH, SEQ ID NO:206); D-IB1(s21) (NH2-RPVQPFLNLTT-COOH, SEQ ID NO:207); D-IB1(s22) (NH2-SRPVQPFLNLT-COOH, SEQ ID NO:208); D-IB1(s23) (NH2-QSRPVQPFLNL-COOH, SEQ ID NO:209); D-IB1(s24) (NH2-DQSRPVQPFLN-COOH, SEQ ID NO:210); D-IB1(s25) (NH2-DQSRPVQPFL-COOH, SEQ ID NO:211); D-IB1(s26) (NH2-QSRPVQPFLN-COOH, SEQ ID NO:212); D-IB1(s27) (NH2-SRPVQPFLNL-COOH, SEQ ID NO:213); D-IB1(s28) (NH2-RPVQPFLNLT-COOH, SEQ ID NO:214); D-IB1(s29) (NH2-PVQPFLNLTT-COOH, SEQ ID NO:215); D-IB1(s30) (NH2-VQPFLNLTTP-COOH, SEQ ID NO:216); D-IB1(s31) (NH2-QPFLNLTTPR-COOH, SEQ ID NO:217); D-IB1(s32) (NH2-PFLNLTTPRK-COOH, SEQ ID NO:218); D-IB1(s33) (NH2-FLNLTTPRKP-COOH, SEQ ID NO:219) и D-IB1(s34) (NH2-LNLTTPRKPR-COOH, SEQ ID NO:220).

Примеры последовательностей ингибиторов JNK, которые можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, представлены в таблице 4 (SEQ ID NO:141-220). В таблице представлены обозначения предлагаемых в изобретении последовательностей ингибиторов JNK, а также идентификационный номер последовательности, их длина и аминокислотная последовательность. Кроме того, в таблице 4 представлены выведенные из IB1 последовательности, а также их общие формулы, например, для SEQ ID NO:141 и SEQ ID NO:142, и SEQ ID NO:143 и SEQ ID NO:144 соответственно. В таблице 4 приведены также последовательности L-IB1, представленные в SEQ ID NO:153-186, и последовательности D-IB1, представленные в SEQ ID NO:187-220.

Таблица 4
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
L-IB1(s) 141 19 RPKRPTTLNLFPQVPRSQD (NH2-RPKRPTTLNLFPQVPRSQD-COOH)
D-IB1(s) 142 19 DQSRPVQPFLNLTTPRKPR (NH2-DQSRPVQPFLNLTTPRKPR-COOH)
L-IB (генерик) (s) 143 19 NH2-Xnb-Xna-RPTTLXLXXXXXXXQD-Xnb-COOH
D-IB (генерик) (s) 144 19 NH2-Xnb-DQXXXXXXXLXLTTPR-Xna-Xnb-COOH
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
IB1-длинный 145 29 PGTGCGDTYRPKRPTTLNLFPQVPRSQDT(NH2-PGTGCGDTYRPKRPTTLNLFPQVPRSQDT СООН)
IB2-длинный 146 27 IPSPSVEEPHKHRPTTLRLTTLGAQDS (NH2- IPSPSVEEPHKHRPTTLRLTTLGAQDS-СООН)
c-Jun 147 29 GAYGYSNPKILKQSMTLNLADPVGNLKPH(NH2-GAYGYSNPKILKQSMTLNLADPVGNLKPH СООН)
ATF2 148 29 TNEDHLAVHKHKHEMTLKFGPARNDSVIV(NH2-TNEDHLAVHKHKHEMTLKFGPARNDSVIV СООН)
L-IB1 149 23 DTYRPKRPTTLNLFPQVPRSQDT (NH2- DTYRPKRPTTLNLFPQVPRSQDT-СООН)
D-IB1 150 23 TDQSRPVQPFLNLTTPRKPRYTD (NH2- TDQSRPVQPFLNLTTPRKPRYTD-СООН)
L-IB (генерик) 151 19 XRPTTLXLXXXXXXXQDS/TX (NH2- XRPTTLXLXXXXXXXQDS/TX-СООН)
D-IB (генерик) 152 19 XS/TDQXXXXXXXLXLTTPRX (NH2- XS/TDQXXXXXXXLXLTTPRX-СООН)
L-IB1(s1) 153 13 TLNLFPQVPRSQD (NH2-TLNLFPQVPRSQD-COOH)
L-IB1(s2) 154 13 TTLNLFPQVPRSQ (NH2-TTLNLFPQVPRSQ-COOH)
L-IB1(s3) 155 13 PTTLNLFPQVPRS (NH2-PTTLNLFPQVPRS-COOH)
L-IB1(s4) 156 13 RPTTLNLFPQVPR (NH2-RPTTLNLFPQVPR-COOH)
L-IB1(s5) 157 13 KRPTTLNLFPQVP (NH2-KRPTTLNLFPQVP-COOH)
L-IB1(s6) 158 13 PKRPTTLNLFPQV (NH2-PKRPTTLNLFPQV-COOH)
L-IB1(s7) 159 13 RPKRPTTLNLFPQ (NH2-RPKRPTTLNLFPQ-COOH)
L-IB1(s8) 160 12 LNLFPQVPRSQD (NH2-LNLFPQVPRSQD-COOH)
L-IB1(s9) 161 12 TLNLFPQVPRSQ (NH2-TLNLFPQVPRSQ-COOH)
L-IB1(s10) 162 12 TTLNLFPQVPRS (NH2-TTLNLFPQVPRS-COOH)
L-IB1(s11) 163 12 PTTLNLFPQVPR (NH2-PTTLNLFPQVPR-COOH)
L-IB1(s12) 164 12 RPTTLNLFPQVP (NH2-RPTTLNLFPQVP-COOH)
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
L-IB1(s13) 165 12 KRPTTLNLFPQV (NH2-KRPTTLNLFPQV-COOH)
L-IB1(s14) 166 12 PKRPTTLNLFPQ (NH2-PKRPTTLNLFPQ-COOH)
L-IB1(s15) 167 12 RPKRPTTLNLFP (NH2-RPKRPTTLNLFP-COOH)
L-IB1(s16) 168 11 NLFPQVPRSQD (NH2-NLFPQVPRSQD-COOH)
L-IB1(s17) 169 11 LNLFPQVPRSQ (NH2-LNLFPQVPRSQ-COOH)
L-IB1(s18) 170 11 TLNLFPQVPRS (NH2-TLNLFPQVPRS-COOH)
L-IB1(s19) 171 11 TTLNLFPQVPR (NH2-TTLNLFPQVPR-COOH)
L-IB1(s20) 172 11 PTTLNLFPQVP (NH2-PTTLNLFPQVP-COOH)
L-IB1(s21) 173 11 RPTTLNLFPQV (NH2-RPTTLNLFPQV-COOH)
L-IB1(s22) 174 11 KRPTTLNLFPQ (NH2-KRPTTLNLFPQ-COOH)
L-IB1(s23) 175 11 PKRPTTLNLFP (NH2-PKRPTTLNLFP-COOH)
L-IB1(s24) 176 11 RPKRPTTLNLF (NH2-RPKRPTTLNLF-COOH)
L-IB1(s25) 177 10 LFPQVPRSQD (NH2-LFPQVPRSQD-COOH)
L-IB1(s26) 178 10 NLFPQVPRSQ (NH2-NLFPQVPRSQ-COOH)
L-IB1(s27) 179 10 LNLFPQVPRS (NH2-LNLFPQVPRS-COOH)
L-IB1(s28) 180 10 TLNLFPQVPR (NH2-TLNLFPQVPR-COOH)
L-IB1(s29) 181 10 TTLNLFPQVP (NH2-TTLNLFPQVP-COOH)
L-IB1(s30) 182 10 PTTLNLFPQV (NH2-PTTLNLFPQV-COOH)
L-IB1(s31) 183 10 RPTTLNLFPQ (NH2-RPTTLNLFPQ-COOH)
L-IB1(s32) 184 10 KRPTTLNLFP (NH2-KRPTTLNLFP-COOH)
L-IB1(s33) 185 10 PKRPTTLNLF (NH2-PKRPTTLNLF-COOH)
L-IB1(s34) 186 10 RPKRPTTLNL (NH2-RPKRPTTLNL-COOH)
D-IB1(s1) 187 13 QPFLNLTTPRKPR (NH2-QPFLNLTTPRKPR-COOH)
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
D-IB1(s2) 188 13 VQPFLNLTTPRKP (NH2-VQPFLNLTTPRKP-COOH)
D-IB1(s3) 189 13 PVQPFLNLTTPRK (NH2-PVQPFLNLTTPRK-COOH)
D-IB1(s4) 190 13 RPVQPFLNLTTPR (NH2-RPVQPFLNLTTPR-COOH)
D-IB1(s5) 191 13 SRPVQPFLNLTTP (NH2-SRPVQPFLNLTTP-COOH)
D-IB1(s6) 192 13 QSRPVQPFLNLTT (NH2-QSRPVQPFLNLTT-COOH)
D-IB1(s7) 193 13 DQSRPVQPFLNLT (NH2-DQSRPVQPFLNLT-COOH)
D-IB1(s8) 194 12 PFLNLTTPRKPR (NH2-PFLNLTTPRKPR-COOH)
D-IB1(s9) 195 12 QPFLNLTTPRKP (NH2-QPFLNLTTPRKP-COOH)
D-IB1(s10) 196 12 VQPFLNLTTPRK (NH2-VQPFLNLTTPRK-COOH)
D-IB1(s11) 197 12 PVQPFLNLTTPR (NH2-PVQPFLNLTTPR-COOH)
D-IB1(s12) 198 12 RPVQPFLNLTTP (NH2-RPVQPFLNLTTP-COOH)
D-IB1(s13) 199 12 SRPVQPFLNLTT (NH2-SRPVQPFLNLTT-COOH)
D-IB1(s14) 200 12 QSRPVQPFLNLT (NH2-QSRPVQPFLNLT-COOH)
D-IB1(s15) 201 12 DQSRPVQPFLNL (NH2-DQSRPVQPFLNL-COOH)
D-IB1(s16) 202 11 FLNLTTPRKPR (NH2-FLNLTTPRKPR-COOH)
D-IB1(s17) 203 11 PFLNLTTPRKP (NH2-PFLNLTTPRKP-COOH)
D-IB1(s18) 204 11 QPFLNLTTPRK (NH2-QPFLNLTTPRK-COOH)
D-IB1(s19) 205 11 VQPFLNLTTPR (NH2-VQPFLNLTTPR-COOH)
D-IB1(s20) 206 11 PVQPFLNLTTP (NH2-PVQPFLNLTTP-COOH)
D-IB1(s21) 207 11 RPVQPFLNLTT (NH2-RPVQPFLNLTT-COOH)
D-IB1(s22) 208 11 SRPVQPFLNLT (NH2-SRPVQPFLNLT-COOH)
D-IB1(s23) 209 11 QSRPVQPFLNL (NH2-QSRPVQPFLNL-COOH)
D-IB1(s24) 210 11 DQSRPVQPFLN (NH2-DQSRPVQPFLN-COOH)
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
D-IB1(s25) 211 10 DQSRPVQPFL (NH2-DQSRPVQPFL-COOH)
D-IB1(s26) 212 10 QSRPVQPFLN (NH2-QSRPVQPFLN-COOH)
D-IB1(s27) 213 10 SRPVQPFLNL (NH2-SRPVQPFLNL-COOH)
D-IB1(s28) 214 10 RPVQPFLNLT (NH2-RPVQPFLNLT-COOH)
D-IB1(s29) 215 10 PVQPFLNLTT (NH2-PVQPFLNLTT-COOH)
D-IB1(s30) 216 10 VQPFLNLTTP (NH2-VQPFLNLTTP-COOH)
D-IB1(s31) 217 10 QPFLNLTTPR (NH2-QPFLNLTTPR-COOH)
D-IB1(s32) 218 10 PFLNLTTPRK (NH2-PFLNLTTPRK-COOH)
D-IB1(s33) 219 10 FLNLTTPRKP (NH2-FLNLTTPRKP-COOH)
D-IB1(s34) 220 10 LNLTTPRKPR (NH2-LNLTTPRKPR-COOH)

Последовательности ингибиторов JNK, которые можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, могут содержать также или состоять по меньшей мере из одного варианта, фрагмента и/или производного указанных выше предлагаемых в изобретении нативных или ненативных аминокислотных последовательностей, представленных в SEQ ID NO:141-220. Предпочтительно эти варианты, фрагменты и/или производные сохраняют биологическую активность описанных выше нативных или ненативных последовательностей ингибиторов JNK, которые можно применять согласно настоящему изобретению, прежде всего нативных или ненативных аминокислотных последовательностей, представленных в SEQ ID NO:141-220, т.е. способность связываться с JNK и/или ингибировать активацию по меньшей мере одного активируемого JNK фактора транскрипции, например, c-Jun, ATF2 или Elk1. Функциональную активность можно оценивать с помощью различных анализов, например, с помощью оценки связывания пептида с его молекулами-мишенями или с помощью биофизических методов, например, с помощью спектроскопии, компьютерного моделирования, структурного анализа и т.д. В частности, последовательность ингибитора JNK или ее вариантов, фрагментов и/или производных, описанных выше, можно исследовать с помощью анализа гидрофильности (см., например, Норр и Woods, Proc Natl Acad Sci USA 78, 1981, сс.3824-3828), который можно использовать для идентификации гидрофобных и гидрофильных областей пептидов, что позволяет создавать субстраты для экспериментальных исследований, таких как эксперименты по связыванию, или для синтеза антител. Для идентификации областей последовательности ингибитора JNK или ее вариантов, фрагментов и/или производных, которые применяют согласно настоящему описанию, можно осуществлять также анализ вторичной структуры, с помощью которого определяют специфические структурные мотивы (см., например, Chou и Fasman, Biochem 13, 1974, сс.222-223). Для манипуляции, трансляции, предсказания вторичной структуры, определения профилей гидрофильности и гидрофобности, предсказания и создания открытых рамок считывания и определения гомологии последовательностей можно использовать компьютерные пакеты программ, существующие в данной области. Можно применять также другие методы структурного анализа, в том числе, например, рентгеновскую кристаллографию (см., например, Engstrom, Biochem Exp Biol 11, 1974, сс.7-13), масс-спектроскопию и газовую хроматографию (см., например, methods in protein science, изд-во J. Wiley and Sons, New York, NY, 1997), и компьютерное моделирование (см., например. Computer Graphics and Molecular Modeling, в: Current Communications in Molecular Biology, под ред. Fletterick и Zoller, изд-во Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1986).

Таким образом, последовательность ингибитора JNK, которую можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, содержит или состоит по меньшей мере из одного варианта (нативных или ненативных) аминокислотных последовательностей, представленных в SEQ ID NO:141-220. В контексте настоящего изобретения «вариант (нативных или ненативных) аминокислотных последовательностей, представленных в SEQ ID NO:141-220» предпочтительно обозначает последовательность, выведенную из любой из последовательностей, представленных в SEQ ID NO:141-220, при этом вариант содержит аминокислотные изменения аминокислотных последовательностей, представленных в SEQ ID NO:141-220. Такие изменения, как правило, включают 1-20, предпочтительно 1-10 и более предпочтительно 1-5 замен, добавлений и/или делеций аминокислот в SEQ ID NO:141-220, при этом для варианта характерна идентичность последовательностей с любой из последовательностей, представленных в SEQ ID NO:141-220, составляющая по меньшей мере примерно 30%, 50%, 70%, 80%, 90%, 95%, 98% или даже 99%. Если варианты (нативных или ненативных) аминокислотных последовательностей, представленных в SEQ ID NO:141-220, как они определены выше, и применяемые согласно настоящему описанию, получают путем замен конкретных аминокислот, то такие замены предпочтительно представляют собой консервативные замены, уже описанные выше.

Эффекторные молекулы, которые можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, можно выбирать также из антигенов или антигенных фрагментов, предпочтительно белковых и пептидных антигенов, например, опухолевых антигенов или их антигенных фрагментов, вызывающих аллергию антигенов или их антигенных фрагментов, аутоантигенов или их антигенных фрагментов, патогенных антигенов или их антигенных фрагментов и антигенов или их антигенных фрагментов из вирусов, предпочтительно таких вирусов, как цитомегаловирус (CMV), ортопоксвирус оспы, ортопоксвирус белой оспы, овечий паратоксвирус, вирус контагиозного моллюска, вирус герпеса простого 1, вирус герпеса простого 2, вирус герпеса В, вирус ветряной оспы, вирус ложного бешенства, вирус человеческой цитомегалии, человеческий вирус герпеса 6, человеческий вирус герпеса 7, вирус Эпштейна-Барра, человеческий вирус герпеса 8, вирус гепатита В, вирус чикунгунья, вирус O'nyong'nyong, рубивирус, вирус гепатита С, GB-вирус С, вирус Западного Нила, вирус лихорадки Денге, вирус желтой лихорадки, вирус шотландского энцефаломиелита овец (louping-вирус), вирус энцефалита Сент-Луис, вирус японского энцефалита В, вирус Повассан, вирус FSME, вирус SARS (тяжелый острый респираторный синдром), SARS-ассоциированный коронавирус, человеческий коронавирус 229Е, человеческий коронавирус Ос43, торовирус, человеческий Т-клеточный лимфотропный вирус типа I, человеческий Т-клеточный лимфотропный вирус типа II, ВИЧ (СПИД), т.е. человеческий вирус иммунодефицита типа 1 или человеческий вирус иммунодефицита типа 2, вирус гриппа, вирус лихорадки Лаоса, вирус лимфоцитарного хориоменингита, вирус комплекса Такарибе, вирус Хурин, вирус Мачупо, вирус болезни Борна, вирус Буньямвера, вирус калифорнийского энцефалита, вирус лихорадки долины Рифт, вирус лихорадки песчаных мух, вирус лихорадки Тоскана, вирус геморрагической лихорадки Крым-Конго, вирус Хазара, вирус Казань, вирус Хантаан, вирус Сеул, вирус Проспект Хилл, вирус Пуумала, вирус Белград-Дубрава, вирус Тула (Tula-вирус), вирус Sin Nombre («вирус без имени»), вирус Марбург озера Виктория, вирус Эбола Заира, суданский вирус Эбола, вирус Эбола Берега Слоновой Кости, вирус гриппа А, вирус гриппа В, вирус гриппа С, вирус парагриппа, вирус малярии, вирус Марбург, вирус кори, вирус эпидемического паротита (свинки), респираторно-синцитиальный вирус, человеческий метапневмовирус, индийский вирус везикулярного стоматита, вирус бешенства, вирус Мокола, вирус Дувенхаге, европейский лиссавирус летучих мышей 1+2, австралийский вирус летучих мышей, аденовирус A-F, вирусы папилломы человека, вирус кондиломы 6, вирус кондиломы 11, вирусы полиомы, аденоассоциированный вирус 2, ротавирус, орбивирусы, вирусы оспы, включая вирус ветряной оспы и др., или антигены или антигенные фрагменты из лейшманий, трипаносом, амеб, бактерий и др., или их можно выбирать их эпитопов или из вариантов вышеуказанных антигенов или антигенных фрагментов. Предпочтительно фрагменты, а также варианты антигенов, указанных выше, отличаются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одним из антигенов или последовательностей антигенов, которые описаны выше. В этом контексте определение фрагментов и вариантов аналогично применяемому выше для компонента (А) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы. Кроме того, под объем изобретения подпадают эпитопы (которые обозначают также как «антигенные детерминанты») антигенов или антигенных фрагментов, указанных выше. Эпитопы в контексте настоящего изобретения, как правило, представляют собой фрагменты, локализованные на внешней поверхности (нативной) белковых или пептидных антигенов, указанных в настоящем изобретении, предпочтительно они состоят из 5-15 аминокислот, более предпочтительно состоят из 5-12 аминокислот, еще более предпочтительно состоят из 6-9 аминокислот, которые могут распознаваться антителами, т.е. находятся в их нативной форме.

Кроме того, эффекторные молекулы, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, являющихся транспортерами карго-молекулы, можно выбирать из антител. Согласно настоящему изобретению указанные антитела можно выбирать из антител, например, полученных рекомбинантным путем или встречающихся в естественных условиях антител, известных в данной области, в частности антител, пригодных для терапевтических, диагностических или научных целей, или антител, идентифицированных в качестве специфических для определенных раковых заболеваний. В контексте настоящего описания понятие «антитело» используется в его наиболее широком смысле и относится, в частности, к моноклональным и поликлональным антителам (включая агонистические, антагонистические и блокирующие или нейтрализующие антитела) и видам антител с полиэпитопной специфичностью. Согласно изобретению «антитело», как правило, включает любые антитела, известные в данной области (например, антитела типа IgM, IgD, IgG, IgA и IgE), в том числе встречающиеся в естественных условиях антитела, антитела, полученные иммунизацией организма-хозяина, антитела, которые выделены и идентифицированы из встречающегося в естественных условиях источника, или антитела, полученные иммунизацией организма-хозяина и полученные рекомбинантным путем с помощью методов молекулярной биологии, известных в данной области, а также химерные антитела, человеческие антитела, гуманизированные антитела, биспецифические антитела, антитела к внутреннему фактору, т.е. антитела, экспрессирующиеся в клетках и необязательно локализованные в специфических клеточных компартментах, и фрагменты и варианты указанных выше антител. Как правило, антитело состоит из легкой цепи и тяжелой цепи, которые обе имеют вариабельные и константные области. Легкая цепь состоит из N-концевой вариабельной области, VL, и С-концевой константной области, CL. В отличие от этого, тяжелая цепь антитела типа IgG, например, состоит из N-концевой вариабельной области, VH, и трех константных областей, CH1, CH2 и CH3. В этом контексте антитела содержат также фрагменты и варианты описанных выше антител, например, Fab-фрагмент, Fc-фрагмент и т.д. Предпочтительно указанные фрагменты, а также варианты антител, указанных выше, отличаются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одним из антител, описанных выше. В этом контексте определение фрагментов и вариантов аналогично определению, которое было дано выше для компонента (А) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы.

Кроме того, эффекторные молекулы, которые можно применять в качестве компонента (Б) в предлагаемых в изобретении молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно выбирать из факторов, индуцирующих апоптоз (проапоптозных), или связанных с апоптозом белков, таких как AIF, Apaf, например, Apaf-1, Apaf-2, Apaf-3, или АРО-2 (L), АРО-3 (L), апопаин. Bad, Bak, Bax, Bcl-2, Bcl-xL, Bcl-xS, bik, Bok, CAD, калпаин, каспаза, например, каспаза-1, каспаза-2, каспаза-3, каспаза-4, каспаза-5, каспаза-6, каспаза-7, каспаза-8, каспаза-9, каспаза-10, каспаза-11, ced-3, ced-9, c-Jun, c-Myc, crm А, цитохром С, CdR1, DcR1, DD, DED, DISC, ДНК-PKCS, DR3, DR4, DR5, FADD/MORT-1, FAK, Fas (Fas-лиганд CD95/fas (рецептор)), FLICE/MACH, FLIP, фодрин, fos, G-актин, Gas-2, гелсолин, гранзим А/В, ICAD, ICE, JNK, ламин А/В, MAP, Max, MCL-1, Mdm-2, MEKK-1, MORT-1, Myd88, NEDD, NF-каппаВ, NuMa, p38, p53, PAK-2, PARP, перфорин, PITSLRE, РКСдельта, pRb, презенилин, prICE, RAIDD, Ras, RIP, сфингомиелиназа, тимидинкиназа вируса герпеса простого, TRADD, TRAF2, TRAIL-R1, TRAIL-R2, TRAIL-R3, трансглутаминаза и т.д., или из их фрагментов или вариантов, или из компонентов пути передачи сигналов wnt, таких как β-катенин, или ICF-семейство, полоподобные киназы, CiP2A, PP2A и т.д., или из их фрагментов или вариантов. Предпочтительно указанные фрагменты, а также варианты отличаются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одной из последовательностей, описанных выше. В этом контексте определение фрагментов и вариантов аналогично применяемому выше для компонента (А) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы.

Эффекторные молекулы, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно выбирать также по меньшей мере из одного или нескольких частичных или полноразмерных ВН3-доменов и/или по меньшей мере одного частичного или полноразмерного белка «ВН3-только». В этом контексте белки «ВН3-только» предпочтительно определяют как представители Bcl-2-семейства, включающего регуляторы апоптоза, которые взаимодействуют с другими представителями Bcl-2-семейства. В этом контексте предлагаемый в настоящем изобретении компонент (Б) молекулы-конъюгата, которая является транспортером карго-молекулы, можно выбирать из аминокислотной последовательности, которая содержит по меньшей мере одну или несколько частичную(ых) или полноразмерную(ых) последовательность(ей) ВН3-домена белка «ВН3-только», или частичный или полноразмерный белок «ВН3-только» (который относится к подклассу семейства белков Bcl-2), который(ые) обладает(ют) способностью индуцировать апоптоз либо путем взаимодействия по меньшей мере с одним белком Bcl-2-семейства, либо путем активации или сенсибилизации по меньшей мере одного проапоптозного представителя Bcl-2-семейства. Их функциональную активность можно тестировать с помощью пригодных методов анализа, например, с помощью анализов связывания или путем анализа проапоптозной активности с помощью анализа апоптоза. Предпочтительно аминокислотная последовательность, применяемая в качестве компонента (Б) в молекуле-конъюгате, которая является транспортером карго-молекулы, предлагаемой в изобретении, может содержать или состоять по меньшей мере из одной частичной или полноразмерной последовательности ВН3-домена и/или по меньшей мере одной частичной или полноразмерной последовательности белка «ВН3-только», выбранной из группы, включающей Bid, Bad, Noxa, Puma, Bim, Bik, Bmf, DP5/Hrk и Bok. В другом варианте аминокислотная последовательность, применяемая в качестве компонента (Б) в молекуле-конъюгате, которая является транспортером карго-молекулы, предлагаемой в изобретении, может содержать или состоять по меньшей мере из комбинации по меньшей мере одной частичной или полноразмерной последовательности белка «ВН3-только», выбранной из группы, включающей, например. Bid и Bad, Bim и Bad, Bik и Bad, Puma и Bad, Noxa и Bad, Bmf и Bad, DP5/Hrk и Bad, Bok и Bad, Bik и Bim, Bik и Bid, Bik и Puma, Bik и Noxa, Bik и Bmf, Bik и DP5/Hrk, Bik и Bok, Bid и Puma, Bid и Noxa, Bid и Bim, Bid и Bmf, Bid и DP5/Hrk, Bid и Bok, Bim и Noxa, Bim и Puma, Bim и Bmf, Bim и DP5/Hrk, Bim и Bok, Puma и Noxa, Puma и Bmf, Puma и DP5/Hrk, Puma и Bok, Noxa и Bmf, Noxa и DP5/Hrk и Noxa и Bok. (Полноразмерные или частичные) ВН3-последовательности или последовательности белка «ВН3-только», указанные выше, можно выбирать, например, из любого белка «ВН3-только» млекопитающих, в частности, из человеческих изоформ. Таким образом, компонент (Б) в молекуле-конъюгате, которая является транспортером карго-молекулы, предлагаемой в изобретении, может содержать или состоять по меньшей мере из одной частичной или полноразмерной последовательности ВН3-домена и/или по меньшей мере одной последовательности белка «ВН3-только», эти последовательности представлены в любой из SEQ ID NO:221-237 (см. таблицу 5). Предпочтительно аминокислотная последовательность, применяемая в качестве компонента (Б) в молекуле-конъюгате, которая является транспортером карго-молекулы, предлагаемой в изобретении, может также содержать или состоять по меньшей мере из одного фрагмента или варианта по меньшей мере частичной или полноразмерной последовательности ВН3-домена и/или по меньшей мере одной последовательности белка «ВН3-только», представленной в одной из SEQ ID NO:221-237. Указанные фрагменты, а также варианты предпочтительно имеют последовательность, состоящую из менее чем 50, предпочтительно менее чем 40 и еще более предпочтительно менее чем 30 аминокислот, или отличаются гомологией или идентичностью последовательностей, составляющей примерно 10%, примерно 20%, примерно 30%, примерно 40%, примерно 50%, примерно 60%, примерно 70%, примерно 80% или примерно 90%, с одной из последовательностей, описанных выше или представленных в одной из SEQ ID NO:221-237. В этом контексте определение фрагментов и вариантов аналогично определению, которое дано выше для компонента (А) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы. Кроме того, фрагменты или варианты нативных последовательностей, как правило, содержат последовательности ВН3-домена или по меньшей мере часть последовательности ВН3-домена (по меньшей мере 7 аминокислот из последовательности ВН3-домена).

Таблица 5
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
Bid (человеческий) (вариант транскрипта 1) 221 241 MCSGAGVMMA RWAARGRAGW RSTVRILSPL GHCEPGVSRS CRAAQAMDCE VNNGSSLRDE CITNLLVFGF LQSCSDNSFR RELDALGHEL PVLAPQWEGY DELQTDGNRS SHSRLGRIEA DSESQEDIIRNIARHLAQVG DSMDRSIPPG LVNGLALQLR NTSRSEEDRN RDLATALEQL LQAYPRDMEK EKTMLVLALL LAKKVASHTP SLLRDVFHTT VNFINQNLRT YVRSLARNGM D
Bad (человеческий) 222 168 MFQIPEFEPS EQEDSSSAER GLGPSPAGDG PSGSGKHHRQ APGLLWDASH QQEQPTSSSH HGGAGAVEIR SRHSSYPAGT EDDEGMGEEP SPFRGRSRSA PPNLWAAQRY GRELRRMSDE FVDSFKKGLP RPKSAGTATQ MRQSSSWTRV FQSWWDRNLG RGSSAPSQ
Noxa1 (человеческий) 223 483 MASLGDLVRA WHLGAQAVDR GDWARALHLF SGVPAPPARL CFNAGCVHLL AGDPEAALRA FDQAVTKDTC MAVGFFQRGV ANFQLARFQE ALSDFWLALE QLRGHAAIDY TQLGLRFKLQ AWEVLHNVAS AQCQLGLWTE AASSLREAMS KWPEGSLNGL DSALDQVQRR GSLPPRQVPR GEVFRPHRWH LKHLEPVDFL GKAKVVASAI PDDQGWGVRP QQPQGPGANH DARSLIMDSP RAGTHQGPLD AETEVGADRC TSTAYQEQRP QVEQVGKQAP LSPGLPAMGG PGPGPCEDPA GAGGAGAGGS EPLVTVTVQC AFTVALRARR GADLSSLRAL LGQALPHQAQ LGQLSYLAPG EDGHWVPIPE EESLQRAWQD AAACPRGLQL QCRGAGGRPV LYQVVAQHSY SAQGPEDLGF RQGDTVDVLC EEPDVPLAVD QAWLEGHCDG RIGIFPKCFV VPAGPRMSGA PGRLPRSQQG DQP
Puma(человеческий) 224 193 MARARQEGSS PEPVEGLARD GPRPFPLGRL VPSAVSCGLC EPGLAAAPAA PTLLPAAYLC APTAPPAVTA ALGGSRWPGG PRSRPRGPRP DGPQPSLSLA EQHLESPVPS APGALAGGPT QAAPGVRGEE EQWAREIGAQ LRRMADDLNA QYERRRQEEQ QRHRPSPWRV LYNLIMGLLP LPRGHRAPEM EPN
Bim (человеческий) (вариант транскрипта 1) 225 198 MAKQPSDVSS ECDREGRQLQ PAERPPQLRP GAPTSLQTEP QGNPEGNHGG EGDSCPHGSP QGPLAPPASP GPFATRSPLF IFMRRSSLLS RSSSGYFSFD TDRSPAPMSC DKSTQTPSPP CQAFNHYLSA MASMRQAEPA DMRPEIWIAQ ELRRIGDEFN AYYARRVFLN NYQAAEDHPR MVILRLLRYI VRLVWRMH
Bik (человеческий) 226 160 MSEVRPLSRD ILMETLLYEQ LLEPPTMEVL GMTDSEEDLD PMEDFDSLEC MEGSDALALR LACIGDEMDV SLRAPRLAQL SEVAMHSLGL AFIYDQTEDI RDVLRSFMDG FTTLKENIMR
Обозначение последовательности/пептида SEQ ID NO AK Последовательность
FWRSPNPGSW VSCEQVLLAL LLLLALLLPL LSGGLHLLLK
ВН3-домен Bik(BH3 Bik) 227 18 ALALRLACIG DEMDVSLR
ВН3-домен Bad (BH3 Bad) 228 18 RYGRELRRMS DEFVDSFK
ВН3-домен Bid (BH3 Bid) 229 18 NIARHLAQVG DSMDRSIP
ВН3-домен Bmf (BH3 Bmf) 230 18 QIARKLQCIA DQFHRLHV
ВН3-домен DP5/Hrk (BH3 DP5Hrk) 231 18 LTAARLKAIG DELHQRTM
ВН3-домен Bim (BH3 Bim) 232 18 WIAQELRRIG DEFNAYYA
ВН3-домен Noxa (BH3 Noxa) 233 18 ECATQLRRFG DKLNFRQK
ВН3-домен PUMA (BH3 PUMA) 234 18 EIGAQLRRMA DDLNAQYE
ВН3-домен Bax (BH3 Bax) 235 18 KLSECLKRIG DELDSNME
ВН3-домен Bak (BH3 Bak) 236 18 QVGRQLAIIG DDINRRYD
ВН3-домен Bok (BH3 Bok) 237 18 EVCTVLLRLG DELEQIRP

Белковые или пептидные последовательности, представленные выше, например, терапевтически активные белки, антигены, антитела, проапоптозные факторы, протеазы, участвующие в патологических состояниях, предпочтительно ингибиторы пептидных протеаз, ВН3-домены и т.д., которые можно применять в качестве эффекторных молекул, представляющих собой компонент (Б) в предлагаемых в изобретении молекулах-конъюгатах, которые являются транспортерами карго-молекулы, могут представлять собой белковую или пептидную последовательность либо в нативной форме, состоящую из L-аминокислот, либо в ретро-инвертированной D-форме (полностью), состоящую из D-аминокислот, это означает, что указанные последовательности могут быть инвертированы путем замены друг на друга концов: нативный С-конец представляет собой N-конец инвертированной формы, а нативный N-конец представляет собой С-конец инвертированной формы. В другом варианте эти белковые или пептидные последовательности, описанные выше, могут иметь белковую или пептидную последовательность, представляющую собой смесь L-аминокислот и D-аминокислот.

Эффекторные молекулы, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно выбирать также из нуклеиновых кислот, предпочтительно из нуклеиновых кислот, кодирующих указанные выше белки или пептиды, такие как терапевтически активные белки и пептиды, антигены, антитела, проапоптозные факторы, протеазы, участвующие в патологических состояниях, предпочтительно ингибиторы пептидных протеаз, ВН3-домены или части или полноразмерные белки «ВН3-только» или варианты их фрагментов. В этом контексте нуклеиновые кислоты предпочтительно содержат одноцепочечные, двухцепочечные или частично двухцепочечные нуклеиновые кислоты, предпочтительно выбранные из группы, включающей геномную ДНК, кДНК, РНК, siPHK, антисмысловую ДНК, антисмысловую РНК, рибозим, комплементарные последовательности РНК/ДНК с контролирующими экспрессию элементами или без них, миниген, фрагменты гена, регуляторные элементы, промоторы и их комбинации.

В другом конкретном примере эффекторные молекулы, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно выбирать из siPHK. В этом контексте представляют интерес прежде всего siPHK в сочетании с явлением РНК-интерференции. Внимание к явлению РНК-интерференции возникло в процессе иммунологических исследований. В последние годы был открыт основанный на РНК защитный механизм, который встречается как в царстве грибов и растений, так и в царстве животных, и который действует в качестве «иммунной системы генома». Эта система впервые была описана независимо друг от друга в различных видах, сначала в С. elegans, до того, как стало возможным идентифицировать механизмы, лежащие в основе этих процессов, как идентичные: опосредуемая РНК устойчивость к вирусам растений, PTGS (пост-транскрипционное молчание генов) у растений и РНК-интерференция у эукариот фактически основаны на общем процессе. Метод in vitro РНК-интерференции (PHKi) основан на двухцепочечных молекулах РНК (dsPHK), которые «запускают» специфическую для последовательности супрессию генной экспрессии (Zamore, Nat. Struct. Biol. 9, 2001, сс.746-750; Sharp, Genes Dev. 5, 2001. сс.485-490: Hannon, Nature 41, 2002, сс.244-251). При трансфекции клеток млекопитающих длинной dsPHK активация протеинкиназы R и КНКазыЬ приводит к неспецифическим воздействиям, таким, например, как интерфероновая реакция (Stark и др., Annu. Rev. Biochem. 67, 1998, сс.227-264; Не и Katze, Viral Immunol. 15, 2002, сс.95-119). Эти неспецифические явления не происходят, когда используют более короткую, например, 21-23-мерную так называемую siPHK (малая интерферирующая РНК), поскольку неспецифические явления не «запускаются» siPHK, которая состоит менее чем из 30 пар оснований (Elbashir и др., Nature 411, 2001, сс.494-498). В настоящее время молекулы dsPHK применяют также in vivo (McCaffrey и др., Nature 418, 2002, сс.38-39; Xia и др., Nature Biotech. 20, 2002, сс.1006-1010; Brummelkamp и др., Cancer Cell 2, 2002, сс.243-247). Таким образом, siPHK, которые применяют в виде эффекторной молекулы, пригодной в качестве компонента (Б) в предлагаемых в изобретении молекулах-конъюгатах, которые являются транспортерами карго-молекулы, как правило, представляют собой одно- или двухцепочечную, предпочтительно двухцепочечную последовательность РНК, состоящую примерно из 8-30 нуклеотидов, предпочтительно из 17-25 нуклеотидов, еще более предпочтительно из 20-25 и наиболее предпочтительно из 21-23 нуклеотидов. В принципе все сегменты, состоящие из 17-29, предпочтительно 19-25, наиболее предпочтительно 21-23 пар оснований, которые присутствуют в кодирующей области белка (последовательность), указанные выше, могут служить в качестве последовательности-мишени для siPHK. Равным образом, siPHK могут быть направлены против описанных выше нуклеотидных последовательностей, кодирующих белок (последовательность), которые не находятся в кодирующей области, в частности, например, в 5'-некодирующей области РНК, таким образом, направлены против некодирующих областей РНК, которые обладают регуляторной функцией. Таким образом, последовательность-мишень для siPHK может лежать в транслируемой и/или нетранслируемой области РНК и/или в области контролирующих элементов. Последовательность-мишень для siPHK может лежать также в области, перекрывающей нетранслируемую и транслируемую последовательность; в частности, последовательность-мишень может содержать по меньшей мере один нуклеотид, расположенный против хода транскрипции относительно стартового триплета кодирующей области.

В другом конкретном примере эффекторные молекулы, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно выбирать из антисмысловой РНК. В этом контексте антисмысловая РНК предпочтительно представляет собой (одноцепочечную) молекулу РНК, транскрибируемую на основе кодирующей, а не матричной цепи (геномной) ДНК, в результате чего она является комплементарной смысловой (матричной) РНК. Антисмысловая РНК, которую можно применять в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, как правило, входит в дуплекс между смысловой и антисмысловой молекулой РНК и поэтому обладает способностью блокировать трансляцию соответствующей мРНК. В контексте настоящего описания антисмысловая РНК может быть направлена против любой части последовательности мРНК, например, выведенной из геномной ДНК, и/или которая может кодировать любой белок, например, белок или пептид, описанные выше, такие как терапевтически активные белки и пептиды, антигены, антитела, проапоптозные факторы, протеазы, участвующие в патологических состояниях, предпочтительно ингибиторы пептидных протеаз, ВН3-домены или части или полноразмерные белки «ВН3-только» или варианты их фрагментов, которые описаны выше, если трансляция кодируемого белка или пептида снижается/подавляется. Таким образом, последовательность-мишень антисмысловой РНК на являющейся мишенью мРНК (или на являющейся мишенью (геномной) ДНК) может быть локализована в транслируемой и/или нетранслируемой области мРНК (или на являющейся мишенью (геномной) ДНК), например, в области контролирующих элементов, в частности в 5'-некодирующей области мРНК (или на являющейся мишенью (геномной) ДНК), которая обладает регуляторной функцией. Последовательность-мишень антисмысловой РНК, направленную против мРНК (или против являющейся мишенью (геномной) ДНК), можно конструировать также таким образом, что антисмысловая РНК связывается с мРНК (или с являющейся мишенью (геномной) ДНК) путем перекрытия ее последовательности областью, которая частично комплементарна нетранслируемой и транслируемой (кодирующей) последовательности мРНК ((или являющейся мишенью (геномной) ДНК); в частности антисмысловая РНК может быть комплементарна последовательности-мишени мРНК (или являющейся мишенью (геномной) ДНК), по меньшей мере одному нуклеотиду, расположенному против хода транскрипции относительно стартового триплета кодирующей области. Предпочтительно антисмысловая РНК, применяемая согласно настоящему описанию, содержит от примерно 5 до примерно 5000, от примерно 500 до примерно 5000 и более предпочтительно от примерно 1000 до примерно 5000 нуклеотидов или в другом варианте от примерно 5 до примерно 1000, от примерно 5 до примерно 500, от примерно 5 до примерно 250, от примерно 5 до примерно 100, от примерно 5 до примерно 50 или от примерно 5 до примерно 30 нуклеотидов или в другом и еще более предпочтительном варианте от примерно 20 до примерно 100, от примерно 20 до примерно 80 или от примерно 20 до примерно 60 нуклеотидов.

В другом конкретном примере эффекторные молекулы, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно выбирать из цитотоксических или противоопухолевых лекарственных средств, которые можно применять в качестве химиотерапевтических лекарственных средств. В целом, химиотерапевтические лекарственные средства, которые можно применять в качестве компонента (Б) в молекулах-конъюгатах, которые являются транспортерами карго-молекулы, можно разделять на три основные категории на основе их механизма действия. Они могут (а) прекращать синтез «элементов конструкции» молекулы преДНК: Эти агенты функционируют различным образом. «Элементами конструкции» ДНК являются фолиевая кислота, гетероциклические основания и нуклеотиды, которые в естественных условиях образуются в клетке. Все эти агенты блокируют определенную стадию образования нуклеотидов или дезоксирибонуклеотидов (необходимых для создания ДНК). Если эти стадии заблокированы, то нуклеотиды, представляющие собой «элементы конструкции» ДНК и РНК, не могут быть синтезированы. В результате клетки не могут реплицироваться, поскольку без нуклеотидов они не могут создавать ДНК. Примеры лекарственных средств из этого класса включают метотрексат (Abitrexate®), фторурацил (Adrucil®), гидроксимочевину (Hydrea®) и меркаптопурин (Purinethol®), тиогуанин, токоферол или, в более общем смысле, также любые нуклеотидные аналоги, например, аналоги 2'-дезоксицитидина. В другом варианте химиотерапевтические лекарственные средства могут (б) непосредственно повреждать ДНК в ядре клетки. Эти агенты повреждают ДНК и РНК химическим путем. Они нарушают репликацию ДНК и либо полностью останавливают репликацию, либо приводят к образованию нонсенс-ДНК или -РНК (т.е. новая ДНК или РНК не кодирует никакой нужный продукт). Примерами лекарственных средств из этого класса являются цисплатин (Platinol®) и антибиотики - даунорубицин (Cerubidine®), доксорубицин (Adriamycin®), относящиеся к классу антрациклиновых противоопухолевых средств (представителей которого можно применять в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы), и этопосид (VePesid®) или любой интеркалятор. И, наконец, химиотерапевтические лекарственные средства могут (в) воздействовать на синтез митотических веретен или расщеплять их: Митотические веретена служат в качестве молекулярных рельсов, имеющих «северный и южный полюса», в клетке, когда клетка начинает делиться на две новые клетки. Эти веретена очень важны, поскольку они помогают расщеплять новые копии ДНК таким образом, чтобы копия попадала в каждую из двух новых клеток в процессе деления клетки. Указанные лекарственные средства нарушают образование этих веретен и тем самым прекращают деление клетки. Примерами лекарственных средств из этого класса соединений, нарушающих митоз, являются: винбластин (Velban®), винкристин (Oncovin®) и паклитаксел (Taxol®). Компонент (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, может оказывать воздействие одним из указанных выше путей. Другими словами, в качестве компонента (Б) предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, можно применять любой из классов противоопухолевых лекарственных средств, т.е. алкилирующие агенты, нитрозомочевины, антиметаболиты, растительные алкалоиды, противоопухолевые антибиотики и стероидные гормоны. Для того, чтобы более подробно описать эти классы лекарственных средств, следует особо подчеркнуть, что каждое противораковое лекарственное средство можно также классифицировать на основе его описанного выше воздействия на клеточный цикл и химию клетки. Алкилирующие агенты убивают клетки, воздействуя непосредственно на ДНК. Алкилирующие агенты можно применять для лечения хронических лейкозов, болезни (лимфомы) Ходжкина, лимфом и определенных типов карцином легкого, молочной железы, предстательной железы и яичника. Примером обычно применяемого алкилирующего агента является циклофосфамид. Действие нитрозомочевин аналогично действию алкилирующих агентов, и они ингибируют также изменения, необходимые для репарации ДНК. Эти агенты преодолевают гематоэнцефалический барьер и поэтому их применяют для лечения опухолей головного мозга, лимфом, множественной миеломы и злокачественной меланомы. Основными лекарственными средствами из этого класса являются кармустин и ломустин. Антиметаболиты представляют собой лекарственные средства, которые блокируют клеточный рост, воздействуя на определенные функции, как правило, на синтез ДНК. После включения в клетку они останавливают нормальное развитие и репродукцию. Все лекарственные средства из этого класса воздействуют на клетку в течение «S»-фазы клеточного цикла. Антиметаболиты можно применять для лечения острых и хронических лейкозов, хориокарциномы и некоторых типов опухолей желудочно-кишечного тракта, молочной железы и яичника. Примерами обычно применяемых антиметаболитов являются 6-меркаптопурин и 5-фторурацил (5FU). Противоопухолевые антибиотики представляют собой группу разнообразных соединений. В целом, их действие заключается в связывании с ДНК и предупреждении синтеза РНК. Эти агенты широко применяют при лечении разнообразных типов рака. Наиболее широко применяемыми лекарственными средствами из этой группы являются доксорубицин (адриамицин), митомицин-С и блеомицин. Растительные (винка) алкалоиды представляют собой противоопухолевые агенты, полученные из растений. Эти лекарственные средства действуют специфически, блокируя деление клеток в процессе митоза. Их обычно применяют при лечении острого лимфобластного лейкоза, лимфомы Ходжкина и не-ходжкинской лимфомы, нейробластом, опухоли Вильямса и рака легкого, молочной железы и яичек. Винкристин и винбластин представляют собой обычно применяемые агенты из этой группы. Стероидные гормоны применяют при лечении некоторых типов опухолей. Этот класс включает адренокортикостероиды, эстрогены, антиэстрогены, прогестероны и андрогены. Хотя конкретный механизм их действия не изучен, известно, что стероидные гормоны модифицируют рост некоторых гормонзависмых типов рака. Примером является тамоксифен, который применяют при лечении эстрогензависимого рака молочной железы. Все указанные выше типы рака можно лечить с помощью предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекулы, которые содержат в качестве компонента (Б) любое из перечисленных выше противоопухолевых средств.

Одну из групп цитотоксических или противоопухолевых лекарственных средств, которые можно применять в виде эффекторной молекулы, пригодной в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, предпочтительно выбирают из группы, включающей алкилирующие лекарственные средства, антиметаболики, цитостатики или лекарственные средства, применяемые при гормональном лечении. В этом контексте в качестве цитотоксических или противоопухолевых лекарственных средств предпочтительно выбирают соединения из классов металлсодержащих, прежде всего содержащих платину (производные) соединений, и таксола. В частности, фрагмент, представляющий собой лекарственное средство, выбирают из группы лекарственных средств, включающей, например, цисплатин, трансплатин, сатраплатин, оксалиплатин, карбоплатин, недаплатин, хлорамбуцил, циклофосфамид, мефалан, азатиоприн, фторурацил, (6)-меркаптопурин, меторексат, нандролон, аминоглутемид, медроксипрогестерон, мегестролацетат, прокарбазин, доцетаксел, паклитаксел, иринотекан, эпиподофиллотоксин, подофиллотоксин, винкристин, винбластин, доцетаксел, дауномицин, даунорубицин, доксорубицин, митоксантрон, топотекан, блеомицин, гемцитабин, флударабин, навелбин и 5-FLJDR. Наиболее предпочтительным является класс металлсодержащих противоопухолевых лекарственных средств, например, класс содержащих платину соединений.

Другими цитотоксическими или противоопухолевыми лекарственными средствами, которые можно применять в качестве эффекторных молекул, представляющих собой компонент (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, являются (обозначены их родовыми названиями) алитретиноин, алтретамин, азатиоприн, бикалутамид, бусулфан, капецитабин, циклофосфамид, экземестан, летрозол, финастерид, мегестрола ацетат, трипторелин, темозоломид, мифепристон, третиноин, орал, тамоксифен, тенипосид, иматиниб (Gleevec®), гефитиниб (IRESSA®), пептомицина сульфат или соединения из класса камптотецинов.

Другой группой цитотоксических или противоопухолевых лекарственных средств, которые можно применять в качестве эффекторных молекул, представляющих собой компонент (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, являются производные индолокарбазола, например, стауроспорин (и его аналоги) и ребеккамицин. Следует отметить, что в качестве компонента (Б) особенно предпочтительными являются также соединения, относящиеся к классу анилинохиназолинов (например, гефитиниб).

Другую группу цитотоксических или противоопухолевых лекарственных средств, которые можно применять в качестве эффекторных молекул, представляющих собой компонент (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать также из ингибиторов топоизомераз, таких как иринотекан, или митотических кинезинов или дигидрофолатредуктазы (DHFR).

Кроме того, цитотоксические или противоопухолевые лекарственные средств, которые можно применять в качестве эффекторных молекул, представляющих собой компонент (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать из группы, включающей факторы, ингибирующие или стимулирующие клеточную пролиферацию, такие как тромбоцитарный фактор роста (PDGF), внутриклеточные пути, например, пути передачи сигнала RAS/RAF, такие, например, как представитель пути передачи сигнала RAF/MEK/ERK (например, RAF-1), или пути активируемой митогеном протеинкиназы, семейство CMGC-киназ (включая CDK (зависящие от циклина киназы), МАРК, GSK3, CLK-), Ser/Thr-киназы, относящиеся к семейству AGC-киназ, включая семейства киназ РКА, PKG, РКС, тирозинкиназные рецепторы, участвующие в неоваскуляризации и развитии опухоли, включая рецептор сосудистого эндотелиального фактора роста (VEGFR)-2, VEGFR-3, рецептор тромбоцитарного фактора роста β, Flt-3, систему эндотелина (ЕТ), котораявключает ЕТ-1, ЕТ-2, ЕТ-3, и рецептор ETA (ETAR) и ETBR, и c-KIT, в этом случае мишенью является, например, ингибирование их функции, и представителей IGF-семейства, например, IGF-1, IGF-2, IGF-1R, IGF2R и т.д.

Другую группу цитотоксических или противоопухолевых лекарственных средств, которые можно применять в качестве эффекторных молекул, представляющих собой компонент (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать из ингибиторов, мишенью которых является пролиферация опухолевых клеток и ангиогенез опухоли. Наиболее предпочтительными являются низкомолекулярные противоопухолевые ингибиторы киназ, мишенью которых являются злокачественные клетки и/или сосудистые клетки, обладающие антиангиогенной активностью. Ингибиторы киназ, такие как ингибиторы, мишенью которых являются EGFR, Her2/neu, BCR-ABL, c-KIT, РКС, Raf и PI3, обладают антиангиогенными свойствами благодаря тому, что они блокируют секрецию ангиогенных факторов злокачественными клетками, на которые они воздействуют. Ингибиторы киназ, такие как VEGFR2, VEGFR1, PDGFR, РКС, Raf и PI3, обладают антиангиогенным действием в отношении сосудистых клеток. Примерами синтетических ингибиторов циклинзависимых киназ (CDKI) являются, например, оломоуцин, флавопиридол, бутиролактон и их производные, которые ограничивают клеточную пролиферацию. С другой стороны, противоопухолевые соединения, пригодные в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать из активаторов программ апоптоза в раковых клетках (таких, например, как стауроспорин) или соединений, осуществляющих понижающую регуляцию антиапоптозных белков, например, Bcl-2.

Общей особенностью всех указанных соединений является то, что они должны проникнуть через клеточную мембрану для того, чтобы оказывать свое действие в качестве противораковых лекарственных средств. В результате сочетания соединений, относящихся к любому из указанных классов (соединения, непосредственно повреждающие ДНК в ядре клетки, воздействующие на синтез или расщепление митотических веретен или прекращающие синтез «блоков конструкции» молекулы пре-ДНК), которые применяют в качестве компонента (Б), с компонентом (А) с образованием предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, повышается способность противораковых соединений проникать в клетку и/или повышается их растворимость, что приводит к увеличению эффективности этих терапевтических соединений. В свою очередь, усиление включения клеткой и предпочтительно более высокая растворимость этих соединений в водном окружении (например, в цитозоле) позволяют уменьшать дозу терапевтического противоракового соединения.

Кроме того, компонент (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может содержать также низкомолекулярные органические соединения или молекулы лекарственного средства, такие как ингибиторы протеаз, которые ингибируют протеазы, прежде всего протеазы, участвующие в инфекционном цикле инфекционных агентов, например, вирусные, бактериальные или протозойные протеазы. В предпочтительном варианте осуществления изобретения эти ингибиторы протеаз (органические соединения или молекулы лекарственного средства), используемые в качестве компонента молекулы-конъюгата, предлагаемой в изобретении, можно применять для лечения вирусных, бактериальных или протозойных инфекций, например, малярии. В частности, с помощью ингибиторов протеаз можно лечить вирусные инфекции, например, заболевания, вызываемые ретровирусами. Очень предпочтительным является применение молекул-конъюгатов, содержащих ингибиторы протеаз, для лечения вызываемых ВИЧ инфекций. Ингибиторы протеаз, которые следует применять для сочетания с указанной в настоящем описании последовательностью-носителем, можно выбирать из группы, включающей 640385, абакавира сульфат, AG1776, ампренавир (141W94 или VX-478), атазанавир (BMS-232632), ингибитор катепсин S-протеазы, D1927, D9120, эфавиренц, эмтрицитабин, энфувиртид (Т-20), фосампренавир (GW-433908 или VX-175), GS 9005, GW640385 (VX-385), ингибитор протеазы HCV, индинавир (МК-639), L-756, 423, левоприн-ZG, лопинавир (АВТ-378), лопинавир/ритонавир (LPV АВТ-378/r), MK-944A, мозенавир (DMP450), нелфинавир (AG-1343), невирапин, Р-1946, PL-100, приномастат, ритонавир (АВТ-538), R0033-4649, ТМС114, саквинавир (Ro-31-8959), тенофовир дисопроксила фумарат, типранавир (PNU-140690), TLK 19781, ТМС-114, Vertex 385, VX-950.

И, наконец, эффекторные молекулы, пригодные в качестве компонента (Б) в предлагаемой в изобретении молекуле-конъюгате, которая является транспортером карго-молекулы, можно выбирать также в качестве отдельного компонента из указанных выше меток для предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Указанная предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, является наиболее предпочтительной для применения в анализах in vitro или in vivo. В этом контексте метки могут представлять собой радиоактивные метки, т.е. радиоактивное фосфорилирование, или радиоактивную метку, включающую серу, водород, углерод, азот и т.д.; окрашивающие агенты (например, дигоксигенин и т.д.); флуоресцентные группы (например, флуоресцеин, родамин, указанные ниже флуорохромные белки и т.д.); хемолюминесцентные группы; или комбинацию указанных меток. Предпочтительно флуорохромные белки представляют собой любой флуорохромный белок, которые можно активировать таким образом, что он испускает флуоресцентный сигнал. Более предпочтительно флуорохромный белок выбирают из числа любых флуоресцентных белков, например, из группы, включающей зеленый флуоресцентный белок (GFP), производные зеленого флуоресцентного белка (GFP), такие как EGFP, AcGFP, TurboGFP, Эмеральд (Emerald), зеленый Азами (Azami Green), фотоактивируемый-GFP (РА-GFP), или синий флуоресцентный белок (BFP), включая EBFP, Сапфир (Sapphire), Т-Сапфир (T-Sapphire), или циановые флуоресцентные белки (CFP), включая усиленный циановый флуоресцентный белок (ECFP), mCFP, церулан, CyPet, или желтые флуоресцентные белки (YFP), включая Топаз (Topaz), Венус (Venus), мЦитрин (mCitrine), Ypet, PhiYFP, mBanana, желтый флуоресцентный белок, спектр флуоресценции которого сдвинут в сторону зеленого флуоресцентного белка (Yellow GFP), усиленный желтый флуоресцентный белок (EYFP) или оранжевый и красный флуоресцентный белок (RFP), включая Kusibara Orange, mOrange, dTomato-Tandem, DsRed-Monomer, mTangerine, mStrawberry, мономерный красный флуоресцентный белок (mRFP1) (который обозначают также как mRFP), mCherry, mRaspberry, HcRed-Tandem,mPlum, а также оптические хайлайтеры (маркеры), выбранные из PA-GFP, CoralHue Dronpa (G), PS-CFP (С), PS-CFP (G), mEosFP (G), mEosFP (G), или другие мономерные флуоресцентные белки, такие как «зажигающий» флуоресцентный белок, (KFP1), экворин, автофлуоресцентные белки (AFP) или флуоресцентные белки JRed, TurboGFP, PhiYFP и PhiYFP-m, tHc-Red (HcRed-Tandem), PS-CFP2 и KFP-Red (доступны от фирмы EVRQGEN, см. также www.evrogen.com), или другие пригодные флуоресцентные белки.

Предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, содержащая компоненты (А) и (Б), может включать также по меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) и т.д., предпочтительно отличный от компонента (Б). Этот по меньшей мере один необязательный дополнительный фрагмент может придавать дополнительные функции предлагаемому в изобретении слитому белку и его можно выбирать независимо друг от друга из компонентов (Б), (В), (Г) и/или (Д).

Например, по меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может представлять собой любую из эффекторных молекул, описанных выше в качестве компонента (Б). Предпочтительно по меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, не является идентичным конкретно указанному компоненту (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, т.е. по меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) и т.д. предпочтительно можно выбирать независимо друг от друга из различных эффекторных молекул или их фрагментов или вариантов, описанных выше. По меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может представлять собой также аминокислоту олигопептид или полипептид или (небольшое) органическое химическое соединение и может быть связан с предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, в соответствующем положении, например, на N-конце, С-конце предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, или может быть сшит внутри цепи с аминокислотами, например, с боковыми цепями аминокислот, или с нуклеиновыми кислотами или с любым приемлемым положением компонента (Б) (или (А)). По меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может представлять собой также фрагмент (например, НА, HSV-метку, His6-метку, FLAG-метку), который делает предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, более пригодной для очистки и/или выделения. При необходимости необходимый для очистки компонент можно затем отделять от других компонентов предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы (например, протеолитическим расщеплением или другими методами, известными в данной области) по окончании процесса получения.

Кроме того, по меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может представлять собой, например, сигнальную последовательность или локализующую последовательность, которая обеспечивает эффективную направленность предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, в конкретную внутриклеточную целевую область локализации, предпочтительно без снижения повышенной способности проникать в клетку предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Как правило, сигнальная последовательность или локализующая последовательность обеспечивают направленный перенос предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, в определенные клеточные компартменты, например, эндоплазматический ретикулум, митохондрии, аппарат с неясной функцией (gloom), лизосомальные пузырьки и т.д. Примерами сигнальных последовательностей или локализующих последовательностей являются (но, не ограничиваясь только ими) локализующие последовательности для эндоплазматического ретикулума, такие как KDEL (SEQ ID NO:238), DDEL (SEQ ID NO:239), DEEL (SEQ ID NO:240), QEDL (SEQ ID NO:241), RDEL (SEQ ID NO:242), последовательности, предназначенные для ядерной локализации, такие как PKKKRKV (SEQ ID NO:243), PQKKIKS (SEQ ID NO:244), QPKKP (SEQ ID NO:245), RKKR (SEQ ID NO:246), последовательности, предназначенные для локализации в ядерной области, такие как RKKRRQRRRAHQ (SEQ ID NO:247), RQARRNRRRRWRERQR (SEQ ID NO:248), MPLTRRRPAASQALAPPTP (SEQ ID NO:249), последовательности, предназначенные для локализации в эндодомальном компартменте MDDQRDLISNNEQLP (SEQ ID NO:250) и т.д.

Аналогично этому по меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может представлять собой, например, сигнальную последовательность или локализующую последовательность, которая обеспечивает эффективную направленность предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, в конкретный тип клеток, предпочтительно без снижения повышенной способности проникать в клетку предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы.

Предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, может содержать также по меньшей мере одну модификацию, предпочтительно на ее концах, либо на С-, либо на N-конце, либо на обоих концах. С-конец предпочтительно можно модифицировать с помощью амидной модификации, а N-конец можно модифицировать с помощью любой приемлемой NH2-защитной группы, например, путем ацилирования, или любой другой модификации, уже описанной выше для L-аминокислот. Указанные модификации включают также интродукцию меток, описанных выше для предлагаемых в изобретении молекул-транспортеров общей формулы (I), представленной выше.

И, наконец, компонент (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, описанной выше, а также линкеры, которые необязательно можно применять для связывания этих компонентов, могут содержать или состоять из белковых или пептидных последовательностей. Указанные белковые или пептидные последовательности могут состоять из L-аминокислот, D-аминокислот или их комбинации, предпочтительно, как описано выше для предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), указанных выше. Указанные D- и/или L-аминокислоты могут располагаться в компонентах (Б), (В), (Г) и/или (Д) в виде блока, не в виде блока или в виде другой структуры. В альтернативном варианте схема, описанная выше для предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), указанных выше, может предусматривать повторение этих компонентов. Другими словами, общую формулу (I) (SEQ ID NO:1) D1LLLxDm(LLLyDn)a, как она определена выше, можно применять, когда количество повторений, указанных выше для а, не ограничено диапазоном 0-3, но можно применять к полной молекуле, т.е. а может обозначать 1-500, 1-250, 1-100, 1-50, 1-20, 1-10, 1-5 или 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 и т.д. и предпочтительно определяется длиной белковых или пептидных последовательностей, которые должны быть перекрыты.

Компоненты (А), (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, и, если они присутствуют, то и другие необязательные компоненты (В), (Г) и/или (Д) и т.д., как правило, связывают друг с другом ковалентными связями или электростатической связью (например, полилизин), предпочтительно ковалентными связями. В этом контексте понятие «ковалентная связь» относится к стабильной химической связи между двумя атомами, образующейся в результате объединения одной или большего количества пар электронов. Предпочтительно все компоненты (А) и (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, и, если они присутствуют, то и другие необязательные компоненты (В), (Г) и/или (Д) и т.д., можно сшивать с получением линейной молекулы или нелинейной (разветвленной) молекулы, предпочтительно линейной молекулы. В линейной молекуле все вышеуказанные компоненты (А) и (Б) и, если они присутствуют, то и необязательные компоненты (В), (Г) и/или (Д) и т.д., связывают друг с другом через их концы в линейной форме, что не приводит к разветвлению молекулы-конъюгата, которая является транспортером карго-молекулы. В нелинейной молекуле все вышеуказанные компоненты (А) и (Б) и, если они присутствуют, то и необязательные компоненты (В), (Г) и/или (Д) и т.д., связывают друг с другом через их концы в форме, которая приводит к получению разветвленной молекулы-конъюгата, которая является транспортером карго-молекулы, например, к получению Y-образной формы и т.д.

Поскольку компонент (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, по определению представляет собой пептидную последовательность, состоящую из D- и L-аминокислот, то (ковалентное) присоединение других компонентов (Б), и, если они присутствуют, то и необязательных компонентов (В), (Г) и/или (Д), может, естественно зависеть от типа и природы подлежащих присоединению компонентов, т.е. от того, представляют ли собой индивидуальные компоненты белки или пептиды, нуклеиновые кислоты, (небольшие) органические соединения и т.д.

Порядок, в котором компонент (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, и, если они присутствуют, то и другие необязательные компоненты (В), (Г) и/или (Д), связывают с компонентом (А) и друг с другом с получением предпочтительно линейной молекулы, как правило, может быть любым. Таким образом, любой из компонентов (А), (Б), и, если они присутствуют, то (В), (Г), (Д) и т.д., можно связывать друг с другом. Однако предпочтительно компонент (А) присоединяют к концам предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Если компоненты (Б), и, если они присутствуют, то и компоненты (В), (Г), (Д) и т.д., представляют собой белковую или пептидную последовательность, то компонент (А), если он представляет собой пептид или белок, предпочтительно находится на С-конце предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, например, на С-конце компонента (Б), как указано выше, или, если они присутствуют, то и компонентов (В), (Г), (Д) и т.д. Указанное положение компонента (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предупреждает расщепление пептидной или белковой последовательности компонентов (Б), (В), (Г) и/или (Д) и т.д. до его/их транспортировки к требуемому сайту-мишени, например, к клетке, ядру и т.д., пептидазой, прежде всего карбоксипептидазой, такой карбоксиконцевая пептидаза N. В альтернативном варианте, если в применяемых клеточных системах присутствуют аминоконцевые пептидазы, то компонент (А) может быть локализован на аминоконце предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы.

Если компонент (Б) и/или, если он присутствует, то и любой другой необязательный компонент (В), (Г), (Д), представляет собой пептидную или белковую последовательность, то связь между указанными белковыми или пептидными компонентами предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предпочтительно представляет собой пептидную связь. Указанную пептидную связь можно формировать с помощью химического синтеза с участием обоих компонентов (N-конец одного компонента и С-конец другого компонента), которые требуется связывать, или ее можно непосредственно получать путем белкового синтеза полной пептидной последовательности обоих компонентов, где оба (белковых или пептидных) компонента предпочтительно синтезируют на одной стадии. Указанные методы синтеза белков включают, например (но, не ограничиваясь только ими), методы жидкофазного синтеза пептидов или методы твердофазного синтеза пептидов, например, методы твердофазного синтеза пептидов согласно подходу Меррифилда, твердофазный синтез пептидов с использованием трет-Вос, твердофазный синтез пептидов с использованием Fmoc, твердофазный синтез пептидов с использованием ВОР (гексафторфосфат бензотриазол-1-илокси-трис(диметиламино)фосфония) и т.д.

Кроме того, компонент (А) и компонент (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, можно сшивать через линкер или непосредственно (без линкера) с помощью, например, амидного мостика, если подлежащие связыванию компоненты имеют реакционноспособные аминогруппы или карбоксигруппы. В другом варианте предпочтительными являются связи с помощью сложного или простого эфира.

Указанные выше дополнительные компоненты (В), (Г) и/или (Д) и т.д., если они присутствуют, можно сшивать аналогичным путем с компонентом (А) и/или компонентом (Б), или необязательно сшивать друг с другом, причем они могут быть связаны в виде одного отдельного фрагмента либо с компонентом (А), либо с компонентом (Б). Можно использовать также линкерные последовательности для слияния компонентов предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, по меньшей мере с одним другим компонентом (см. ниже). Форма сочетания другого(их) компонента(ов) либо с компонентом (А), либо с компонентом (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, должна зависеть от их химической природы. Если дополнительные компоненты (В), (Г), (Д) и т.д. относятся к классу пептидных последовательностей, их предпочтительно связывают с предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, либо на конце компонента (А), либо в альтернативном варианте через боковые цепи L- или D-аминокислот компонента (А), например, с помощью дисульфидного мостика. Аналогичным образом можно присоединять дополнительные компоненты другой химической природы к компоненту (А) (концевые группы или химически активные группы боковых цепей) или компоненту (Б). Связь через боковые цепи предпочтительно осуществляют с помощью аминогрупп, тиольных или гидроксильных групп боковых цепей, например, посредством амидной связи или связи с помощью сложного или простого эфира. Следует отметить, что согласно изобретению все аминокислоты (любого из компонентов (А) и (В), (Г), (Д) и т.д., если они состоят из аминокислот) предпочтительно представляют собой D-энантиомерные аминокислоты, которые соответствуют своим встречающимся в естественных условиях аналогам, связанным в ретро-инвертированном порядке. Тем не менее, компоненты (В), (Г), (Д) и т.д., если они состоят из аминокислот, могут содержать также L-аминокислоты (в их встречающемся в естественных условиях порядке расположения последовательностей) или содержать комбинацию D- и L-аминокислот.

Если используют пептидные линкерные последовательности для слияния компонента (А) и (Б) или для слияния другого компонента, например (В), с компонентом (А) и/или (Б), то линкерные последовательности предпочтительно представляют собой гибкую последовательность, состоящую из 2-10 остатков, более предпочтительно из 1-5 остатков. В предпочтительном варианте осуществления изобретения линкерная последовательность содержит по меньшей мере 20%, более предпочтительно по меньшей мере 40% и еще более предпочтительно по меньшей мере 50% остатков Gly или (3-аланина, например, представляет собой GlyGlyGlyGlyGly (SEQ ID NO:255), GlyGlyGlyGly (SEQ ID NO:256), GlyGlyGly, CysGlyGly или GlyGlyCys и т.д. Специалист в данной области легко может отбирать и получать соответствующие линкерные последовательности. Они могут состоять из D- и/или L-аминокислот.

Пептидные линкерные последовательности можно интродуцировать также между компонентом (А) и компонентом (Б) и/или дополнительными компонентами (В), (Г), (Д) и т.д., предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, при этом аминоконцевой метионин добавляют к компоненту (А) и/или перед белковой или пептидной последовательностью компонента (Б), (В), (Г) и/или (Д).

Предпочтительно, компонент (А) и компонент (Б) связывают путем химического сочетания любым пригодным методом, известным в данной области, таким как методы перекрестного сшивания. Однако следует обращать внимание на то, что многие известные методы химического перекрестного сшивания являются неспецифическими, т.е. они не направляют точку сшивания в конкретный сайт фрагмента-носителя или карго-фрагмента. Так, неспецифические перекрестносшивающие агенты в случае их использования могут «атаковать» функциональные сайты или стерически блокировать активные сайты, приводя к тому, что слитые компоненты предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, становятся биологически неактивными. Компетенция специалиста в данной области позволяет блокировать потенциальные реакционноспособные группы с помощью соответствующих защитных групп. В альтернативном варианте можно применять эффективные и разнообразные методы лигирования с использованием оксима и гидразона, представляющих собой обладающие химической избирательностью элементы, которые можно применять для перекрестного сшивания компонента (А) с компонентом (Б). Этот метод связывания описан, например, у Rose и др., JACS 116, 1994, с.30. Указанные выше дополнительные компоненты (В), (Г), (Д) и т.д., если они присутствуют, можно подвергать аналогичным методом химическому сочетанию друг с другом или с компонентом (А) и/или (Б).

Специфичность сочетания можно повышать путем непосредственного химического сочетания с функциональной группой, встречающейся только один раз или лишь небольшое количество раз в компоненте (А), функциональная группа которого должна быть перекрестие сшита с органической молекулой компонента (Б). Например, можно использовать тиольную группу цистеина, если только один остаток цистеина присутствует в компоненте (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Также, например, если компонент (А) молекулы-конъюгата не содержит остатков лизина, то перекрестносшивающий реагент, обладающий специфичностью в отношении первичных аминов, будет обладать избирательным действием в отношении аминоконца компонента (А). В альтернативном варианте перекрестное сшивание можно осуществлять также через боковую цепь остатка глутаминовой кислоты, находящегося на N-конце полипептида, в результате чего амидная связь может быть образована через его боковую цепь. Поэтому может оказаться целесообразным связывать остаток глутаминовой кислоты с N-концом компонента (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Однако, если в компонент (А) необходимо встраивать остаток цистеина, то предпочтительно встраивание осуществляют на его N- или С-конце или вблизи него. Можно применять методы, общепринятые для таких изменений аминокислотных последовательностей, основанные на модификациях компонента (А), которые осуществляют либо путем добавления одной или большего количества дополнительных аминокислот, например, среди прочего, остатка цистеина, к обеспечивающей транслокацию (транслоцирующей) последовательности, либо путем замены по меньшей мере одного остатка транслоцирующей(их) последовательности(ей), присутствующего(их) в компоненте (А). В том случае, когда для целей сочетания используют боковую цепь цистеина, компонент (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предпочтительно содержит один остаток цистеина. Предпочтительно следует избегать присутствия какого-либо второго остатка цистеина и, в конце концов, их можно заменять, если они присутствуют в компоненте (А) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Если остаток цистеина заменяют в исходной транслоцирующей последовательности, предназначенной для использования в качестве компонента (А) или его части, то, как правило, желательно минимизировать образующиеся изменения складчатости пептида компонента (А). Изменения складчатости компонента (А) являются минимальными, когда замена является химически и стерически близкой цистеину. Таким образом, в качестве замены цистеина предпочтительно использовать серии.

Сочетание двух составных частей предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, можно осуществлять посредством связующего или конъюгирующего агента с использованием стандартных для синтеза пептидов связующих реагентов, таких как ГOBt, ГБТУ, ДИКДИ, ТБТУ. Существует несколько агентов для межмолекулярного перекрестного сшивания, которые можно использовать, см., например. Means и Feeney, Chemical Modification of Proteins, изд-во Holden-Day, 1974, сс.39-43. К этим реагентам относятся, например, N-сукцинимидил-3-(2-пиридилдитио)пропионат (СПДП) или N,N'-(1,3-фенилен)бисмалеимид; N,N'-этиленбис(йодацетамид) или другой аналогичный реагент, имеющий 6-11 углеродных метиленовых мостиков; и 1,5-дифтор-2,4-динитробензол. К другим перекрестно сшивающим реагентам, пригодным для этой цели, относятся: n,n'-дифтор-м,м'-динитрофенилсульфон; диметиладипимидат; фенол-1,4-дисульфонилхлорид; гексаметилендиизоцианат или диизотиоцианат, или азофенил-ияро-диизоцианат; глутаровый альдегид или дисдиазобензидин. Перекрестносшивающие реагенты могут быть гомобифункциональными, т.е., могут иметь две функциональные группы, участвующие в одной и той же реакции. Предпочтительным гомобифункциональным перекрестносшивающим реагентом является бисмалеимидогексан (БМГ). БМГ содержит две малеимидные функциональные группы, которые специфически взаимодействуют с содержащими сульфгидрил соединениями в мягких условиях (рН 6,5-7,7). Две малеимидные группы соединены углеводородной цепью. Таким образом, БМГ можно применять для необратимого перекрестного сшивания белков (или пептидов), которые содержат остатки цистеина. Перекрестносшивающие реагенты могут быть также гетеробифункциональными. Гетробифункциональные Перекрестносшивающие реагенты имеют две различные функциональные группы, например, реактивную аминогруппу и реактивную тиольную группу, которые перекрестие сшивают два белка, имеющие свободные амины и тиолы соответственно. Примерами гетеробифункциональных перекрестносшивающих агентов являются сукцинимидил-4-(N-малеимидометил)циклогексан-1-карбоксилат (СМЦК), сложный мета-малеимидобензоил-N-гидроксисукцинимидиловый эфир (МБС) и сукцинимид-4-(пара-малеимидофенил)бутират (СМФБ), представляющий собой аналог МБС с удлиненной цепью. Сукцинимидильная группа этих перекрестносшивающих линкеров взаимодействует с первичным амином, и реактивная тиольная группа малеимида образует ковалентную связь с тиольной группой остатка цистеина. Поскольку Перекрестносшивающие реагенты часто обладают слабой растворимостью в воде, к перекрестносшивающему реагенту можно добавлять гидрофильный фрагмент, такой как сульфонатная группа, для повышения растворимости в воде. Сульфо-МБС и сульфо-СМЦК являются примерами перекрестносшивающих реагентов, модифицированных с целью повышения растворимости в воде. Многие Перекрестносшивающие реагенты приводят к образованию конъюгата, который практически не расщепляется в условиях клеточного окружения. Поэтому некоторые Перекрестносшивающие реагенты содержат ковалентную связь, такую как дисульфид, которая расщепляется в условиях клеточного окружения. Например, реагент Траута, дитиобис(сукцинимидилпропионат) (ДСП) и N-сукцинимидил-3-(2-пиридилдитио)пропионат (СПДП) представляют собой широко известные расщепляемые Перекрестносшивающие линкеры. Использование расщепляемого перекрестносшивающего реагента позволяет транспортируемому карго-фрагменту компонента (Б), (В), (Г) или (Д) и т.д. отделяться от компонента А новой транспортирующей конструкции после введения в клетку-мишень. Для этой цели можно применять также прямую дисульфидную связь. Химическое перекрестное сшивание можно осуществлять также с использованием спейсерных плечей. Спейсерные плечи обеспечивают внутримолекулярную гибкость или регулируют внутримолекулярные расстояния между конъюгированными молекулами и тем самым могут помогать сохранять биологическую активность. Спейсерное плечо может представлять собой фрагмент белка (или пептида), который содержит спейсерные аминокислоты, например, пролин. В альтернативном варианте спейсерное плечо может представлять собой часть перекрестносшивающего реагента, такого как «СПДП с длинной цепью» (фирма Pierce Chem. Co., Рокфорд, шт.Иллинойс, каталожный номер 21651 Н). В продаже имеются многочисленные перекрестносшивающие реагенты, включая перечисленные выше. Подробные инструкции по их применению легко можно получить от коммерческих поставщиков. Общие сведения о перекрестном сшивании белков и получении конъюгатов приведены у Wong, Chemistry of Protein Conjugation and Cross-Linking, изд-во CRC Press (1991).

Согласно другому предпочтительному варианту осуществления изобретения указанная выше предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, может содержать или состоять по меньшей мере из одного варианта и/или фрагмента указанных выше предлагаемых в изобретении молекул-конъюгатов, которые являются транспортерами карго-молекул. Предпочтительно варианты и/или фрагменты указанных выше предлагаемых в изобретении молекул-конъюгатов, которые являются транспортерами карго-молекул, сохраняют биологическую активность предлагаемых в изобретении молекул-конъюгатов, которые являются транспортерами карго-молекул, указанных выше. Функциональную активность фрагментов или вариантов можно оценивать с помощью различных анализов, например, по эффективности трансфекции, правильной экспрессии белков, кодируемых карго-молекулами, представляющими собой нуклеиновые кислоты, или с помощью биофизических методов, например, с помощью спектроскопии, компьютерного моделирования, структурного анализа и т.д., аналогичных описанным выше для предлагаемых в изобретении новых конструкций транспортеров общей формулы (I)

Еще более предпочтительно указанные выше предлагаемые в изобретении молекулы-конъюгаты, которые являются транспортерами карго-молекул, содержат или состоят по меньшей мере из одного варианта (и/или фрагмента), прежде всего, если индивидуальные компоненты представляют собой белковые или пептидные последовательности. В контексте настоящего изобретения указанные варианты (и/или фрагменты) могут иметь последовательности, идентичные их нативным последовательностям, например, последовательность фрагмента или варианта указанной выше предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может быть идентична нативной последовательности молекулы-конъюгата, которая является транспортером карго-молекулы, по меньшей мере на 70%, 80% или 85%, предпочтительно по меньшей мере на 90%, более предпочтительно по меньше мере на 95% и наиболее предпочтительно по меньшей мере на 99% по всей длине нативной предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы.

Под «фрагментом» указанной выше предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, прежде всего, если индивидуальные компоненты представляют собой белковые или пептидные последовательности, предпочтительно подразумевается ее укороченная последовательность, т.е. аминокислотная последовательность указанной выше предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, которая на N-конце, С-конце и/или внутри последовательности укорочена по сравнению с аминокислотной последовательностью нативной предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы.

«Вариант» указанной выше предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предпочтительно содержит последовательность, при этом аминокислотная последовательность варианта отличается от нативной последовательности указанной выше предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, одной или несколькими мутацией(ями), такой(ими) как одна или несколько замен (или при необходимости инсерцией и/или делеций) аминокислот.Предпочтительно варианты указанных выше предлагаемых в изобретении молекул-конъюгатов, которые являются транспортерами карго-молекул, обладают такой же биологической функцией или специфической активностью, что и полноразмерная нативная последовательность молекул-конъюгатов, которые являются транспортерами карго-молекул, указанных выше. Предпочтительно вариант может включать примерно 1-50, 1-20, еще более предпочтительно 1-10 и наиболее предпочтительно 1-5, 4, 3, 2 или 1 изменение аминокислот в пределах указанных выше значений. Такие изменения могут включать среди прочего указанные выше модификации аминокислот, интродукцию вышеуказанных меток в аминокислоты, замену аминокислоты любой из (модифицированных или меченых) аминокислот, упомянутых в настоящем описании, делеции или инсерции аминокислот. Варианты, представленные в настоящем описании, предпочтительно содержат также консервативные аминокислотные замены, предпочтительно уже указанные выше.

Третьим объектом настоящего изобретения является фармацевтическая композиция, где фармацевтическая композиция предпочтительно содержит описанную выше предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, и необязательно фармацевтически приемлемый носитель и/или наполнитель или любой эксципиент, буфер, стабилизатор или другие материалы, хорошо известные специалистам в данной области.

В качестве первого ингредиента предлагаемая в изобретении фармацевтическая композиция содержит предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, описанную выше, т.е. предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, которая содержит в качестве компонента (А) предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, и в качестве компонента (Б) эффекторную молекулу, выбранную из белков или пептидов, таких как терапевтические активные белки и пептиды, ингибиторов протеинкиназ, прежде всего ингибиторов протеинкиназы, такой как аминоконцевая киназа c-Jun, или факторов, антигенов, антител, проапоптозных факторов, протеаз, участвующих в патологических состояниях, предпочтительно ингибиторов пептидных протеаз, ВН3-доменов белков «ВН3-только», или выбранную из нуклеиновых кислот, siPHK или из цитотоксических агентов, небольших органических молекул и т.д. Необязательно указанная выше предлагаемая в изобретении молекула-конъюгат, которая является транспортером карго-молекулы, может содержать также дополнительные компоненты (В), (Г) и/или (Д) и т.д.

В качестве второго ингредиента предлагаемая в изобретении фармацевтическая композиция может содержать фармацевтически приемлемый носитель и/или наполнитель или может не содержать их. В контексте настоящего изобретения фармацевтически приемлемый носитель, как правило, представляет собой жидкую или нежидкую основу предлагаемой в изобретении фармацевтической композиции. Если предлагаемая в изобретении фармацевтическая композиция находится в жидкой форме, то носитель, как правило, представляет собой свободную от пирогенов воду; изотонический соляной раствор или забуференные (водные) растворы, например, растворы, забуференные фосфатом, цитратом и т.д. Предпочтительно для инъекции предлагаемой в изобретении фармацевтической композиции можно использовать воду или предпочтительно буфер, более предпочтительно водный буфер, содержащий натриевую соль, предпочтительно по меньшей мере 50 мМ натриевую соль, кальциевую соль, предпочтительно по меньшей мере 0,01 мМ кальциевую соль, и необязательно калиевую соль, предпочтительно по меньшей мере 3 мМ калиевую соль. Согласно предпочтительному варианту осуществления изобретения натриевая, кальциевая и необязательно калиевая соль могут применяться в форме галогенидов, например, хлоридов, йодидов или бромидов, или в форме их гидроксидов, карбонатов, гидрокарбонатов или сульфатов и т.д. Примерами натриевых солей являются (но, не ограничиваясь только ими), например, NaCl, NaI, NaBr, Na2CO3, NaHCO3, Na2SO4, примерами необязательных калиевых солей являются, например, KCl, KI, KBr, К2СО3, KHCO3, K2SO4, и примерами кальциевых солей являются, например, CaCl2, CaI2, CaBr2, СаСО3, CaSO4, Са(ОН)2. Кроме того, в буфер могут входить органические анионы вышеуказанных катионов. Согласно более предпочтительному варианту осуществления изобретения, буфер, пригодный для инъекций, как указано выше, может содержать соли, выбранные из хлорида натрия (NaCl), хлорида кальция (CaCl2) и необязательно хлорида калия (KCl), где помимо хлоридов могут присутствовать дополнительные анионы. CaCl2 можно заменять также на другую соль, например, на KCl. Как правило, соли в предназначенном для инъекции буфере присутствуют в следующей концентрации: по меньшей мере 50 мМ хлорид натрия (NaCl), по меньшей мере 3 мМ хлорид калия (KCl) и по меньшей мере 0,01 мМ хлорид кальция (CaCl2). Предназначенный для инъекции буфер может быть гипертоническим, изотоническим или гипотоническим относительно конкретной референс-среды, т.е. содержание в буфере солей может быть выше, идентичным или ниже их содержания в конкретной референс-среде, при этом предпочтительно можно применять такие концентрации вышеуказанных солей, которые не приводят к повреждению клеток в результате осмоса или других связанных с концентрацией воздействий. Референс-среды могут представлять собой, например, жидкости, применяемые в методах «in viva», такие как кровь, лимфа, цитозольные жидкости или другие жидкости организма, или, например, жидкости, которые можно использовать в качестве референс-сред в методах «in vitro», такие как обычные буферы или жидкости. Указанные обычные буферы или жидкости известны специалисту в данной области. Наиболее предпочтительной жидкой основой является лактированный раствор Рингера.

Однако в предлагаемой в изобретении фармацевтической композиции можно использовать также один или несколько совместимых твердых или жидких наполнителей или разбавителей или капсулирующих соединений, которые можно применять для введения пациенту, подлежащему лечению. Понятие «совместимые» в контексте настоящего описания означает, что составляющие предлагаемой в изобретении фармацевтической композиции можно смешивать с предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, как определено выше, таким образом, чтобы не происходило взаимодействия, которое могло бы существенно снижать фармацевтическую эффективность предлагаемой в изобретении фармацевтической композиции в обычных условиях применения. Фармацевтически приемлемые носители, наполнители и разбавители, естественно, должны иметь достаточно высокую чистоту и достаточно низкую токсичность, чтобы их можно было применять для введения индивидууму, подлежащему лечению. Некоторыми примерами соединений, которые можно применять в качестве фармацевтически приемлемых носителей, наполнителей или составляющих, являются сахара, такие, например, как лактоза, глюкоза и сахароза; крахмалы, такие, например, как кукурузный крахмал или картофельный крахмал; целлюлоза и ее производные, такие, например, как натриевая соль карбоксиметилцеллюлозы, этилцеллюлоза, ацетат целлюлозы; порошкообразный трагакант; солод; желатин; твердый жир; твердые вещества, усиливающие скольжение, такие, например, как стеариновая кислота, стеарат магния; сульфат кальция; растительные масла, такие, например, как арахисовое масло, хлопковое масло, кунжутное масло, оливковое масло, кукурузное масло и какао-масло; полиолы, такие, например, как полипропиленгликоль, глицерин, сорбит, маннит и полиэтиленгликоль; альгиновая кислота

Предлагаемую в изобретении фармацевтическую композицию можно вводить орально, парентерально, с помощью спрея для ингаляции, местно, ректально, назально, трансбуккально, вагинально или с помощью имплантируемого резервуара или с помощью любого другого приемлемого пути введения, известного специалисту в данной области. Понятие «парентеральный» в контексте настоящего описания включает подкожную, внутривенную, внутримышечную, внутрисуставную, интрасиновиальную, надчревную, внутриоболочечную, внутрипеченочную, в пораженный участок, внутричерепную, трансдермальную, внутрикожную, внутрилегочную, внутрибрюшинную, внутрисердечную, внутриартериальную и подъязычную инъекцию или инфузию.

Предпочтительно предлагаемую в изобретении фармацевтическую композицию можно вводить путем парентеральной инъекции, более предпочтительно с помощью подкожной, внутривенной, внутримышечной, внутрисуставной, интрасиновиальной, надчревной, внутриоболочечной, внутрипечечночной, в пораженный участок, внутричерепной, трансдермальной, внутрикожной, внутрилегочной, внутрибрюшинной, внутрисердечной, внутриартериальной и подъязычной инъекции или инфузии. Стерильные инъецируемые формы предлагаемых в изобретении фармацевтических композиций могут представлять собой водные или маслянистые суспензии. Эти суспензии можно приготавливать согласно методам, известным в данной области, с использованием пригодных диспергирующих или смачивающих агентов и суспендирующих агентов. Стерильный инъецируемый препарат может представлять собой также стерильный инъецируемый раствор или суспензию в нетоксичном пригодном для парентерального введения разбавителе или растворителе, например, раствор в 1,3-бутандиоле. В число приемлемых наполнителей и растворителей, которые можно применять, входят вода, раствор Рингера и изотонический раствор хлорида натрия. Кроме того, в качестве растворителя или суспендирующей среды обычно применяют стерильные нелетучие масла. Для этой цели можно применять любое успокаивающее нелетучее масло, включая синтетические моно- или диглицериды. Для приготовления инъецируемых лекарственных средств можно применять жирные кислоты, такие как олеиновая кислота и ее глицериды, а также природные фармацевтически приемлемые масла, такие как оливковое масло или касторовое масло, прежде всего в виде их полиоксиэтилированных производных. Эти масляные растворы или суспензии могут содержать также разбавитель, представляющий собой спирт с длинной цепью, или диспергирующий агент, такой как карбоксиметилцеллюлоза, или аналогичные диспергирующие агенты, обычно применяемые при приготовлении фармацевтически приемлемых форм лекарственного средства, включая эмульсии и суспензии. Для целей приготовления предлагаемой в изобретении фармацевтической композиции можно использовать также другие обычно применяемые поверхностно-активные вещества, такие как агенты типа Твин, Спан, или другие эмульгаторы или вещества, повышающие биологическую доступность, которые обычно применяют при приготовлении фармацевтически приемлемых твердых, жидких или иных форм лекарственного средства.

Для внутривенной, кожной или подкожной инъекции или инъекции в область поражения действующее вещество предпочтительно должно находиться в форме приемлемого для парентерального введения водного раствора, который не содержит пирогены и имеет приемлемые значение рН, изотоничность и стабильность. Специалисты в данной области легко могут приготавливать приемлемые растворы с использованием, например, изотонических наполнителей, таких как хлорид натрия для инъекций, раствор Рингера для инъекций, лактированный раствор Рингера для инъекций. При необходимости можно включать консерванты, стабилизаторы, буферы, антиоксиданты и/или другие добавки. Вне зависимости от того, применяют ли полипептид, пептид ли молекулу нуклеиновой кислоты или любое другое фармацевтически приемлемое соединение, предлагаемое в настоящем изобретении, которое вводят индивидууму, введение предпочтительно осуществляют в «профилактически эффективном количестве» или в «терапевтически эффективном количестве» (в качестве одного из возможных вариантов), которое является достаточным для оказания благоприятного действия на индивидуума. Фактическое вводимое количество, скорость и временные особенности введения должны зависеть от природы и серьезности состояния, подлежащего лечению.

Предлагаемую в изобретении фармацевтическую композицию, как она определена выше, можно вводить также орально в любой приемлемой для орального введения форме лекарственного средства, включая (но, не ограничиваясь ими) капсулы, таблетки, водные суспензии или растворы. В случае таблеток, предназначенных для орального применения, обычно используемые носители представляют собой лактозу и кукурузный крахмал. Как правило, добавляют также замасливатели, такие как стеарат магния. Для орального введения в форме капсул пригодными разбавителями являются лактоза и сухой кукурузный крахмал. Если для орального применения требуются водные суспензии, то действующее вещество, т.е. указанную выше предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, объединяют с эмульгаторами и суспендирующими агентами. При необходимости можно добавлять также определенные подслащивающие вещества, корригенты или красители.

Предлагаемую в изобретении фармацевтическую композицию можно применять также местно, особенно в том случае, когда мишень для лечения включает области или органы, легко доступные для местной обработки, включая лечение заболеваний кожи или любых других доступных эпителиальных тканей. Для каждой из этих областей или органов можно легко приготавливать пригодные препаративные формы для местного применения. Для местных применений можно приготавливать предлагаемую в изобретении фармацевтическую композицию в виде пригодных мазей, содержащих предлагаемую в изобретении иммуностимулирующую композицию, прежде всего ее описанные выше компоненты, суспендированные или растворенные в одном или нескольких носителях. Носители для местного применения включают (но, не ограничиваясь только ими) минеральное масло, вазелиновое масло, белый вазелин, пропиленгликоль, полиоксиэтилен, производное полиоксипропилена, эмульгирующий воск и воду. В альтернативном варианте предлагаемую в изобретении фармацевтическую композицию можно приготавливать в виде пригодного лосьона или крема. В контексте настоящего изобретения пригодные носители включают (но, не ограничиваясь ими) минеральное масло, сорбитанмоностеарат, полисорбат 60, воск на основе сложных цетиловых эфиров, цетеариловый спирт, 2-октилдодеканол, бензиловый спирт и воду.

В этом контексте решение о схеме лечения, например, касательно доз и т.д., находится в компетенции обычных практикующих врачей и других лечащих врачей и, как правило, учитывает нарушение, подлежащее лечению, состояние каждого пациента, место введения и метод введения и другие факторы, известные практикующим.специалистам в данной области. Примеры методов и упомянутых протоколов приведены в справочнике Remington's Pharmaceutical Sciences, 16-oe изд., под ред. Osol A., 1980. Таким образом, предлагаемая в изобретении фармацевтическая композиция, как правило, содержит «безопасное и эффективное количество» компонентов предлагаемой в изобретении фармацевтической композиции, в частности, предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. В контексте настоящего описания «безопасное и эффективное количество» означает количество описанной выше предлагаемой в изобретении молекулы-конъюгата, являющейся транспортером карго-молекулы, которое является достаточным для значительной индукции положительного изменения заболевания или нарушения, представленного в настоящем описании. Однако в то же время «безопасное и эффективное количество» должно являться и достаточно небольшим, чтобы избегать серьезных побочных действий, другими словами, обеспечивать разумную зависимость между преимуществом и риском. Определение этих пределов, как правило, регулируется соответствующими медицинскими правилами. «Безопасное и эффективное количество» компонентов предлагаемой в изобретении фармацевтической композиции, прежде всего предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, описанной выше, должно, таким образом, варьироваться в зависимости от конкретного состояния, подлежащего лечению, а также возраста и физического состояния пациента, подлежащего лечению, веса тела, общего состояния здоровья, пола, диеты, времени введения, скорости экскреции, комбинации лекарственных средств, активности конкретных компонентов (А), (Б), (В), (Г) и/или (Д) и т.д. описанной выше предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, серьезности состояния, продолжительности лечения, особенностей сопутствующей терапии, конкретного применяемого фармацевтически приемлемого носителя и аналогичных факторов, которые известны и находятся в компетенции осуществляющего лечение врача. Предлагаемую в изобретении фармацевтическую композицию можно применять для человека, а также в ветеринарных медицинских целях, предпочтительно в медицинских целях для человека, в качестве фармацевтической композиции в целом или более конкретно в качестве вакцины.

Согласно конкретному варианту осуществления изобретения предлагаемую в изобретении фармацевтическую композицию можно применять в качестве вакцины, например, если компонент (Б) предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, представляет собой терапевтически активный белок, такой как (белковый или пептидный) антиген или антигенный фрагмент или любую молекулу, описанную выше, которая обладает способностью вызывать иммунный ответ. Указанная предлагаемая в изобретении вакцина, как правило, по составу напоминает предлагаемую в изобретении фармацевтическую композицию, и она предпочтительно поддерживает врожденный и/или адаптивный иммунный ответ иммунной системы пациента, подлежащего лечению, в зависимости от природы компонентов (Б), (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, описанной выше. Например, если любые эти компоненты представляют собой или кодируют (полипептидный) антиген или антигенный фрагмент, то вакцина, как правило, должна вызывать адаптивный иммунный ответ у пациента, подлежащего лечению. Аналогично этому, любой из других компонентов (Б), (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, может вызывать врожденный и/или адаптивный иммунный ответ.

Предлагаемая в изобретении вакцина может содержать также фармацевтически приемлемый носитель, адъювант и/или наполнитель, как они определены выше для предлагаемой в изобретении фармацевтической композиции. В конкретном варианте предлагаемой в изобретении вакцины выбор фармацевтически приемлемого носителя определяют в основном в зависимости от пути введения предлагаемой в изобретении вакцины. Предлагаемую в изобретении вакцину можно применять, например, системно или локально. Пути системного введения в целом включают, например, трансдермальный, оральный, парентеральный пути, включая подкожные, внутривенные, внутримышечные, внутриартериальные, внутрикожные и внутрибрюшинные инъекции и/или внутриносовые пути введения. Пути локального применения в целом включают, например, местные пути нанесения, но также и внутрикожные, трансдермальные, подкожные или внутримышечные инъекции или инъекции в область повреждения, внутричерепную, внутрилегочную, внутрисердечную и подъязычную инъекцию. Более предпочтительно вакцины можно применять внутрикожным, подкожным или внутримышечным путем. Таким образом, предлагаемые в изобретении вакцины предпочтительно приготавливатьв форме жидкости или иногда в твердой форме). Пригодное для введения количество предлагаемой в изобретении вакцины можно определять с помощью обычных экспериментов с использованием животных моделей. Такие модели включают (но, не ограничиваясь только ими) модели, созданные с использованием кроликов, овец, мышей, крыс, собак и приматов кроме человека. Предпочтительные формы для инъекций в виде стандартных доз включают стерильные растворы в воде, физиологическом растворе или их смесях. Значение рН указанных растворов следует доводить примерно до 7,4. Приемлемыми носителями для инъекций являются гидрогели, устройства для контролируемого или замедленного высвобождения, полимолочная кислота и коллагеновые матрицы. Пригодными фармацевтически приемлемыми носителями для местного применения являются носители, которые можно применять в виде лосьонов, кремов гелей и т.п. Если предлагаемая в изобретении вакцина предназначена для орального введения, то предпочтительными стандартными формами лекарственного средства являются таблетки, капсулы и т.п. Фармацевтически приемлемые носители, которые можно применять для приготовления стандартных дозируемых форм, предназначенных для орального введения, хорошо известны из существующего уровня техники. При этом выбор должен зависеть от вторичных характеристик, таких как вкус, цена и способность к хранению, которые не имеют решающего значения для целей настоящего изобретения, и его может без труда осуществить специалист в данной области.

Предлагаемая в изобретении вакцина может содержать также одну или несколько вспомогательных субстанций с целью дополнительного повышения ее иммуногенности. При этом предпочтительно достигается синергетическое действие между предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, описанной выше, и вспомогательной субстанцией, которая необязательно может входить в состав предлагаемой в изобретении вакцины, описанной выше. В этом плане в зависимости от различных типов вспомогательных субстанций они могут обладать различными механизмами действия. Например, соединения, которые обеспечивают созревание дендритных клеток (DC), например, липополисахариды, TNF-альфа или CD40-лиганд, образуют первый класс пригодных вспомогательных субстанций. В целом, в качестве вспомогательной субстанции можно применять любой агент, который оказывает воздействие на иммунную систему в виде «сигнала опасности» (LPS, GP96 и т.д.), или цитокины, такие как GM-CFS, которые приводят к тому, что иммунный ответ, продуцируемый стимулирующим иммунную систему адъювантом, предлагаемым в изобретении, повышается, и/или которые оказывают направленное воздействие на иммунный ответ.Особенно предпочтительными вспомогательными субстанциями являются цитокины, такие как монокины, лимфокины, интерлейкины или хемокины, которые также усиливают врожденный иммунный ответ, такие как IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18,IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, INF-альфа, IFN-бета, INF-гамма, GM-CSF, G-CSF, M-CSF, LT-бета или TNF-альфа, факторы роста, такие как hGH.

Другими добавками, которые можно включать в фармацевтическую композицию или в предлагаемую в изобретении вакцину, являются эмульгаторы, такие, например, как Tween®; смачивающие вещества, такие, например, как лаурилсульфат натрия; красители; улучшающие вкус вещества, фармацевтические носители; формирующие таблетки агенты; стабилизаторы; антиоксиданты; консерванты.

Предлагаемая в изобретении вакцина может содержать также любое дополнительное соединение, для которого известно, что оно стимулирует иммунную систему благодаря его аффинности к связыванию (в качестве лигандов) с человеческими Toll-подобными рецепторами TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, или в результате его аффинности к связыванию (в качестве лигандов) с мышиными Toll-подобными рецепторами в TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 или TLR13.

В этом контексте другим классом соединений, которые можно добавлять в предлагаемую в изобретении вакцину, могут являться CpG-нуклеиновые кислоты, в частности CpG-PHK или CpG-ДНК. CpG-PHK или CpG-ДНК могут представлять собой одноцепочечную CpG-ДНК (ss CpG-ДНК), двухцепочечную CpG-ДНК (dsДНК), одноцепочечную CpG-PHK (ss CpG-PHK) или двухцепочечную CpG-PHK (ds CpG-PHK). CpG-нуклеиновая кислота предпочтительно имеет форму CpG-PHK, более предпочтительно форму одноцепочечной CpG-PHK (ss CpG-PHK). CpG-нуклеиновая кислота предпочтительно содержит по меньшей мере одну или несколько (митогенные) динуклеотидную(ые) цитозин/гуаниновую(ые) последовательность(и) (CpG-мотив(ы)). Согласно первому предпочтительному альтернативному варианту по меньшей мере один CpG-мотив, входящий в эти последовательности, т.е. С (цитозин) и G (гуанин) CpG-мотива, является неметилированным. Все другие цитозины или гуанины, необязательно входящие в эти последовательности, могут быть либо метилированными, либо неметилированными. Однако согласно другому предпочтительному альтернативному варианту С (цитозин) и G (гуанин) CpG-мотива могут присутствовать также в метилированной форме.

Согласно четвертому объекту настоящего изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как она определена выше, можно применять (для приготовления фармацевтической композиции или вакцины, предпочтительно обеих, как они определены выше) для профилактики, лечения и/или уменьшения интенсивности любых заболеваний и нарушений, представленных в настоящем описании, предпочтительно для профилактики, лечения и/или уменьшения интенсивности рака или опухолевых заболеваний, включая болезни, связанные с нарушенным апоптозом, воспалительные заболевания, инфекционные болезни, вирусные (инфекционные) болезни, болезни в значительной степени связанные с передачей сигналов JNK, аутоиммунные нарушения или заболевания, сердечнососудистые заболевания, нейронные или нейродегенеративные заболевания, болезни печени, болезни позвоночника, болезни матки, большие депрессивные нарушения, нехронические или хронические заболевания пищеварительной системы, потерю слуха или болезни внутреннего уха. Предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, можно применять также (для приготовления фармацевтической композиции) при трансплантации ткани либо путем обработки органов/ткани/клеток, подлежащих трансплантации, либо путем обработки реципиента органа/ткани/клеток.

Профилактика, лечение и/или уменьшение интенсивности заболевания, указанного в настоящем описании, как правило, включает введение фармацевтической композиции, указанной выше. Понятие «профилактика», как правило, относится к предупреждению заболевания, указанного в настоящем описании, у пациента, предпочтительно до проявления заболевания у пациента. Понятие «лечение» относится, в целом, к любому лечению заболевания, указанного в настоящем описании, у пациента, при этом заболевание может быть уже диагностировано или должно быть предупреждено, т.е. до, параллельно и после проявления заболевания у пациента. Понятие «лечение», используемое, например, в понятии «лечение состояния», кроме того, предпочтительно означает введение по меньшей мере терапевтически эффективного количества терапевтического соединения для получения терапевтического действия. При этом не обязательно подразумевается «исцеление», а скорее подразумевается, что при введении оказывается предпочтительно по меньшей мере некоторое минимальное физиологическое действие на состояние живого организма, имеющего указанное состояние. Например, лечение должно предусматривать введение агента, и присутствие этого агента приводит к изменению физиологии животного-реципиента. И, наконец, понятие «уменьшение интенсивности» предпочтительно включает любую модификацию заболевания, указанного в настоящем описании, предпочтительно положительную модификацию заболевания, указанного в настоящем описании. Конкретная модификация зависит от болезни, подлежащей лечению.

Согласно одному из подходов предлагаемую в изобретении фармацевтическую композицию, вакцину или предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как они определены выше, можно вводить непосредственно пациенту с использованием путей введения, описанных выше для фармацевтических композиций. В альтернативном варианте фармацевтическую композицию, вакцину или предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как они определены выше, можно вводить пациенту, используя подход ex vivo, например, путем интродукции фармацевтической композиции, вакцины или предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, как они определены выше, в клетки, предпочтительно аутологичные клетки, т.е. клетки, полученные из организма пациента, подлежащего лечению, и трансплантации этих клеток в определенную область организма пациента, подлежащего лечению, необязательно после хранения и/или культивирования этих клеток перед лечением.

Согласно одному из предпочтительных вариантов осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности рака или опухолевых заболеваний, включая заболевания, вызываемые нарушением апоптоза, предпочтительно выбранные из группы, включающей невриному слухового нерва, анальную карциному, астроцитому, базалиому, болезнь Бехчета, рак мочевого пузыря, бластомы, рак кости, метастазы в головной мозг, опухоли головного мозга, рак головного мозга (глиобластомы), рак молочной железы (карцинома молочной железы), лимфому Беркитта, карциноиды, рак шейки матки, карциному ободочной кишки, колоректальный рак, карциному тела, краниофарингеомы, CUP-синдром (синдром рака с невыявленным первичным очагом), карциному эндометрия, рак желчного пузыря, опухоли гениталий, включая рак мочеполовой системы, глиобластому, глиомы, опухоли головы/шеи, гепатомы, гистоцитарную лимфому, синдромы или лимфомы Ходжкина и не-ходжкинские лимфомы, опухоль гипофиза, рак кишечника, включая опухоли тонкого кишечника и желудочно-кишечные опухоли, саркому Капоши, рак почки, карциномы почки, рак желудочка гортани или рак гортани, лейкоз, включая острый миелолейкоз (AML), эритролейкоз, острый лимфолейкоз (ALL), хронический миелолейкоз (CML), хронический лимфолейкоз (CLL), опухоль века, рак печени, метастазы в печень, карциномы легкого (=рак легкого=бронхиальная карцинома), мелкоклеточные карциномы легкого и немелкоклеточные карциномы легкого и аденокарциномы легкого, лимфомы, рак лимфатической системы, злокачественные меланомы, относящиеся к молочной железе карциномы (= рак молочной железы), медуллобластомы, меланомы, менингиомы, грибовидный микоз, неопластические заболевания типа невриномы, эзофагеальный рак, эзофагеальную карциному (= эзофагеальный рак), олигодендроглиому, рак яичника (= карцинома яичника), карциному яичника, карциному поджелудочной железы (= рак поджелудочной железы), относящийся к половому члену рак, рак полового члена, фарингеальный рак, опухоль гипофиза, плазмоцитому, рак предстательной железы (= опухоли предстательной железы), ректальную карциному, ректальные опухоли, рак почки, карциномы почки, ретинобластому, саркомы, болезнь Шнеебергера, рак кожи, например, меланомный или не-меланомный рак кожи, включая базальноклеточные и плоскоклеточные карциномы, а также псориаз, пузырчатку обыкновенную, опухоли мягких тканей, спиналому, рак желудка, рак яичек, рак гортани, тимому, карциному щитовидной железы, рак языка, уретральный рак, рак матки, вагинальный рак, различные индуцируемые вирусами опухоли, такие, например, как карцинома, вызываемая вирусом папилломы (например, карцинома шейки матки=рак шейки матки), аденокарциномы, опухоли, вызываемые вирусом герпеса (например, лимфома Беркитта, В-клеточная лимфома, индуцируемая вирусом Эпштейна-Барра (EBV) лимфома), опухоли, индуцируемые вирусом гепатита В (печеночно-клеточная карцинома), лимфомы, вызываемые HTLV-1 и HTLV-2, рак вульвы, связанные с бородавками состояния или патологический процесс и т.д. В контексте настоящего описания понятия «терапия» и «терапевтический» предпочтительно означают по меньшей мере некоторое минимальное физиологическое действие после введения на состояние живого организм, подлежащего лечению. Например, физиологическое действие при введении «терапевтического» противоопухолевого соединения может представлять собой ингибирование роста опухоли или снижение размера опухоли, или предупреждение повторного появления опухоли. Предпочтительно при лечении рака или неопластического заболевания соединение, которое ингибирует рост опухоли или снижает размер опухоли, или предупреждает повторное появление опухоли, должно рассматриваться как терапевтически эффективное. Таким образом, понятие «противоопухолевое лекарственное средство» предпочтительно относится к любому терапевтическому агенту, который обладает терапевтическим действием в отношении опухоли, неопластического заболевания или рака.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности воспалительных болезней, таких как воспалительные заболевания легкого или болезни легкого, включая острый респираторный дистресс-синдром (ARDS) или легочный фиброз, воспаление ткани, включая (но, не ограничиваясь только ими) формирование фиброзной ткани, в том числе муковисцидоз, менингит, и реакции отторжения трансплантата, хронические заболевания дыхательных путей, включая астму, хроническое обструктивное заболевание легких (COPD), пневмонию и легочный фиброз.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности, например, инфекционных болезней, предпочтительно вирусных, ретровирусных, бактериальных или протозойных инфекционных заболеваний. Такие инфекционные болезни, как правило, выбирают из группы, включающей СПИД, сибирскую язву, японский энцефалит, бактериальные инфекционные болезни, такие как выкидыш (воспаление предстательной железы), сибирская язва, аппендицит, боррелиоз, ботулизм, заболевание, вызываемое микроорганизмами Camphylobacter, хламидийная трахома (воспаление уретры, конъюнктивит), холера, дифтерия, донованоз, эпиглоттис, сыпной тиф, газовая гангрена, гонорея, туляремия, заболевание, вызываемое Heliobacter pylori, коклюш, паховый лимфогранулематоз, остеомиелит, болезнь легионеров, ветрянка, остроконечная кондилома, заболевание, вызываемое цитомегаловирусом (CMV), лихорадка Денге, весенне-летний менингоэнцефалит (FSME), заболевание, вызываемое вирусом Эбола, простуды, инфекционная эритема (пятая болезнь), ящур, заболевание, вызываемое вирусом герпеса простого типа I, вирусом герпеса простого типа II, опоясывающий лишай, HSV, инфекционные болезни, вызываемые паразитами, простейшими или грибами, такие как амебиаз, шистамоз, болезнь Шагаса, болезни, вызываемые Echinococcus, дифиллоботриоз, пищевое отравление рыбами (сигуатера), болезни, вызываемые птичьим цепнем, эпидермофия стопы, болезнь, вызываемая собачим солитером (эхинококк), кандидоз, пятнистость, вызываемая дрожжевыми грибками, чесотка, кожный лейшманиоз, лямблиоз (протозойная инфекция, вызываемая Lamblia intestinalis), педикулез, малярия (определяемая по методу микроскопии толстой капли), онхоцеркоз (речная слепота), болезни, вызываемые грибами, бычьим цепнем, шистоматоз, болезнь, вызываемая свиным цепнем, токсоплазмоз, трихомониаз, трипаносомоз (сонная болезнь), индийский висцеральный лейшманиоз, «подгузниковый»/«пеленочный» дерматит, болезнь, вызываемая карликовым цепнем, такие болезни, как инфекционная эритема, грипп, саркома Капоши, лихорадка Лаоса, лейшманиоз, проказа, листериоз, боррелиоз Лайма, малярия, инфекция, вызываемая вирусом Марбург, корь, менингит, включая бактериальный менингит, инфекция, вызываемая вирусом контагиозного моллюска, мононуклеоз, свинка, заболевание, вызываемое Mycoplasma hominis, сепсис новорожденных (хориоамнионит), влажная гангрена, инфекция, вызываемая вирусом Норвалк, паратиф, воспаление среднего уха, железистая лихорадка Пфейффера, натуральная оспа, пневмония, полиомиелит (детская хромота), ложный круп, бешенство, синдром Рейтера, пятнистая лихорадка Скалистых гор, паратиф, вызываемый Salmonella, тиф, вызываемый Salmonella, SARS, скарлатина, опоясывающий герпес, гепатит, натуральная оспа, мягкий шанкр, сифилис, столбняк, трехдневная лихорадка, триппер, японская речная лихорадка, туберкулез, тиф, вагинит (кольпит), вирусные болезни, вызываемые такими вирусами, как цитомегаловирус (CMV), ортопоксвирус оспы, ортопоксвирус белой оспы, овечий паратоксвирус, вирус контагиозного моллюска, вирус герпеса простого 1, вирус герпеса простого 2, вирус герпеса В, вирус ветряной оспы, вирус ложного бешенства, вирус человеческой цитомегалии, человеческий вирус герпеса 6, человеческий вирус герпеса 7, вирус Эпштейна-Барра, человеческий вирус герпеса 8, вирус гепатита В, вирус чикунгунья, вирус O'nyong'nyong, рубивирус, вирус гепатита С, GB-вирус С, вирус Западного Нила, вирус лихорадки Денге, вирус желтой лихорадки, вирус шотландского энцефаломиелита овец (louping-вирус), вирус энцефалита Сент-Луис, вирус японского энцефалита В, вирус Повассан, вирус FSME, SARS, SARS-ассоциированный коронавирус, человеческий коронавирус 229Е, человеческий коронавирус Ос43, торовирус, человеческий Т-клеточный лимфотропный вирус типа I, человеческий Т-клеточный лимфотропный вирус типа II, ВИЧ (СПИД), т.е. человеческий вирус иммунодефицита типа I или человеческий вирус иммунодефицита типа 2, вирус гриппа, вирус лихорадки Ласса, вирус лимфоцитарного лимфоцитарного хориоменингита, вирус комплекса Такарибе, вирус Хурин, вирус Мачупо, вирус болезни Борна, вирус Буньямвера, вирус калифорнийского энцефалита, вирус лихорадки долины Рифт, вирус лихорадки песчаных мух, вирус лихорадки Тоскана, вирус геморрагической лихорадки Крым-Конго, вирус Хазара, вирус Казань, вирус Хантаан, вирус Сеул, вирус Проспект Хилл, вирус Пуумала, вирус Белград-Дубрава, вирус Тула (Tula-вирус), вирус Sin Nombre (вирус без имени), вирус Марбург озера Виктория, вирус Эбола Заира, суданский вирус Эбола, вирус Эбола Берега Слоновой Кости, вирус гриппа А, вирус гриппа В, вирус гриппа С, вирус парагриппа, вирус малярии, вирус Марбург, вирус кори, вирус эпидемического паротита, респираторно-синцитиальный вирус, человеческий метапневмовирус, индийский вирус везикулярного стоматита, вирус бешенства, вирус Мокола, вирус Дувенхаге, европейский лиссавирус летучих мышей 1+2, австралийский вирус летучих мышей, аденовирус A-F, вирусы папилломы человека, вирус кондиломы 6, вирус кондиломы 11, вирусы полиомы, аденоассоциированный вирус 2, ротавирусы или орбивирусы, вирусы оспы, включая вирус ветряной оспы, и вирус малярии, вирусные инфекционные болезни, такие как СПИД, инфекционные болезни, вызываемые Condyloma acuminata, пустотелые бородавки, лихорадка Денге, трехдневная лихорадка, болезнь, вызываемая вирусом Эбола, простуда, весенне-летний менингоэнцефалит (FSME), лихорадка, опоясывающий герпес, гепатит, заболевание, вызываемое вирусом герпеса простого типа I, вирусом герпеса простого типа II, опоясывающий лишай, грипп, японский энцефалит, лихорадка Ласса, болезнь, вызываемая вирусом Марбург, бородавки, лихорадка Западного Нила, желтая лихорадка и т.д.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности болезней, в значительной степени связанных с передачей сигналов JNK у индивидуума. Такие болезни или нарушения, которые у индивидуума в значительной степени связаны с передачей сигналов JNK, предпочтительно выбирают (но, не ограничиваясь только ими) из аутоиммунных нарушений, сердечно-сосудистых болезней, рака или опухолевых заболеваний, указанных выше, диабета, включая диабет типа 1 или типа 2, воспалительных заболеваний, как они определены выше, потери волос, включая гнездную алопецию, болезней легкого, неврологических или нейродегенеративных болезней, болезней печени, болезней позвоночника, болезней матки, (вирусных) инфекционных болезней и депрессивных нарушений. В случае болезней или нарушений, в значительной степени связанных с передачей сигналов JNK, понятие «уменьшение интенсивности» может включать подавление экспрессии JNK при ее сверхэкпрессии, и/или подавление фосфорилирования c-jun, ATF2 или NFAT4 при любом из вышеуказанных заболеваний, например, с помощью по меньшей мере одной ингибирующей JNK последовательности, представленной в настоящем описании, в сочетании с предлагаемой в изобретении новой молекулой-транспортером, как она определена выше, в качестве конкурентного ингибитора встречающегося в естественных условиях сайта связывания c-jun, ATF2 и FAT4 в клетке. В этом конкретном контексте понятие «модулировать» относится также к подавлению гетеро-и гомомерных комплексов факторов транскрипции, таких как (но, не ограничиваясь только ими) c-jun, ATF2 или NFAT4 и родственных партнеров, таких, например, как АР-1-комплекс, включающий c-jun, AFT2 и c-fos. Когда указанное выше заболевание или нарушение, в значительной степени связанное с передачей сигналов JNK, ассоциировано со сверхэкспрессией JNK, такие супрессорные последовательности, ингибирующие JNK, можно интродуцировать в клетку. В некоторых случаях понятие «модулировать» в контексте заболевания или нарушения, в значительной степени связанного с передачей сигналов JNK, может включать также повышение уровня экспрессии JNK, например, при использовании специфического для IB-пептида антитела, которое блокирует связывание IB-пептида с JNK, предупреждая тем самым ингибирование JNK родственным IB пептидом. Предупреждение и/или лечение индивидуума с помощью предлагаемой в изобретении фармацевтической композиции, как она описана выше, можно, как правило, осуществлять путем введения (in vivo) индивидууму фармацевтической композиции в определенном («терапевтически эффективном») количестве, где индивидуум может представлять собой, например, любое млекопитающее, например, человека, примата, мышь, крысу, собаку, кошку, корову, лошадь или свинью. Понятие «терапевтически эффективный» означает, что количество активного компонента фармацевтической композиции является достаточным для облегчения заболевания или нарушения, как они определены выше, которые в значительной степени связаны с передачей сигналов JNK. Для других упомянутых в настоящем описании заболеваний можно привести дополнительные примеры.

Таким образом, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности аутоиммунных нарушений или заболеваний. Аутоиммунные нарушения или заболевания можно в широком смысле подразделять на системные и специфические для органа или локализованные аутоиммунные нарушения в зависимости от принципиальных клинико-патологических особенностей каждого заболевания. Аутоиммунные заболевания можно подразделять на следующие группы в зависимости от категорий системных синдромов, такие как системная красная волчанка (SLE), синдром Шегрена, склеродерма, ревматоидный артрит и полимиозит, или локальные синдромы, которые могут включать эндокринологические заболевания (диабет типа I (сахарный диабет типа 1), тиреоидит Хашимото, болезнь Аддисона и т.д.), дерматологические заболевания (пузырчатка обыкновенная), гематологические заболевания (аутоиммунная гемолитическая анемия), невральные заболевания (рассеянный склероз), или они могут затрагивать фактически любую ограниченную часть ткани организма. Подлежащие лечению аутоиммунные заболевания можно выбирать из группы, включающей аутоиммунные заболевания типа I, аутоиммунные заболевания типа II, аутоиммунные заболевания типа III и аутоиммунные заболевания типа IV, такие, например, как рассеянный склероз (MS), ревматоидный артрит, диабет, диабет типа I (сахарный диабет типа I), хронический полиартрит, базедова болезнь, аутоиммунные формы хронического гепатита, неспецифический язвенный колит, аллергические болезни типа I, аллергические болезни типа II, аллергические болезни типа III, аллергические болезни типа IV, фибромиалгию, потерю волос, болезнь Бехтерева, болезнь Крона, тяжелую перемежающуюся хромоту, нейродермит, полимиалгию ревматическую, прогрессирующий системный склероз (PSS), синдром Рейтера, ревматоидный артрит, псориаз, васкулит и т.д., или диабет типа II. Хотя до настоящего времени остается нерасшифрованным точный механизм, посредством которого иммунная система индуцирует иммунную реакцию на аутоантигены, известен ряд данных, касающихся их этиологии. Так, аутореакция может являться результатом отказа от потребности в Т-клетках («пренебрежение»). В здоровой иммунной системе требуется активация В-клеток Т-клетками перед тем как первые приобретают способность продуцировать антитела в больших количествах. Это требование, касающееся Т-клеток, может «пренебрегаться» в редких случаях, таких как заражение организмами, продуцирующими супер-антигены, которые могут инициировать поликлональную активацию В-клеток или даже Т-клеток, путем непосредственного связывания с β-субъединицей Т-клеточных рецепторов неспецифическим образом. Другим предполагаемым объяснением механизма аутоиммунных заболеваний является молекулярная мимикрия. Экзогенный антиген может обладать структурными сходствами с определенными антигенами хозяина; в результате любое антитело, образующееся к этому антигену (который имитирует аутоантигены), может теоретически связываться также с антигенами хозяина и усиливать иммунный ответ. Наиболее сильная форма молекулярной мимикрии обнаружена в группе А бета-гемолитических стрептококков, антигены которых соответствуют человеческому миокарду и которые ответственны за воздействие на сердце ревматической атаки.

Предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности сердечно-сосудистых заболеваний, предпочтительно выбранных из болезней сердца и коронарных болезней сердца, артериосклероза, апоплексии, дилатации брюшной аорты, таких как связанная с гипертензией аневризма инфраренального отдела аорты, и инфаркта миокарда.

Кроме того, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности неврологических или нейродегенеративных заболеваний, выбранных из группы, включающей (но, не ограничиваясь только ими) болезнь Альцгеймера, болезнь Паркинсона, амиотрофический боковой склероз (ALS), дистонию, эпилепсию, заболевание зрительного нерва, включая глаукому, глазную инфекцию, рассеянный склероз, менингит, неврологические болезни, связанные с нарушениями или заболеваниями, или представляющие собой заболевания или нарушения нервной системы, включая «отрезание» или нарушение аксонов, такие как аксотомия, боль, прежде всего нейропатическая боль, «удар», включая ишемический «удар», и вирусную энцефалопатию.

Предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности болезней печени, выбранных из группы, включающей (но, не ограничиваясь только ими) гепатит и гепатотоксичность.

Кроме того, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности болезней позвоночника, выбранных из группы, включающей (но, не ограничиваясь только ею) грыжу диска.

Согласно одному из предпочтительных вариантов осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности болезней матки, выбранных из группы, включающей (но, не ограничиваясь только им) эндометриоз.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности депрессивных нарушений, выбранных из группы, включающей (но, не ограничиваясь только ими) большие депрессивные нарушения, известные также как большая депрессия, униполярную депрессию, клиническую депрессию, или простую депрессию, биполярные нарушения, манию и маниакальную депрессию.

Согласно другому предпочтительному варианту осуществления изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они определены выше, можно применять (для приготовления медицинского препарата) для профилактики, лечения и/или уменьшения интенсивности нехронических или хронических воспалительных болезней пищеварительной системы у индивидуума. Понятие «нехронические или хронические воспалительные болезни пищеварительной системы» в контексте настоящего описания применяют, как правило, для обозначения нехронических или хронических воспалительных болезней желудочно-кишечного тракта. Они включают болезни пищевода, желудка, первого, второго, третьего и четвертого отдела двенадцатиперстной кишки, тощей кишки, подвздошной кишки, илеоцекального комплекса, толстой кишки (восходящая, поперечная и нисходящая ободочная кишка), сигмовидной ободочной кишки и прямой кишки. Предпочтительными в этом плане являются хронические воспалительные заболевания пищеварительной системы, которые отличаются воспалением ободочной кишки, такие как колит, включая, например, неспецифический язвенный колит (язвенный колит), болезнь Крона, колит отключенной толстой кишки, ишемический колит, инфекционный колит, молниеносный колит, химический колит, микроскопический колит, лимфоцитарный колит, коллагенозный колит, недетерминированный колит и атипический колит и т.д.

В вышеуказанном контексте изобретение относится также к применению предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой в изобретении фармацевтической композиции или предлагаемой в изобретении вакцины для профилактики, лечения и/или уменьшение интенсивности заболеваний или нарушений, упомянутых в настоящем описании. Изобретение относится также, в частности, к применению предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, предлагаемой в изобретении фармацевтической композиции или предлагаемой в изобретении вакцины для инокуляции или к применению этих компонентов в качестве инокулята. Согласно одному из наиболее предпочтительных вариантов осуществления настоящего изобретения указанный способ профилактики, лечения и/или уменьшения интенсивности вышеуказанных заболеваний или нарушений или способ инокуляции для предупреждения вышеуказанных заболеваний, как правило, заключается в том, что вводят описанную выше предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, фармацевтическую композицию или вакцину пациенту, который нуждается в этом (например, страдающему любыми указанными выше болезнями или имеющему их симптомы), в частности, человеку, предпочтительно в «безопасном и эффективном» количестве и в виде одной из указанных выше препаративных форм. Путь введения также может представлять собой путь, описанный выше для предлагаемых в изобретении фармацевтических композиций или вакцин.

Согласно пятому объекту настоящего изобретения предлагаемую в изобретении фармацевтическую композицию, предлагаемую в изобретении вакцину, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как они определены выше, предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, или их варианты или фрагменты, как они определены выше, можно применять в качестве лекарственного препарата. Такой лекарственный препарат может представлять собой фармацевтическую композицию или вакцину, как они описаны выше. Его можно использовать для медицинских целях вообще, предпочтительно для любой из таких целей, как профилактика, лечение и/или уменьшение интенсивности заболеваний или нарушений, упомянутых в настоящем описании.

Согласно шестому объекту настоящего изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, и предпочтительно предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, можно применять для переноса любой карго-молекулы (предпочтительно указанной в настоящем описании) в клетки или ткани пациента, подлежащего лечению. В этом контексте карго-молекула может быть пригодна для терапии, упомянутой в настоящем описании, прежде всего для профилактики, лечения, и/или уменьшения интенсивности заболеваний или нарушений, упомянутых в настоящем описании, и ее можно выбирать из любой пригодной для этого карго-молекулы, более предпочтительно из любой карго-молекулы, описанной выше для любого из компонентов (Б), (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы. Таким образом, предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, можно соединять с такой карго-молекулой, используя любой из методов сочетания, описанных выше для компонентов (А), (Б), (В), (Г) и/или (Д).

Согласно наиболее предпочтительному варианту этого объекта изобретения предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, и более предпочтительно предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, можно применять для переноса любой карго-молекулы, упомянутой в настоящем описании, например, описанной выше для любого из компонентов (Б), (В), (Г) и/или (Д), в клетки, предпочтительно в клетки крови, более предпочтительно в лейкоциты или предпочтительно в нервные клетки. Перенос можно осуществлять in vitro, in vivo и/или ex vivo. Предпочтительно перенос осуществляют в соответствующие клетки пациента, подлежащего лечению. Такое применение предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы и предпочтительно предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, конъюгированной с карго-молекулой, упомянутой выше в настоящем описании, наиболее пригодно для лечения воспалительных заболеваний, указанных выше. Для этой цели предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, и более предпочтительно предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, можно вводить согласно методу, описанному выше для предлагаемой в изобретении фармацевтической композиции или предлагаемой в изобретении вакцины. Кроме того, с использованием предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, и более предпочтительно предлагаемой в изобретении новой конструкции транспортера, соответствующей общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, можно приготавливать предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину, как они описаны выше, для их введения. Пути введения соответствуют описанным выше для предлагаемой в изобретении фармацевтической композиции или предлагаемой в изобретении вакцины. В альтернативном варианте предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, и более предпочтительно предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, можно вводить непосредственно без включения в какую-либо препаративную форму, т.е. в «голом» виде. Пути введения также предпочтительно соответствуют описанным выше для таких препаративных форм.

Согласно седьмому объекту настоящего изобретения предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как она определена выше, или их варианты или фрагменты, как они определены в настоящем описании, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину можно применять для диагностирования в качестве инструмента диагностики, например, в анализах (in vivo или in vitro), например, в иммуноанализах, для выявления, прогнозирования, диагностирования или мониторинга указанных выше различных состояний, заболеваний и/или нарушений.

Например, иммуноанализ можно осуществлять с помощью метода, предусматривающего приведение в контакт образца, полученного из организма пациента, с предлагаемой в изобретении молекулой-конъюгатом, которая является транспортером карго-молекулы, как она определена выше, где компонент (Б) и/или любые из компонентов (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, могут обладать направленным воздействием на компонент или соединение, например специфический (для клетки) компонент или соединение, которые находятся в образце. Указанный компонент (Б) или любые из компонентов (В), (Г) и/или (Д) и т.д. предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, могут представлять собой, например, антитело к специфическому (для клетки) компоненту или соединению, которые находятся в образце, например, к соединению или компоненту, описанному выше для любого из компонентов (Б), (В), (Г) и/или (Д) и т.д., представленных в настоящем описании. Приведение в контакт образца, как правило, осуществляют в условиях, при которых может происходить иммуноспецифическое связывание, с последующим выявлением или оценкой количества любого характеризующегося иммуноспецифическим связыванием антитела. В конкретном варианте осуществления изобретения антитело, специфическое для конкретного (клеточного) компонента или соединения в образце, например, компонента (Б), (В), (Г) и/или (Д) и т.д., представленного в настоящем описании, можно применять для анализа образца ткани или сыворотки из организма пациента в отношении присутствия указанного компонента (Б), (В), (Г) и/или (Д), представленного выше, или ассоциированного с ним заболевания. Такие болезни могут включать заболевания или нарушения, представленные в настоящем описании. Иммуноанализы, которые можно использовать, включают (но, не ограничиваясь ими) конкурентные или неконкурентные системы анализов, основанные на применении таких методик, как вестерн-блоттинг, радиоиммуноанализы (РИА), твердофазный иммуноферментный анализ (ELISA), «сэндвич»-иммуноанализы, анализы на основе иммунопреципитации, реакции с использованием преципитина, реакции, основанные на диффузии преципитина в геле, анализы иммунодиффузиии, анализы агглютинации, флуоресцентные иммуноанализы, анализы фиксации комплемента, иммунорадиометрические анализы и иммуноанализы на белке А и т.д.

В альтернативном варианте можно осуществлять (m vitro) анализы путем введения предлагаемой в изобретении фармацевтической композиции, вакцины или предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы, как они описаны выше, или их вариантов или фрагментов, как они определены в настоящем описании, в клетки-мишени, которые, как правило, выбирают, например, из культивируемых клеток животных, человеческих клеток или микроорганизмов, и оценивая ответ клетки с помощью биофизических методов, как правило, известных специалистам в данной области. Клетки-мишени, которые обычно применяют для этой цели, могут представлять собой культивируемые клетки (in vitro) или клетки in vivo, т.е. клетки, из которых состоят органы или ткани живых животных или людей, или микроорганизмов, присутствующих в живых животных или людях. В этом контексте особенно предпочтительными являются так называемые маркеры или метки, которые могут входить в качестве компонента (Б) или любого из компонентов (В), (Г) и/или (Д) и т.д. в предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, где такие метки могут представлять собой метки, описанные в целом выше для предлагаемой в изобретении молекулы-конъюгата, которая является транспортером карго-молекулы.

И, наконец, последним объектом настоящего изобретения являются также наборы, в частности, состоящие из частей наборы, содержащие в качестве компонентов, индивидуально или в сочетании, предлагаемую в изобретении новую конструкцию транспортера, соответствующую общей формуле (I) или любой из подформул (Ia), (Ib), (Ic), (Id), (Ie) или (If), как они определены выше, предлагаемую в изобретении молекулу-конъюгат, которая является транспортером карго-молекулы, как она определена выше, предлагаемую в изобретении фармацевтическую композицию или предлагаемую в изобретении вакцину и необязательно технические инструкции с информацией об особенностях введении и дозах этих компонентов. Указанные наборы, предпочтительно состоящие из частей наборы, можно применять для многих или любой из вышеуказанных целей или вариантов применения. В настоящем изобретении предложено также применение наборов для диагностических или терапевтических целей, в частности для лечения, предупреждения или мониторинга описанных заболеваний или нарушений.

Объем настоящего изобретения не ограничен приведенными конкретными вариантами его осуществления. Так, различные модификации изобретения помимо представленных в настоящем описании, должны стать очевидными специалистам в данной области после ознакомления с приведенным выше описанием и прилагаемыми чертежами. Такие модификации подпадают под объем прилагаемой формулы изобретения.

Различные публикации, процитированные в настоящем описании, включены в него в качестве ссылки по всей их полноте.

Если не указано иное, то все технические и научные понятия, использованные в настоящем описании, имеют обычные значения, известные обычному специалисту в области, к которой относится настоящее изобретение. Хотя для воплощения на практике или оценки настоящего изобретения можно применять методы и материалы, аналогичные или эквивалентные представленным в настоящем описании, ниже дано описание приемлемых методов и материалов. Все публикации, заявки на патент, патенты и другие упомянутые в настоящем описании документы полностью включены в него в качестве ссылок. В случае расхождения следует опираться на настоящее описание, включая определения. Кроме того, материалы, методы и примеры приведены только с целью иллюстрации и не направлены на ограничение объема изобретения. Другие особенности и преимущества изобретения станут очевидными после ознакомления с приведенным подробным описанием и формулой изобретения.

Описание чертежей

Приведенные ниже чертежи даны с целью дополнительной иллюстрации изобретения. Они не направлены на ограничение объема изобретения.

На чертежах показано:

на фиг.1 - результаты количественного анализа расщепления с помощью протеиназы K, с использованием нескольких конструкций транспортеров с последовательностями поли-Arg, каждая из которых отличается различной схемой D- и L-аминокислот (D-/L-схема). Конструкции транспортеров, применяемые в этом анализе, обозначали номерами с 1- по 6-. Различные D-/L-схемы последовательностей представлены с помощью заглавных и прописных букв. Заглавными буквами в этих последовательностях («K»-аминокислоты) обозначен L-энантиомерный аргинин (L-Arg), а прописными буквами в этих последовательностях («r»-аминокислоты) обозначен D-энантиомерный аргинин (L-Arg). Чувствительность к протеиназе К оценивали во временном интервале t=0, 10 и 40 мин. Затем результаты количественного анализа расщепления с помощью протеиназы К определяли на основе данных для образцов, отобранных в эти конкретные интервалы времени. Эти образцы анализировали с помощью масс-спектрометрии, используя интенсивности ионов исходного продукта в качестве референс-значений. Установлено, что когда фрагмент, состоящий из 3 или большего количества L-Arg, присутствовали в последовательности, то пептид обладал чувствительностью к протеиназе К и расщеплялся. Пептиды с 2 или меньшим количеством L-Arg, следующих друг за другом, не расщеплялись, и эти результаты сопоставимы с полученными для последовательностей, состоящих полностью из D-энантиомерных аминокислот, например D-TAT (SEQ ID NO:251) или D-JNKi соответственно;

на фиг.2 - таблица сравнительных данных для четырех различных конструкций транспортеров, являющихся производными D-/L-TAT (которые обозначены как L-TAT (SEQ ID NO:18), r3-ТАТ (также обозначена как r3-L-Tat;

SEQ ID NO:20), r3-TATi (также обозначена как r3-L-TATi: SEQ ID NO:21) и D-ТАТ; SEQ ID NO:251), каждая из которых состояла из 9 аминокислот, но имела различную D-/L-cxeмy. Различные D-/L-cxeмы последовательностей представлены с помощью заглавных и прописных букв. Заглавными буквами в этих последовательностях («К»-аминокислоты) обозначен L-энантиомерный аргинин (L-Arg), а прописными буквами в этих последовательностях («r»-аминокислоты) обозначен D-энантиомерный аргинин (L-Arg). В таблице, представленной на фиг.2, проиллюстрированы аминокислотные последовательности этих полученных из ТАТ конструкций транспортеров с обозначением их молекулярной массы (MW) и pI-значений;

на фиг.3 - результаты анализа расщепления полученных из ТАТ конструкций транспортеров в 10%- и 50%-ной человеческой сыворотке при 37°С вплоть до полного расщепления этих полученных из ТАТ конструкций транспортеров. Полученные из TAT конструкции транспортеров представляли собой конструкции, описанные на фиг.2, при этом конструкции транспортеров r3-ТАТ (обозначена также как r3-L-Tat; SEQ ID NO:20), r3-TATi (обозначена также как r3-L-TATi; SEQ ID NO:21) дополнительно были защищены на N-конце с помощью бета-аланина. Как видно из фиг.3, конструкции транспортеров D-TAT обладали устойчивостью к протеазе, а конструкция транспортера L-TAT расщеплялась in vivo слишком быстро для того, чтобы осуществлять эффективный транспорт в клетки. Только конструкции транспортеров r3-ТАТ (обозначена также как r3-L-Tat, SEQ ID NO:20), r3-TATi (обозначена также как r3-L-TATi, SEQ ID NO:21) характеризовались расщеплением в приемлемом временном интервале, соответствуя пределу стабильности in vivo, пригодному для терапевтических применений;

на фиг.4- результаты анализа расщепления полученных из ТАТ конструкций транспортеров в 10%- и 50%-ной человеческой сыворотке при 37°С вплоть до полного расщепления этих полученных из ТАТ конструкций транспортеров в условиях включения бета-аланина (b-Ala) для защиты пептидов. Для этой цели бета-Ala добавляли к N-концу полученных из ТАТ конструкций транспортеров L-TAT в виде L-TATi, как уже показано на фиг.3. Как видно из результатов, представленных на фиг.4, N-концевая защита транспортных пептидов бета-аланином не приводила к существенному действию, т.е. повышенной стабильности;

на фиг.5 - результаты, полученные при оценке в зависимости от времени интернализации (поглощения) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров в клетки линии HL-60. Клетки линии HL-60 инкубировали в течение 30 мин, 1, 6 или 24 ч с 10 мкМ полученными из ТАТ транспортерами. Затем клетки отмывали дважды в кислом буфере (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды в ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем определяли относительное количество интернализованного пептида путем считывания интенсивности флуоресценции (планшет-ридер типа Fusion Alpha; фирма PerkinElmer) каждого экстракта с последующим вычитанием фонового уровня и стандартизации относительно содержания белка. Установлено, что конструкция транспортера r3-L-TAT (SEQ ID NO:20) обладала столь же высокой способностью к интернализации, что и конструкция транспортера D-ТАТ. Конструкция транспортера r3-L-TATi (SEQ ID NO:21), интернализация которой зависела от времени, также как и в случае двух указанных выше транспортеров, вероятно, обладала более низкой, но все еще приемлемой эффективностью, в то время как для конструкции L-TAT (SEQ ID NO:18) не обнаружено накопления в течение 24 ч;

на фиг.6 - результаты, полученные при оценке с помощью конфокальной микроскопии клеток, обработанных флуоресцентно меченными полученными из ТАТ конструкциями транспортеров. Диссоциированные кортикальные первичные нейроны из бластомеров крыс Р2 линии Sprague Dawley культивировали в течение 12 дней в нейробазальной среде перед обработкой в течение 24 ч 500 нМ меченными с помощью ФИТЦ полученными из ТАТ транспортерами. Клетки отмывали 5 раз ЗФР на льду и затем заключали в заливочную среду Fluorsave без предварительной фиксации. Обследование осуществляли с помощью метаконфокального микроскопа LSM510 (фирма Zeiss). Изображения обрабатывали с помощью программы LSM510 и представляли с помощью фотошопа Adobe. Визуализация с помощью конфокального микроскопа меченных 500 нМ ФИТЦ транспортеров (А: зеленый). Ядра окрашивали с помощью красителя фирмы Hoechst (Б: голубой). Конструкции транспортеров r3-L-TAT (SEQ ID NO:20), а также D-TAT (SEQ ID NO:251) и r3-L-TATi (SEQ ID NO:21) были интернализованы в цитоплазме не подвергнутых стрессу нейронов (В: панель с наложенными изображениями). Однако после 24-часовой инкубации транспортер L-TAT (SEQ ID NO:18) больше не присутствовал;

на фиг.7 - результаты поглощения (интернализации) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro (10 мкМ, HepG2-гепатокарцинома, НСТ-116-опухоль ободочной кишки, 24 ч). Применяемые конструкции представляли собой различные полученные из ТАТ конструкции транспортеров, которые обозначали как D-TAT (SEQ ID NO:251) и r3-TATi (обозначена также как r3-L-TATi, SEQ ID NO:21), каждая из которых состояла из 9 аминокислот, но отличалась D-/L-cxcmou, изучали также конструкции r6R3 (SEQ ID NO:260) и DAK, эти конструкции дополнительно метили бета-аланином на N-конце. Установлено, что поглощение являлось наиболее эффективным для конструкций D-TAT (SEQ ID NO:251) и r6R3 (SEQ ID NO:260), далее в порядке снижения эффективности следовала конструкция r3-L-TATi (SEQ ID NO:21);

на фиг.8 - результаты поглощения (интернализации) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro (10 мкМ, U937, лимфома, 24 ч). Применяемые конструкции представляли собой 4 различные полученные из ТАТ конструкции транспортеров (которые обозначали как L-ТАТ, SEQ ID NO:18), r3-ТАТ (обозначена также как r3-L-Tat, SEQ ID NO:20), r3-TATi (обозначена также как r3-L-TATi, SEQ ID NO:21) и D-TAT, SEQ ID NO:251), каждая из которых состояла из 9 аминокислот, но отличалась D-yL-схемой. Дополнительно для сравнения и в качестве контрольного образца применяли конструкцию DAK, которая содержала только аминокислоты D, А и K. Установлено, что поглощение клетками конструкций транспортеров r3-ТАТ (SEQ ID NO:20), r3-TATi (SEQ ID NO:21) и D-TAT (SEQ ID NO:251) являлось наиболее эффективным, а для L-TAT (SEQ ID NO:18) обнаружено существенно более низкий уровень поглощения клетками;

на фиг.9 - результаты, свидетельствующие о том, что поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров является HSPG-зависимым при их применении в концентрации 500 нМ в течение 24 ч при использовании клеток лимфомы линии U937. Применяемая в этом эксперименте конструкция представляла собой D-TAT (SEQ ID NO:251), которая состояла из 9 аминокислот, и ее метили с помощью ФИТЦ и на N-конце с помощью бета-аланина;

на фиг.10 - результаты, свидетельствующие о том, что выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров отсутствовал при изучении на клетках линии U937 с использованием 500нМ ФИТЦ-D-TAT. Применяемая в этом эксперименте конструкция представляла собой D-TAT (SEQ ID NO:251), которая состояла из 9 аминокислот, и ее метили с помощью ФИТЦ;

на фиг.11 - результаты, свидетельствующие о том, что выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров имел место при применении 10 мкМ ФИТЦ-D-TAT и являлся HSPG-зависимым (U937, лимфома). Применяемая в этом эксперименте конструкция представляла собой D-TAT (SEQ ID NO:251), которая состояла из 9 аминокислот, и ее метили с помощью ФИТЦ и на N-конце с помощью бета-аланина;

на фиг.12 - результаты, свидетельствующие о том, что поглощение (интернализация) и выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров обнаружены при применении 10 мкМ ФИТЦ-D-TAT и клеток не-WBC-линий (линии клеток, не относящиеся к лейкоцитам). Применяемая в этом эксперименте конструкция представляла собой D-TAT (SEQ ID NO:251), которая состояла из 9 аминокислот, и ее метили с помощью ФИТЦ;

на фиг.13 -результаты экспериментов по интернализации, проведенных с использованием полученных из ТАТ конструкций транспортеров общей формулы (I). Как продемонстрировано на фиг.13, после 24-часовой инкубации все транспортеры с консенсусной последовательностью rXXXrXXXr (SEQ ID NO:252) (см. выше о выборе возможных последовательностей) отличались более высокой способностью к интернализации, чем транспортер L-TAT (SEQ ID NO:18). Клетки линии Hela инкубировали в течение 24 ч в 96-луночном планшете с ЮмМ полученными из r3-L-TAT транспортерами. Затем клетки отмывали дважды кислым буфером (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем определяли относительное количество интернализованного пептида, считывая интенсивность флуоресценции (ридер Fusion Alpha, фирма Perkin Elmer) для каждого экстракта, с последующим вычитанием фонового уровня;

на фиг.14 - результаты экспериментов по интернализации, проведенных с использованием полученных из ТАТ конструкций транспортеров общей формулы (I). Как продемонстрировано на фиг.14, одно из положений, вероятно, играет решающее значение для наиболее высокой активности транспортера и улучшенных кинетических характеристик транспортной активности: Y в положении 2 (пептид №91, соответствующий SEQ ID NO:116). В целом, метод состоял в следующем: клетки линии Hela инкубировали в течение 2, 6 или 24 ч в 24-луночном планшете с возрастающими дозами полученных из r3-L-TAT транспортеров (0, 500 нМ, 1 мМ или ЮмМ). Затем клетки отмывали дважды кислым буфером (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем определяли относительное количество интернализованного пептида, считывая интенсивность флуоресценции (ридер Fusion Alpha, фирма Perkin Elmer) для каждого экстракта, с последующим вычитанием фонового уровня;

на фиг.15 - результаты, полученные с использованием флуоресцентных полученных из ТАТ транспортеров D-TAT (SEQ ID NO:251)-ФИТЦ или r3-L-TAT (SEQ ID NO:20)-ФИТЦ, при использовании в качестве мишеней различных популяций человеческих лейкоцитов;

A: D-TAT (SEQ ID NO:251)-ФИТЦ. Процентное содержание клеток в соответствующих квадрантах (по ходу часовой клетки, начиная с верхнего левого квадранта):

моноциты (CD14) 9,24; 19,37; 31,71; 39,68;
нейтрофилы (CD15) 17,03; 13,87; 21,53; 47,57;
лимфоциты Т (CD3) 22,7; 11,82; 18,01; 47,46;
лимфоциты В (CD19) 32,40; 2,12; 8,26; 57,22.

Б: r3-L-TAT (SEQ ID NO:20)-ФИТЦ. Процентное содержание клеток в соответствующих квадрантах (по ходу часовой клетки, начиная с верхнего левого квадранта):

моноциты (CD14) 6,34; 16,65; 36,24; 40,77;
нейтрофилы (CD15) 11,74; 13.75; 24,76; 49,75;
лимфоциты Т (CD3) 20,64; 8,96; 20,04; 50,36;
лимфоциты В (CD19) 27,83; 1,76; 8,48; 61,92;

на фиг.16 - таблица, в которой приведены средние значения интенсивности флуоресценции для флуоресцентных полученных из ТАТ транспортеров D-TAT (SEQ ID NO:251)-ФИТЦ или r3-L-TAT (SEQ ID NO:20)-ФИТЦ в каждом типе клеток, представленных на фиг.15 (ФИТЦ-канал);

на фиг.17 - данные о поглощении выбранных конструкций транспортеров, предлагаемых в настоящем изобретении, различными типами клеток. Поглощение стандартизовали относительно D-TAT (SEQ ID NO:251). HepG2: клетки гепатокарциномы (человеческие; линия, не относящаяся к лейкоцитам); А549: эпителиальные клетки легкого (человеческие; линия, не относящаяся к лейкоцитам); Raw: клетки-макрофаги (мышиные; клеточная линия лейкоцитов); J77: клетки-макрофаги (мышиные; клеточная линия лейкоцитов); BMDM: макрофаги из костного мозга (мышиные; очищенные первичные лейкоциты). *n=2 независимых эксперимента (с дублированием) (за исключением пептида №64 n=1 с дублированием); **n=2 эксперимента (с дублированием) (за исключением пептида №64 n=1 с дублированием); ***n=1 эксперимент (с дублированием);

на фиг.18 - данные о поглощении выбранных конструкций транспортеров, предлагаемых в настоящем изобретении, различными типами клеток. Поглощение стандартизовали относительно r3-L-TAT (SEQ ID NO:20). HepG2: клетки гепатокарциномы (человеческие; линия, не относящаяся к лейкоцитам); А549: эпителиальные клетки легкого (человеческие; линия, не относящаяся к лейкоцитам); Raw: клетки-макрофаги (мышиные; клеточная линия лейкоцитов); J77: клетки-макрофаги (мышиные; клеточная линия лейкоцитов); BMDM: макрофаги из костного мозга (мышиные; очищенные первичные лейкоциты). *n=2 независимых эксперимента (с дублированием) (за исключением пептида №64 n=1 с дублированием); **n=2 эксперимента (с дублированием) (за исключением пептида №64 n=1 с дублированием); ***n=1 эксперимент (с дублированием).

Примеры

Представленные ниже примеры даны с целью дополнительной иллюстрации изобретения. Они не направлены на ограничение объема изобретения.

Пример 1. Получение (пептидных) конструкций транспортеров

(Пептидные) конструкции транспортеров, применяемые в этих примерах, получали с помощью описанного выше твердофазного синтеза. Конструкции, применяемые для идентификации минимальной D-/L-схемы конструкций транспортеров, которые обладали чувствительностью к протеазам, среди прочего представляли собой следующие конструкции:

SEQ ID No. D-/L-cxeMa Последовательность (от N-конца к С-концу)
123 Полностью L RRRRRRRRR (референс-последовательность)
257 Полностью D rrrrrrrrr
258 D/L rRrRrRrRr
259 DD/LL rrRRrrRRr
260 DDD/LLL (r6R3) rrrRRRrrr
261 DDDD/LLLL rrrRRRRrr

Конструкции, применяемые в экспериментах по поглощению (интернализации) различными клетками и клеточными линиями, представляли собой следующие конструкции:

Название Последовательность (от N-конца к С-концу)
ФИТЦ-βA-D-TAT ФИТЦ-βA-RKKRQRRR
ФИТЦ-βA-D-TAT ФИТЦ-βA-rrrqrrkkr
ФИТЦ-βA-r3-L-ТАТ ФИТЦ-βA-rKKRrQRRr
ФИТЦ-βA-r3-L-TATi ФИТЦ-βA-rRRQrRKKr
ФИТЦ-βA-DAK (ctl) ФИТЦ-βA-DAK (без транспортирующей последовательности)

После синтеза конструкции очищали, хранили в виде ЮмМ раствора в стерильной воде и применяли в качестве очищенных субстанций без какой-либо дополнительной обработки.

Пример 2. Идентификация минимальной D-/L-схемы. обеспечивающей чувствительность к протеазам (протеиназа K)

Для идентификации минимальной D-/L-схемы конструкций транспортеров, чувствительных к протеазам, но обеспечивающих достаточно продолжительно время полужизни in vivo, осуществляли количественный анализ расщепления с использованием протеиназы K, применяя несколько конструкций транспортеров с поли-Arg-последовательностями, каждая из которых отличалась различной схемой D- и L-аминокислот. Конструкции транспортеров, применяемые в этом анализе, получали согласно методу, описанному выше в примере 1, и обозначали как конструкции под номерами от 1 до 6.

SEQ I DNo. Схема Последовательность(от N-конца к С-концу) Чувствительность к протеазам
123 Полностью L RRRRRRRRR (референс-последовательность) +
257 Полностью D rrrrrrrrr -
258 D/L rRrRrRrRr -
259 DD/LL rrRRrrRRr -
260 DDD/LLL (r6R3) rrrRRRrrr +
261 DDDD/LLLL rrrRRRRrr +

Различная схема последовательностей описана с использованием заглавных и прописных букв. Заглавными буквами в этих последовательностях с 1 по 6 («К»-аминокислоты) обозначен L-энантиомерный аргинин (L-Arg), a прописными буквами в этих последовательностях («r»-аминокислоты) обозначен D-энантиомерный аргинин (D-Arg). Чувствительность к протеиназе К оценивали в моменты времени t=0, 10 и 40 мин. Затем результаты количественного анализа расщепления с помощью протеиназы К определяли на основе данных для образцов, отобранных в эти конкретные моменты времени. Эти образцы анализировали с помощью масс-спектрометрии, используя интенсивности ионов исходного продукта в качестве референс-значений. Установлено, что когда в последовательности присутствовал фрагмент, состоящий из 3 или большего количества L-Arg, то пептид обладал чувствительностью к протеиназе К и расщеплялся. Пептиды с 2 или меньшим количеством L-Arg, следующих друг за другом, не расщеплялись. Эти результаты сопоставимы с полученными для последовательностей, состоящих полностью из D-энантиомерных аминокислот, например D-TAT (rrrqrrkkr; SEQ ID NO:251) или D-JNKi соответственно (см. также фиг.1).

Осуществляли дополнительное сравнение, используя 4 конструкции транспортеров, полученные из D-/L-TAT, обозначенные как L-TAT (SEQ ID NO:18), r3-ТАТ (обозначена также как r3-L-Tat; SEQ ID NO:20) r3-TATi (обозначена также как гз-L-TATi; SEQ ID NO:21) и D-TAT (SEQ ID NO:251), каждая из которых состояла из 9 аминокислот, но имела отличную от других D-/L-схему. Различная схема последовательностей описана с использованием заглавных и прописных букв. Заглавными буквами в этих последовательностях с 1 по 6 («R»-аминокислоты) обозначен L-энантиомерный аргинин (L-Arg), а прописными буквами в этих последовательностях («r»-аминокислоты) обозначен D-энантиомерный аргинин (D-Arg). На фиг.2 проиллюстрированы аминокислотные последовательности этих полученных из ТАТ конструкций транспортеров с обозначением их молекулярной массы (MW) и pI-значений (см. фиг.2).

Расщепление осуществляли с использованием 10%- и 50%-ной человеческой сыворотки при 37°С до полного расщепления этих полученных из ТАТ конструкций транспортеров. Как видно из фиг.3, на которой представлены результаты расщепления полученных из ТАТ конструкций транспортеров, конструкции транспортеров D-TAT (SEQ ID NO:251) обладали устойчивостью к протеазе, а конструкция транспортера L-TAT (SEQ ID NO:18) расщеплялась in vivo слишком быстро для того, чтобы осуществлять эффективный транспорт в клетки. Только конструкции транспортеров r3-ТАТ (обозначена также как r3-L-Tat, SEQ ID NO:20), r3-TATi (обозначена также как r3-L-TATi, SEQ ID NO:21) характеризовались расщеплением в приемлемом временном интервале, соответствуя пределу стабильности in vivo, пригодному для терапевтических применений.

Осуществляли масс-спектрометрический анализ расщепления конструкции транспортера r3-L-TAT в человеческой сыворотке. Установлено, что r3-L-TAT (SEQ ID NO:20) в человеческой в человеческой сыворотке расщеплялась на С-конце до образования отдельных аминокислот.

Кроме того, осуществляли расщепление полученных из ТАТ конструкций транспортеров в 10%- и 50%-ной человеческой сыворотке при 37°С до полного расщепления этих полученных из ТАТ транспортеров в условиях включения бета-аланина (b-Ala) для защиты пептидов. Для этой цели бета-Ala добавляли к N-концу полученных из ТАТ конструкций транспортеров L-TAT в виде L-TATi, как уже показано на фиг.3. Результаты представлены на фиг.4. Как проиллюстрировано на фиг.4, N-концевая защита транспортных пептидов бета-аланином не оказывала существенного воздействия, т.е. не повышала стабильность.

Обобщая приведенные выше результаты касательно их стабильности in vivo и функционального времени полужизни стабильности 4 полученных из ТАТ пептидов, протестированных в 10%- и 50%-ной ЧС (человеческая сыворотка), установлен следующий порядок: D-TAT (SEQ ID NO:251)>r3-L-TATi (SEQ ID NO:21)>r3-L-TAT (SEQ ID NO:20)>L-TAT (SEQ ID NO:18). Таким образом. время полужизни как r3-L-TAT (SEQ ID NO:20), так и r3-L-TATi (SEQ ID NO:21) оказалось повышенным по сравнению с L-TAT (SEQ ID NO:18) и пониженным по сравнению с D-TAT (SEQ ID NO:251). Поскольку на долю сыворотки приходится ~50% объема крови, данные, полученные с использованием образцов, содержащих 50% ЧС, являлись наиболее значимыми. Результаты UPLC (сверхпроизводительная жидкостная хроматография)-МС позволили также предположить, что в расщеплении участвуют экзопротеазы, которые осуществляют расщепление на С-конце ТАТ. Карбоксипептидаза N (CPN), вероятно, участвует в расщеплении, поскольку она обладает коститутивной активностью и присутствует в высокой концентрации (30 мкг/мл) в крови. Кроме того, CPN специфически отщепляет С-концевой Lys или Arg от пептидов или белков.

Пример 3. Поглощение (интернализация) пептидов в клетки и оценка интернализации пептидов в клетки

В этом эксперименте способность к интернализации (поглощению) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro оценивали с помощью флуоресцентного планшет-ридера на клетках линии HL-60 (лейкоз).

3.1. Применяемые в экспериментах тест-образцы

Применяемые в этом эксперименте конструкции представляли собой 4 различные полученные из ТАТ конструкции транспортеров (обозначены как L-ТАТ (SEQ ID NO:18), r3-ТАТ (обозначена также как r3-L-Tat; SEQ ID NO:20), r3-TATi (обозначена также как r3-L-TATi; SEQ ID NO:21) и D-TAT (SEQ ID NO:251), каждую из которых получали согласно описанному выше методу. Эти конструкции состояли из 9 аминокислот, но имели различную D-/L-схему. Кроме того, в качестве контроля использовали конструкцию DAK, которая не включала транспортной последовательности. Конструкции защищали на N-конце бета-аланином (βА) и метили с помощью ФИТЦ.

ФИТЦ-βA-L-TAT ФИТЦ-βA-RKKRQRRR
ФИТЦ-βA-D-TAT ФИТЦ-βA-rrrqrrkkr
ФИТЦ-βA-r3-L-TAT ФИТЦ-βA-rKKRrQRRr
ФИТЦ-βA-r3-L-TATi ФИТЦ-βA-rRRQrRKKr
ФИТЦ-βA-DAK (ctl) ФИТЦ-βA-DAK (без транспортной последовательности)

Конструкции получали согласно описанному выше методу, очищали, хранили в виде 10 мМ раствора в стерильной воде и использовали в чистом виде без дополнительной обработки.

3.2. Дополнительные конструкции транспортеров TAT(s2-1)- TAT(s2-96) Дополнительные конструкции транспортеров TAT(s2-1)- TAT(s2-96) получали согласно методу, в целом описанному выше для предлагаемых в изобретении конструкций транспортеров. Для этой цели для синтеза применяли следующие последовательности и защитные группы (связанные со смолой):

TATs2-1: D-Arg(Pmc)-Ala-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-2: D-Arg(Pmc)-Lys(Boc)-Ala-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-3: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Ala-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-4: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Ala-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-5: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Ala-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-6: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Ala-D-Arg(Pmc)-смола
TATs2-7: D-Arg(Pmc)-Asp(OBut)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-8: D-Arg(Pmc)-Lys(Boc)-Asp(OBut)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-9: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Asp(OBut)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-10: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Asp(OBut)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-11: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Asp(OBut)-Arg(Pmc)-D-Arg(Pmc)- TATs2-CMona
TATs2-12: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Asp(OBut)-D-Arg(Pmc)- TATs2-CMona
TATs2-13: D-Arg(Pmc)-Glu(OBut)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-14: D-Arg(Pmc)-Lys(Boc)-Glu(OBut)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-15: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Glu(OBut)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-16: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Glu(OBut)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-17: D-Arg(P[nc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Glu(OBut)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-18: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Glu(OBut)-D-Arg(Pmc)-смола
TATs2-19: D-Arg(Pmc)-Phe-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-20: D-Arg(Pmc)-Lys(Boc)-Phe-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-21: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Phe-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-22: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Phe-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-23: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Phe-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-24: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Phe-D-Arg(Pmc)-смола
TATs2-25: D-Arg(Pmc)-Arg(Pmc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-26: D-Arg(Pmc)-Lys(Boc)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-27: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Lys(Boc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-28: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Arg(Pmc)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-29: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-30: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Lys(Boc)-D-Arg(Pmc)-смола
TATs2-31: D-Arg(Pmc)-His(Trt)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-32: D-Arg(Pmc)-Lys(Boc)-His(Trt)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-33: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-His(Trt)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-34: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)His(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-35: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-His(Trt)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-36: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-His(Trt)-D-Arg(Pmc)-смола
TATs2-37: D-Arg(Pmc)-Ile-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-38: D-Arg(Pmc)-Lys(Boc)-Ile-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-39: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Ile-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-40: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Ile-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-41: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Ile-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-42: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-]le-D-Arg(Pmc)-смола
TATs2-43: D-Arg(Pmc)-Leu-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-44: D-Arg(Pmc)-Lys(Boc)-Leu-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-45: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Leu-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-46: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Leu-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-47: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Leu-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-48: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Leu-D-Arg(Pmc)-смола
TATs2-49: D-Arg(Pmc)-Met-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-50: D-Arg(Pmc)-Lys(Boc)-Met-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-51: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Met-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-52: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Met-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-53: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Met-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-54: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Met-D-Arg(Pmc)-смола
TATs2-55: D-Arg(Pmc)-Asn(Trt)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-56: D-Arg(Pmc)-Lys(Boc)-Asn(Trt)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-57: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Asn(Trt)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-58: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Asn(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-59: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Asn(Trt)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-60: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Asn(Trt)-D-Arg, (Pmc)-смола
TATs2-61: D-Arg(Pmc)-Gln(Trt)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-62: D-Arg(Pmc)-Lys(Boc)-Gln(Trt)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-63: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Gln(Trt)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-64: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Lys(Boc)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-65: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Gln(Trt)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-66: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Gln(Trt)-D-Arg(Pmc)-смола
TATs2-67: D-Arg(Pmc)-Ser(But)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-68: D-Arg(Pmc)-Lys(Boc)-Ser(But)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-69: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Ser(But)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-70: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Ser(But)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-71: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Ser(But)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-72: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Ser(But)-D-Arg(Pmc)-смола
TATs2-73: D-Arg(Pmc)-Thr(But)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-74: D-Arg(Pmc)-Lys(Boc)-Thr(But)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-75: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Thr(But)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-76: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Thr(But)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-77: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Thr(But)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-78: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Thr(But)-D-Arg(Pmc)-смола
TATs2-79: D-Arg(Pmc)-Val-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-80: D-Arg(Pmc)-Lys(Boc)-Val-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-81: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Val-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-82: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Val-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-83: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Val-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-84: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Val-D-Arg(Pmc)-смола
TATs2-85: D-Arg(Pmc)-Trp(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-86: D-Arg(Pmc)-Lys(Boc)-Trp(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-87: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Trp(Boc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-88: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Trp(Boc)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-89: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Trp(Boc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-90: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Trp(Boc)-D-Arg(Pmc)-смола
TATs2-91: D-Arg(Pmc)-Tyr(But)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-92: D-Arg(Pmc)-Lys(Boc)-Tyr(But)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-93: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Tyr(But)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-94: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)Tyr(But)-Arg(Pmc)-Arg(Pmc)-D-Arg(Pmc)-cMona
TATs2-95: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Tyr(But)-Arg(Pmc)-D-Arg(Pmc)-смола
TATs2-96: D-Arg(Pmc)-Lys(Boc)-Lys(Boc)-Arg(Pmc)-D-Arg(Pmc)-Gln(Trt)-Arg(Pmc)-Tyr(But)-D-Arg(Pmc)-смола

3.3 Материалы и методы, применяемые при проведении экспериментов по анализу поглощения

а) Клеточная линия:

Применяемая в этом эксперименте клеточная линия представляла собой HL-60 (RefCCL-240, ATCC, лот 116523)

б) Культуральная среда и планшеты

Среда RPMI (Ref 21875-091, фирма Invitrogen, лот 8296) или DMEM (Ref 41965, фирма Invitrogen, лот 13481), дополненная 05.05.2008 г. следующими компонентами:

10% FBS (RefA64906-0098, фирма РАА, лот А15-151):

декомплементированная при 56°С, 30 мин 04.04.2008 г.;

1 мМ пируват натрия (RefS8636, фирма Sigma, лот 56К2386);

пенициллин (100 ед./мл)/стрептомицин (100 мкг/мл) (RefP4333, фирма Sigma, лот 106К2321).

ЗФР 10× (Ref 70011, фирма Invitrogen, лот 8277): разведенный до 1× стерильной H2O.

Трипсин-0.05% ЭДТК (Ref L-11660, фирма РАА, лот L66007-1194).

6-луночные культуральные планшеты (Ref 140675, фирма Nunc, лот 102613),

24-луночные культуральные планшеты (Ref 142475, фирма Nunc, лот 095849),

96-луночные культуральные планшеты (Ref 167008, фирма Nunc, лот 083310),

96 -луночные планшеты для дозирования белков (Ref 82.1581, фирма Sarstedt)

96-лучночные планшеты для оценки флуоресценции (Ref 6005279, фирма Perkin Elmer).

в) Растворы

Поли-D-лизиновый раствор для сенсибилизации (нанесения покрытия) (фирма Sigma P9011, лот 095К5104): 25 мкг/мл конечное разведение в ЗФР 1×.

Кислый буфер для отмывки: 0,2М глицин, 0,15М NaCl, pH 3.0.

Буфер для лизиса Ripa: ЮмМ NaH2P04 pH 7,2, 150 мМ NaCl, 1% Тритон X-100, 1 мМ ЭДТК pH 8,0, 200 мкМ Na3VO2, 0,1% ДСН, 1× коктейль ингибиторов протеаз (Ref 11873580001, фирма Roche, лот 13732700).

г) Микроскопия и анализ с помощью флуоресцентного планшет-ридера

Выявление и подсчет клеток осуществляли с помощью инвертированного микроскопа (Axiovert 40 CFL; фирма Zeiss; 20×).

Флуоресценцию определяли с помощью планшет-ридера Fusion Alpha (фирма Perkin Elmer).

д) Метод

Интернализацию меченного с помощью ФИТЦ пептида изучали на суспензионной культуре клеток. Клетки высевали в покрытые поли-DL-лизином планшеты в концентрации 1×106 клеток/мл. Затем планшеты инкубировали в течение 24 ч при 37°С, 5% СО2 и 100% относительной влажности перед добавлением пептида в известной концентрации. После добавления пептида клетки инкубировали в течение 30 мин, 1, 6 или 24 ч при 37°С, 5% СО2 и 100% относительной влажности. Затем клетки отмывали дважды кислым буфером (глицин 0,2М, NaCl 0,15М, pH 3,0) для удаления адсорбированного на клеточной поверхности пептида (см. Kameyama и др., Biopolymers, 88, 2007, сс.98-107). Применяли кислый буфер поскольку пептиды, богатые основными аминокислотами сильно адсорбировались на поверхности клеток, что часто приводило к завышенной оценке количества интернализованого пептида. Таким образом, для удаления адсорбированных на поверхности клеток пептидов применяли отмывку клеток кислым буфером. При определении поглощения клетками проникающих в клетку пептидных конъюгатов Fab осуществляли кислотную отмывку с последующими двумя отмывками с помощью ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Относительное количество интернализованного пептида затем определяли на основе флуоресценции после вычитания фонового уровня и стандартизации относительно содержания белка.

Таким образом, осуществляли следующие стадии:

1. культивирование клеток;

2. кислотная отмывка и экстрагирование клеток;

3. анализ интернализации пептидов с помощью флуоресцентного планшет-ридера.

е) Культивирование клеток и обработка пептидами

(1) 6-лучночные культуральные планшеты сенсибилизировали 3 мл поли-D-Lys (фирма Sigma P9011; 25 мкг/мл в ЗФР), 24 - луночные - 600 мкл, а 96-луночные планшеты - 125 мкл и инкубировали в течение 4 ч при 37°С, СО2 5% и 100% относительной влажности.

(2) Через 4 ч планшеты дважды отмывали 3,5 мл ЗФР, 700 мкл или 150 мкл ЗФР в случае 6-, 24- или 96-луночных планшетов соответственно.

(3) Клетки высевали в планшеты в 2,4 мл среды (RPMI) с плотностью 1000000 клеток/мл для получения суспензии клеток. После инокуляции планшеты инкубировали при 37°С, 5% CO2 и 100% относительной влажности в течение 24 ч перед добавлением пептида. Прикрепленные (прилипшие) клетки, плотность которых должна составлять 90-95% в день обработки, высевали в DMEM:

Лунки Поверхность культуры (см2) Среда Количество прикрепившихся клеток Количество клеток в суспензии
96 лунок 0,3 100-200 мкл 8000-30000 100000
24 лунок 2 500-1000 мкл 100000-200000 500000-1000000
Лунки Поверхность культуры (см2) Среда Количество прикрепившихся клеток Количество клеток в суспензии
35 мм (Р35)/6 лунок 10 2,4 мл 250000-2100000 2400000
60 мм (Р60) 20 3,5 мл 15×105 1000000/мл
Юсм(РЮО) 60 10 мл 15-60×105

4) Клетки обрабатывали (маточный раствор с концентрацией 10 мМ в Н2О).

(5) После меченным с помощью ФИТЦ пептидом в требуемой концентрации добавления пептида клетки инкубировали в течение 0-24 ч (например, 30 мин, 1, 6 или 24 ч) при 37°С, СОз 5% и 100% относительной влажности.

Кислотная отмывка и получение клеточных экстрактов:

(6) Экстракты охлаждали на льду.

Суспензионные клетки (или клетки, не прикрепившиеся к планшету):

- Переносили клетки в «Falcon 15 мл». Для получения максимального количества клеток отмывали планшет 1 мл ЗФР.

- Собирали клетки в течение 2 мин максимум при 2400 об/мин.

- Суспендировали клетки в 1 мл холодного ЗФР.

- Переносили клетки в сенсибилизированную «пробирку Эппендорфа» (покрытую 1 мл поли-D-Lys, на 4 ч и отмывают дважды 1 мл ЗФР).

- Отмывали трижды 1 мл холодного кислого буфера и центрифугировали в течение 2 мин максимум при 2400 об/мин. Применяли меры предосторожности для предупреждения распространения клеток в «пробирке Эппендорфа».

- Отмывали дважды 1 мл холодного ЗФР для нейтрализации.

- Добавляли 50 мкл буфера для лизиса RIPA.

- Инкубировали в течение 30 мин-1 ч на льду при перемешивании.

Прикрепленные (прилипшие) клетки:

- Отмывали трижды, используя по 3 мл, 1 мл или 200 мкл (для 6-, 24- или 96-луночных планшетов соответственно) холодного кислого буфера для отмывки. Применяли меры предосторожности для предупреждения отлипания клеток от планшета.

- Отмывали дважды 1 мл холодного ЗФР (для 6-, 24- или 96-луночных планшетов соответственно) для нейтрализации.

- Добавляли 50 мкл буфера для лизиса RIPA.

- Инкубировали в течение 30 мин-1 ч на льду при перемешивании.

- Отскабливали клетки с помощью холодного лезвия. 24- и 96-луночные планшеты непосредственно центрифугировали при 4000 об/мин при 4°С в течение 15 мин для удаления клеточного дебриса. Затем супернатанты (100 или 50 мл соответственно для 24- или 96-луночных планшетов) непосредственно переносили в темные 96-луночные планшеты. Планшеты считывали с помощью флуоресцентного планшет-ридера (Fusion Alpha, фирма Perkin Elmer).

- Переносили лизат в сенсилизированную «пробирку Эппендорфа» (покрытую 1 мл поли-D-Lys на 4 ч и отмывали дважды 1 мл ЗФР).

- Затем лизированные клетки центрифугировали в течение 30 мин при 10000 g при 4°С для удаления клеточного дебриса.

- Удаляли супернатант и хранили при -80°С в сенсибилизированной «пробирке Эппендорфа» (покрытой 1 мл поли-D-Lys в течение 4 ч и отмывали дважды 1 мл ЗФР).

Анализ интернализации пептидов с помощью флуоресцентного планшет-ридера:

(7) Содержание белка в каждом белковом экстракте определяли с помощью стандартного ВСА-анализа (набор №23225, фирма Pierce) согласно инструкциям производителя.

(8) Определяли относительную флуоресценцию каждого образца после считывания 10 мкл каждого образца с помощью флуоресцентного планшет-ридера (Fusion Alpha, фирма Perkin Elmer), вычитали фоновый уровень и стандартизовали относительно концентрации белка.

3.4. Эксперименты по интернализации и анализ полученных результатов

Зависящую от времени интернализацию (поглощение) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров в клетки клеточной линии HL-60 осуществляли с использованием указанных выше материалов и методов.

В целом, метод состоял в следующем: HL-60-клетки инкубировали в течение 30 мин, 1, 6 или 24 ч с 10 мкМ полученными из ТАТ транспортерами. Затем клетки отмывали дважды кислым буфером (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем относительное количество интернализованного пептида определяли, считывая интенсивность флуоресценции (рйдер Fusion Alpha, фирма Perkin Elmer) для каждого экстракта с последующим вычитанием фонового уровня и стандартизации относительно содержания белка. Для конструкции транспортера r3-L-TAT обнаружена способность к интернализации такая же по эффективности, что и для конструкции транспортера D-TAT. Конструкция транспортера r3-L-TATi, интернализация которой зависела от времени, также как и в случае двух указанных выше транспортеров, вероятно, обладала более низкой, но все еще приемлемой эффективностью, в то время как для конструкции L-TAT не обнаружено накопления в течение 24 ч (см. фиг.5).

Кроме того, осуществляли исследование клеток, обработанных флуоресцентно меченными полученными из ТАТ конструкциями транспортеров, с помощью конфокального микроскопа согласно описанному выше методу. Диссоциированные кортикальные первичные нейроны из бластомеров Р2 крыс линии Sprague Dawley культивировали в течение 12 дней в нейробазальной среде перед обработкой в течение 24 ч 500 нМ меченными с помощью ФИТЦ полученными из ТАТ транспортерами. Клетки отмывали 5 раз ЗФР на льду и затем заключали в заливочную среду Fluorsave без предварительной фиксации. Обследование осуществляли с помощью метаконфокального микроскопа LSM510 (фирма Zeiss). Изображения обрабатывали с помощью программы LSM510 и представляли с помощью фотошопа Adobe. Визуализацию меченных 500нМ ФИТЦ транспортеров (А: зеленый) осуществляли с помощью конфокального микроскопа. Ядра окрашивали с помощью красителя фирмы Hoechst (Б: голубой). Конструкции транспортеров r3-L-TAT, а также D-TAT и r3-L-TATi были интернализованы в цитоплазме не подвергнутых стрессу нейронов (В: наложенная панель). Однако после 24-часовой инкубации транспортер L-ТАТ больше не присутствовал (см. фиг.6).

3.5 Дополнительные эксперименты по интернализации и их анализ

Зависящую от времени интернализацию (поглощение) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров в клетки клеточной линии HL-60 осуществляли также с использованием указанных выше материалов и методов, применяя последовательности 96 меченных с помощью ФИТЦ транспортеров-производных D-ТАТ. Эти последовательности перечислены ниже в таблице 6.

Таблица 6
SEQ IDN O: Пептид No: сокращение, указанное на фиг.13 и фиг.14
20 r3-L-TAT H2N dR K K R dR Q R R dR CONH2
26 1 H2N dR A K R dR Q R R dR CONH2
27 2 H2N dR K А R dR Q R R dR CONH2
28 3 H2N dR K K А dR Q R R dR CONH2
29 4 H2N dR K K R dR А R R dR CONH2
30 5 H2N dR K K R dR Q А R dR CONH2
31 6 H2N dR K K R dR Q R А dR CONH2
32 7 H2N dR D K R dR Q R R dR CONH2
33 8 H2N dR K D R dR Q R R dR CONH2
34 9 H2N dR K K D dR Q R R dR CONH2
35 10 H2N dR K K R dR D R R dR CONH2
36 11 H2N dR K K R dR Q D R dR CONH2
37 12 H2N dR K K R dR Q R D dR CONH2
38 13 H2N dR Е K R dR Q R R dR CONH2
39 14 H2N dR K Е R dR Q R R dR CONH2
40 15 H2N dR K K Е dR Q R R dR CONH2
41 16 H2N dR K K R dR Е R R dR CONH2
42 17 H2N dR K K R dR Q Е R dR CONH2
43 18 H2N dR K K R dR Q R Е dR CONH2
44 19 H2N dR F K R dR Q R R dR CONH2
45 20 H2N dR K F R dR Q R R dR CONH2
46 21 H2N dR K K F dR Q R R dR CONH2
47 22 H2N dR K K R dR F R R dR CONH2
SEQ ID NO: Пептид No: сокращение, указанное на фиг.13 и фиг.14
48 23 H2N dR K K R dR Q F R dR CONH2
49 24 HzN dR K K R dR Q R F dR CONH2
50 25 HzN dR R K R dR Q R R dR CONH2
51 26 H2N dR K R R dR Q R R dR CONH2
52 27 H2N dR K K K dR Q R R dR CONH2
53 28 H2N dR K K R dR R R R dR CONH2
54 29 H2N dR K K R dR Q K R dR CONH2
55 30 H2N dR K K R dR Q R K dR CONH2
56 31 H2N dR н K R dR Q R R dR CONH2
57 32 H2N dR K Н R dR Q R R dR CONH2
58 33 H2N dR K K Н dR Q R R dR CONH2
59 34 HzN dR K K R dR н R R dR CONH2
60 35 H2N dR K K R dR Q Н R dR CONH2
61 36 H2N dR K K R dR Q R Н dR CONH2
62 37 H2N dR I K R dR Q R R dR CONH2
63 38 H2N dR K I R dR Q R R dR CONH2
64 39 H2N dR K K I dR Q R R dR CONH2
65 40 H2N dR K K R dR I R R dR CONH2
66 41 H2N dR K K R dR Q I R dR CONH2
67 42 H2N dR K K R dR Q R I dR CONH2
68 43 H2N dR L K R dR Q R R dR CONH2
251 44 (D-TAT) H2N dR dR dR dQ dR dR dK dK dR CONH2
21 45 (r3-L-TATi) H2N dR R R Q dR R K K dR CONH2
20 46 (r3-L-TAT) H2N dR K K R dR Q R R dR CONH2
18 47 (L-TAT) H2N R K K R R Q R R R CONH2
SEQ ID NO: Пептид No: сокращение, указанное на фиг.13 и фиг.14
73 48 H2N dR K K R dR Q R L dR CONH2
74 49 H2N dR M K R dR Q R R dR CONH2
75 50 HzN dR К М R dR Q R R dR CONH2
76 51 H2N dR K K М dR Q R R dR CONH2
77 52 H2N dR K K R dR М R R dR CONH2
78 53 H2N dR K K R dR Q М R dR CONH2
79 54 H2N dR K K R dR Q R М dR CONH2
80 55 H2N dR N K R dR Q R R dR CONH2
81 56 H2N dR K N R dR Q R R dR CONH2
82 57 H2N dR K K N dR Q R R dR CONH2
83 58 H2N dR K K R dR N R R dR CONH2
84 59 H2N dR K K R dR Q N R dR CONH2
85 60 H2N dR K K R dR Q R N dR CONH2
86 61 H2N dR Q K R dR Q R R dR CONH2
87 62 H2N dR K Q R dR Q R R dR CONH2
88 63 H2N dR K K Q dR Q R R dR CONH2
89 64 H2N dR K K R dR К R R dR CONH2
90 65 H2N dR K K R dR Q Q R dR CONH2
91 66 H2N dR K K R dR Q R Q dR CONH2
92 67 H2N dR S K R dR Q R R dR CONH2
93 68 H2N dR K S R dR Q R R dR CONH2
94 69 H2N dR K K S dR Q R R dR CONH2
95 70 H2N dR K K R dR S R R dR CONH2
96 71 N2H dR K K R dR Q S R dR CONH2
97 72 H2N dR K K R dR Q R S dR CONH2
SEQ ID NO: Пептид No: сокращение, указанное на фиг.13 и фиг.14
98 73 H2N dR T K R dR Q R R dR CONH2
99 74 H2N dR K Т R dR Q R R dR CONH2
100 75 H2N dR K K Т dR Q R R dR CONH2
101 76 H2N dR K K R dR Т R R dR CONH2
102 77 H2N dR K K R dR Q Т R dR CONH2
103 78 H2N dR K K R dR Q R Т dR CONH2
104 79 H2N dR V K R dR Q R R dR CONH2
105 80 H2N dR K V R dR Q R R dR CONH2
106 81 H2N dR K K V dR Q R R dR CONH2
107 82 H2N dR K K R dR V R R dR CONH2
108 83 H2N dR K K R dR Q V R dR CONH2
109 84 H2N dR K K R dR Q R V dR CONH2
110 85 H2N dR W K R dR Q R R dR CONH2
111 86 H2N dR K W R dR Q R R dR CONH2
112 87 H2N dR K K W dR Q R R dR CONH2
113 88 H2N dR K K R dR W R R dR CONH2
114 89 H2N dR K K R dR Q W R dR CONH2
115 90 H2N dR K K R dR Q R W dR CONH2
116 91 H2N dR Y K R dR Q R R dR CONH2
117 92 H2N dR K Y R dR Q R R dR CONH2
118 93 H2N dR K K Y dR Q R R dR CONH2
119 94 H2N dR K K R dR Y R R dR CONH2
120 95 H2N dR K K R dR Q Y R dR CONH2
121 96 H2N dR K K R dR Q R Y dR CONH2

В приведенной выше таблице D-аминокислоты обозначены прописной буквой «d» перед соответствующим аминокислотным остатком (например, dR=D-Arg).

Для некоторых последовательностей при использовании первого подхода, к сожалению, не удалось осуществить синтез по техническим причинам. Эти последовательности сокращенно обозначены на фиг.13 как 1, 2, 3, 4, 5, 6, 7, 8, 43, 52, 53, 54, 55, 56, 57, 85, 86, 87, 88, 89 и 90. Однако остальные последовательности применяли в экспериментах по интернализации.

Результаты представлены на фиг.13 и 14.

Как продемонстрировано на фиг.13, после 24-часовой инкубации все транспортеры с консенсусной последовательностью rXXXrXXXr (SEQ ID NO:

252) (см. выше о выборе возможных последовательностей) отличались более высокой способностью к интернализации, чем транспортер L-TAT. Клетки линии Hela инкубировали в течение 24 ч в 96-луночном планшете с 10 мМ полученными из r3-L-TAT транспортерами. Затем клетки отмывали дважды кислым буфером (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем определяли относительное количество интернализованного пептида, считывая интенсивность флуоресценции (ридер Fusion Alpha, фирма Perkin Elmer) для каждого экстракта, с последующим вычитанием фонового уровня.

Как продемонстрировано на фиг.14, одно из положений, вероятно, играет решающее значение для наиболее высокой активности транспортера и улучшенных кинетических характеристик транспортной активности: Y в положении 2 (пептид №91, соответствующий SEQ ID NO:116). В целом, метод состоял в следующем: клетки линии Hela инкубировали в течение 2, 6 или 24 ч в 24-луночном планшете с возрастающими дозами полученных из r3-L-TAT транспортеров (0, 500 нМ, 1 мМ или 10 мМ). Затем клетки отмывали дважды кислым буфером (0,2М глицин, 0,15М NaCl, pH 3,0) и дважды ЗФР. Клетки расщепляли, добавляя буфер для лизиса RIPA. Затем определяли относительное количество интернализованного пептида, считывая интенсивность флуоресценции (ридер Fusion Alpha, фирма Perkin Elmer) для каждого экстракта, с последующим вычитанием фонового уровня.

На основе результатов, полученных в этом эксперименте, можно сделать следующие выводы:

- После 24-часовой инкубации все транспортеры с консенсусной последовательностью rXXXrXXXr (SEQ ID NO:252) (см. таблицу 1 для выбора возможных последовательностей) отличались более высокой способностью к интернализации, чем транспортер L-TAT (фиг.13). Эти результаты полностью валидируют консенсусную последовательность rXXXrXXXr (SEQ ID NO:252).

- Одно из положений имеет решающее значение для обеспечения наиболее высокой активности транспортера: Y в положении 2 (последовательность 91, соответствующая SEQ ID NO:116).

- Одно из положений имеет решающее значение для улучшения кинетических характеристик транспортной активности: Y в положении 2 (последовательность 91, соответствующая SEQ ID NO:116).

Таким образом, указанные полученные из ТАТ последовательности, представленные в таблице 1, являются предпочтительными, они отличаются наличием Y в положении 2, прежде всего, когда последовательность согласно общей формуле (I) состоит из 9 аминокислот и имеет консенсусную последовательность rXXXrXXXr (SEQ ID NO:252).

Пример 4. Определение внутриклеточной концентрации конкретных конструкций транспортеров после поглощения (интернализации) этих пептидов клетками линии U937

В следующем эксперименте определяли концентрацию конкретных конструкций транспортеров после поглощения (интернализации) этих пептидов клетками линии U937. Эксперименты осуществляли, используя последовательности RKKRRQRRR (L-TAT), rrrqrrkkr (D-TAT), rKKRrQRRr (r3-L-TAT) и rYKRrQRRr (XG-91), каждую в концентрации 10 мкМ.

10 мкМ 2 ч 4 ч 6 ч 24 ч
RKKRRQRRR (L-TAT) 1,20 1,38 1,07 0,5
rrrqrrkkr (D-TAT) 2,00 2,24 3,55 17,3
rKKRrQRRr (r3-L-TAT) 2,34 3,16 3,56 11,2
rYKRrQRRr (XG-91, последовательность 91, соответствующая SEQ ID NO:116) 3,16 4,27 4,68 50

При создании изобретения неожиданно было установлено, что накопление rYKRrQRRr (XG-91, последовательность 91, соответствующая SEQ ID NO:116), является очень высоким в клетке, даже существенно превышающим концентрацию конструкции транспортера в среде или среднюю концентрацию, составляющую примерно 20 мкМ, которая ожидалась для конструкции D-TAT. Это подчеркивает важность конструкций транспортеров общей формулы (I), прежде всего конструкций транспортеров, которые содержат полученную из ТАТ последовательность, представленную в таблице 1, которая несет Y в положении 2, и предпочтительно состоит из 9 аминокислот и несет консенсусную последовательность rXXXrXXXr (SEQ ID NO:252).

Пример 5. Поглощение (интернализация) пептидов клетками и оценка интернализации пептидов с использованием клеток линии HepG2 (гепатокарцинома). НСТ-116 (опухоль ободочной кишки). U937 (лимфома) и клеточных линий WBC (клеточные линии лейкоцитов) и клеточных линий, не относящихся к WBC

В этих экспериментах оценивали способность к интернализации (поглощению) меченых с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro с помощью флуоресцентного планшет-ридера на других клеточных линиях, таких как HepG2 (гепатокарцинома), НСТ-116 (опухоль ободочной кишки), U937 (лимфома), клеточные линии WBC (клеточные линии лейкоцитов) и клеточные линии, не относящиеся к WBC.

Тест-образцы и условия, применяемые в этих экспериментах

В этом эксперименте применяли описанные выше для эксперимента 3 конструкции и условия со следующими изменениями и клеточными линиями:

(а) Поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro (10 мкМ, HepG2 (гепатокарцинома), НСТ-116 (опухоль ободочной кишки, 24 ч)

Применяемые конструкции представляли собой различные полученные из ТАТ конструкции транспортеров, обозначенные как D-TAT и r3-TATi (обозначена также как r3-L-TATi), D-TAT, каждая из которых состояла из 9 аминокислот, но имела отличную от других D-/L-схему, и конструкции r6R3 и DAK, эти конструкции дополнительно метили бета-аланином на N-конце. Результаты представлены на фиг.7. Как видно из фиг.7, наиболее высокая эффективность обнаружена для конструкций D-TAT и r6R3, далее в порядке снижения эффективности следовала конструкция r3-L-TATi.

(б) Поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro (10 мкМ. U937 (лимфома) 24 ч)

Применяемые конструкции представляли собой 4 различные полученные из ТАТ конструкции транспортеров (обозначенные как L-TAT, r3-ТАТ (обозначена также как r3-L-Tat), r3-TATi (обозначена также как r3-L-TATi) и D-TAT), каждая из которых состояла из 9 аминокислот, но имела отличную от других D-/L-схему. Кроме того, применяли конструкцию DAK для сравнения и контрольный образец, не содержащий пептид. Результаты представлены на фиг.8. Как видно из фиг.8, наиболее высокая эффективность поглощения клетками обнаружена для конструкций транспортеров r3-ТАТ, r3-TATi и D-TAT, в то время как для L-ТАТ характерна существенно меньшее поглощение клетками.

в) Зависящее от HSPG (гепаринсульфатпротеогликан) поглощение (интернализация) конструкции транспортера D-TAT

Эксперимент осуществляли с целью решения вопроса о том, является ли поглощение (интернализация) конструкции транспортера D-TAT HSPG-зависимой. Установлено, что поглощение (интернализация) конструкции транспортера D-TAT являлось HSPG-зависимым в концентрации 500 нМ в течение 24 ч при оценке на клетках лимфомы линии U937 (см. фиг.9). Применяемая в этом эксперименте конструкция представляла собой D-TAT, которая состояла из 9 аминокислот и ее метили с помощью ФИТЦ и на N-конце с помощью бета-аланина.

г) Выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров при использовании клеток линии U937 (лимфома)

Следующий эксперимент осуществляли с целью решения вопроса о том, имеет ли место выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров при использовании клеток линии U937. В этом случае выход при использовании клеток линии U937 не обнаружен при применении 500 нМ ФИТЦ-D-TAT (см. фиг.10). Применяемая для эксперимента конструкция представляла собой D-TAT (SEQ ID NO:251), которая состояла из 9 аминокислот и ее метили с помощью ФИТЦ и на N-конце с помощью бета-аланина.

Кроме того, удалось установить, что выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров обнаружен при применении 10 мкМ ФИТЦ-D-TAT и являлся HSPG-зависимым в случае клеток линии U937 (лимфома) (см. фиг.11). Применяемая для эксперимента конструкция представляла собой также описанную выше конструкцию D-TAT (SEQ ID NO:251).

д) Поглощение (интернализация) и выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров, таких как 10 мкМ ФИТЦ-Р-ТАТ, в линиях клеток, не относящихся к WBC (клеточные линии, не относящиеся к лейкоцитам)

В следующем эксперименте изучали поглощение (интернализацию) и выход меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров при использовании 10 мкМ ФИТЦ-D-TAT и линий клеток, не относящихся к WBC (не относящиеся к лейкоцитам клеточные линии) (см. фиг.12). Применяемая для эксперимента конструкция представляла собой D-TAT (SEQ ID NO:251), которая состояла из 9 аминокислот и ее метили с помощью ФИТЦ и на N-конце с помощью бета-аланина.

е) Заключение

Из представленных выше экспериментов по оценке поглощения (интернализации) следует, что поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров, содержащих или состоящих только из D-аминокислот, являлось линейным в течение нескольких часов в опытах in vitro. Кроме того, через 24 ч поглощение (интернализация) этих меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров in vitro по внутриклеточным концентрациям превышало в 50-100 раз L-TAT. Кроме того, поглощение (интернализация) меченных с помощью ФИТЦ полученных из ТАТ конструкций транспортеров, содержащих или полностью состоящих из D-аминокислот, WBC-линиями (клеточные линии лейкоцитов) оказалось в 10-50-раз более эффективным по сравнению с не относящимися к WBC линиями in vitro. Во всех этих экспериментах установлено, что при использовании WBC выход являлся эффективным при высокой внутриклеточной концентрации, но не обнаружен при низкой концентрации.

Пример 6. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-цисплатин, r3-L-ТАТ-цисплатин и r3-L-TATi-цисплатин

6.1 Пептидный синтез

Пептидные последовательности D-TAT (rrrqrrkkr; SEQ ID NO:251), r3-L-TAT (rKKRrQRRr; SEQ ID NO:20) и r3-L-TATi (rRRQrRKKr; SEQ ID NO:21), включающие дополнительный метионин, синтезировали вручную, используя 0,4 ммоля Fmoc-Амид-амидной-АМ-смолы, на основе Fmoc-химии. Затем пептид отщепляли от смолы с помощью ТФК, фильтровали при пониженном давлении, осаждали холодным простым эфиром и сушили. Неочищенный пептид очищали с помощью полупрепаративной ЖХВР и характеризовали с помощью масс-спектрометрии с ионизацией электроспреем (ESI-MC).

6.2 Алкилирование пептида в присутствии цисплатина

5,0 мкмоля цисплатина (1,5 мг в 3,0 мл натрий-хлоридного буфера, рН 5,0) растворяли в 2,0 мл 10 мМ Na2HPO4-буфера (рН 7,4) при этом значение рН раствора составляло 7,0. 5,0 мкмоля пептида D-TAT-метионин (или пептида r3-L-TAT-метионин, или пептида r3-L-TATi-метионин) приготавливали в 10 мМ Na2HPO4-буфере (рН 7,4) при этом значение рН раствора составляло 6,0. Затем начинали алкилирование путем смешения двух растворов при комнатной температуре в темноте (значение рН смеси 7,0). Через 0, 1, 3 и 24 ч продукт анализировали с помощью аналитической ОФ-ЖХВР и характеризовали с помощью ESI-MC. Включающий ожидаемый пик раствор окончательно очищали с помощью полупрепаративной ОФ-ЖХВР и лиофилизировали.

Пример 7. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-оксалиплатин, r3-L-TAT-оксалиплатин и r3-L-TATi-оксалиплатин

7.1. Синтез пептидов (D-Tat-метионин, r3-L-ТАТ-метионин r3-L-TATi-метионин)

Пептидные последовательности D-TAT (rrrqrrkkr; SEQ ID NO:251), r3-L-TAT (rKKRrQRRr; SEQ ID NO:20) и r3-L-TATi (rRRQrRKKr; SEQ ID NO:21) синтезировали вручную, используя 0,23 ммоля Fmoc-амидной смолы Ринка, на основе Fmoc-химии. При этом каждую аминокислоту, начиная с С-концевого Gly до N-концевого 1-Met (L-форма), последовательно присоединяли к смоле, осуществляя цикл удаления защитной группы Fmoc (20% пиперидина в ДМФ), и аминокислотного сочетания (ГБТУ/ГОВ1/ДИЭА (диизопропилэтиламин), активация в ДМФ). Пептид отщепляли от смолы с помощью ТФК (2 ч в присутствии 2,5% dH2O, 0,5% ЭДТ и 2,0% ТИС), фильтровали при атмосферном давлении, уменьшали объем барботированием nz, осаждали холодным простым эфиром и сушили на воздухе. Неочищенный пептид очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC.

7.2. Алкилирование пептида в присутствии оксалиплатина

10 мкмолей оксалиплатина, в виде лекарственной формы Eloxatin (оксалиплатин 4,0 мг, моногидрата лактозы 36,0 мг) растворяли в 5,0 мл 10 мМ Na2HPO4- буфера (рН 7,4). 10 мкмолей пептида D-Tat-метионин (или пептида r3-L-TAT-метионин, или пептида r3-L-TATi-метионин) приготавливали в 5,0 мл dH2O. Начинали алкилирование путем смешения двух растворов при комнатной температуре. Затем реакционную смесь выдерживали при 37°С и осуществляли мониторинг с помощью аналитической ОФ-ЖХВР при 214 и 280 нм в течение 24 ч, целевой пик характеризовали с помощью ESI-MC и очищали полупрепаративной ОФ-ЖХВР с последующей лиофилизацией.

7.3. Условия тестирования

Изучали воздействие обработки возрастающими концентрациями молекулы-конъюгата, предлагаемой в изобретении (D-Tat-оксалиплатин, r3-L-ТАТ-оксалиплатин или r3-L-TATi-оксалиплатин), на выживаемость клеток MCF-7 (клеточная линия человеческой аденокарциномы молочной железы) и SiHa (клеточная линия человеческой плоскоклеточной карциномы шейки матки). Воздействие конъюгатов D-Tat-оксалиплатин, r3-L-ТАТ-оксалиплатин или r3-L-TATi-оксалиплатин сравнивали с действием конъюгата L-Tat-оксалиплатин и двух неконъюгированных противораковых лекарственных средств (оксалиплатин и цисплатин). Клетки каждой клеточной линии (10000 клеток на лунку) высевали в 96-луночные планшеты (200 мкл общий объем среды MEM, дополненной 10% FBS, 1% L-глутамина, 1% Na-пирувата, 1% заменимых аминокислот, для MCF-7-клеток и среды МЕМ/Эрла, дополненной 10% FBS, 1% Na-пирувата, 1% заменимых аминокислот, для SiHa-клеток). Для тестирования каждой оцениваемой субстанции использовали от 6 до 10 различных концентраций. Контрольные клетки представляли собой необработанные клетки. Клетки инкубировали при 37°С в течение 24 ч перед обработкой оцениваемой субстанцией. Каждый эксперимент осуществляли в трех повторностях. Инкубацию клеток после обработки осуществляли в течение 96 ч при 37°С. Воздействие тестируемой молекулы на выживаемость этих клеточных линий (in vitro цитотоксическая активность) оценивали с помощью МТТ-анализа. Добавляли в каждую лунку по 20 мкл (5 мг/мл), профильтрованного через фильтр с размером отверстий 0,22 мкм раствора МТТ (тиазолил синий тетразолий бромид) (МТТ, фирма Sigma, Ref. №88415) в забуференным фосфатом физиологическом растворее (ЗФР, фирма CHUV) и планшет инкубировали в течение 4 ч при 37°С. Супернатант удаляли и кристаллы формазана растворяли в ДМСО (200 мкл на лунку). Оценивали абсорбцию (ОП) с помощью ридера для микропланшетов при 595 нм (ридер типа Expert Plus, фирма Asys Hitech). Значения Юзо (концентрация лекарственного средства, ингибирующая на 50% рост клеток) для оцениваемых субстанций рассчитывали с помощью программы Prism.

Пример 8. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-хлорамбуцил, r3-L-TAT-хлорамбуцил и r3-L-TATi-хлорамбуцил

8.1 Синтез молекул-конъюгатов (D-Tat-хлорамбуцил, r3-L-TAT-хлорамбуцил и r3-L-TATi-хлорамбуцил)

Пептидные последовательности D-TAT (rrrqrrkkr; SEQ ID NO:251), r3-L-TAT (rKKRrQRRr; SEQ ID NO:20) или r3-L-TATi (rRRQrRKKr; SEQ ID NO:21) синтезировали вручную, используя 0,23 ммоля Fmoc-амидной смолы Ринка, на основе Fmoc-химии. При этом каждую аминокислоту, начиная с С-концевого Gly до N-концевого 1-A (L-форма), последовательно присоединяли к смоле, осуществляя цикл удаления защитной группы Fmoc (20% пиперидина в ДМФ) и аминокислотного сочетания (ГБТУ/ГОВt/ДИЭА, активация в ДМФ).

8.2 Сравнительные исследования

Изучали воздействие обработки возрастающими концентрациями конъюгатов D-Tat-хлорамбуцил, r3-L-TAT-хлорамбуцил или r3-L-TATi-хлорамбуцил на выживаемость клеток MCF-7 (клеточная линия человеческой аденокарциномы молочной железы) и SiHa (клеточная линия человеческой плоскоклеточной карциномы шейки матки). Воздействие конъюгатов D-Tat-хлорамбуцил, r3-L-TAT-хлорамбуцил или r3-L-TATi-хлорамбуцил сравнивали также с воздействием конъюгата L-Tat-хлорамбуцил и некоъюгированными противораковыми лекарственными средствами (хлорамбуцил и цисплатин). Клетки каждой клеточной линии (10000 клеток на лунку) высевали в 96-луночные планшеты (200 мкл общий объем среды MEM, дополненной 10% FBS, 1% L-глутамина, 1% Na-пирувата, 1% заменимых аминокислот, для MCF-7-клеток и среды МЕМ/Эрла, дополненной 10% FBS, 1% Na-пирувата, 1% заменимых аминокислот, для SiHa-клеток). Тестировали от 6 до 10 различных концентраций для каждой оцениваемой субстанции. Контрольные клетки представляли собой необработанные клетки. Клетки инкубировали при 37°С в течение 24 ч перед обработкой оцениваемой субстанцией. Каждый эксперимент осуществляли в трех повторностях. Инкубацию клеток после обработки осуществляли в течение 96 ч при 37°С. Воздействие тестируемой молекулы на выживаемость этих клеточных линий (in vitro цитотоксическая активность) оценивали с помощью МТТ-анализа. Добавляли в каждую лунку по 20 мкл (5 мг/мл), профильтрованного через фильтр с размером отверстий 0,22 мкм раствора МТТ (тиазолил синий тетразолий бромид) (МТТ, фирма Sigma, Ref. №88415) в забуференным фосфатом физиологическом растворее (ЗФР, фирма CHUV) и планшет инкубировали в течение 4 ч при 37°С. Супернатант удаляли и кристаллы формазана растворяли в ДМСО (200 мкл на лунку). Оценивали абсорбцию (ОП) с помощью ридера для микропланшетов при 595 нм (ридер типа Expert Plus, фирма Asys Hitech). Значения Юзо (концентрация лекарственного средства, ингибирующая на 50% рост клеток) для оцениваемых субстанций рассчитывали с помощью программы Prism.

Пример 9. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-доксорубицин, r3-L-TAT-доксорубицин и r3-L-TATi-доксорубицин

9.1. Синтез молекул-конъюгатов (D-Tat-доксорубицин, r3-L-TAT-доксорубицин и r3-L-TATi-доксорубицин)

Пептидные последовательности D-TAT (rrrqrrkkr; SEQ ID NO:251), r3-L-TAT (rKKRrQRRr; SEQ ID NO:20) и r3-L-TATi (rRRQrRKKr; SEQ ID NO:21) синтезировали вручную, используя 0,23 ммоля Fmoc-амидной смолы Ринка, на основе Fmoc-химии. При этом каждую аминокислоту, начиная с С-концевого Gly до N-концевого 1-Е (L-форма), последовательно присоединяли к смоле, осуществляя цикл удаления защитной группы Fmoc (20% пиперидина в ДМФ) и аминокислотного сочетания (ГБТУ/ГОВ1/ДИЭА, активация в ДМФ).

После удаления защитной группы Fmoc (20% пиперидина в ДМФ) N-концевого 1-Е, осуществляли ацетилирование (уксусный ангидрид, ДИЭА, активация в ДМФ) Удаление защитной группы Odmab боковой цепи осуществляли, используя 2% моногидрата гидразина в ДМФ. Сочетание хлорамбуцила в виде лекарственной формы Adriblastin® (доксорубицинх HCl, 18%, NaCl, лиофилизированный, 82%) осуществляли через сложный эфир OBt (DIPCDI/ГOBt/ДИЭА, активация ДХМ/ДМФ).

Молекулу-конъюгат отщепляли от смолы с помощью ТФК (2 ч в присутствии 1,7% dH2O и 1,7% TIS), фильтровали при атмосферном давлении, уменьшали объем барботированием N2, осаждали холодным простым эфиром и сушили на воздухе. Неочищенную молекулу-конъюгат очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC с последующей лиофилизацией.

Пример 10. Синтез цитотоксических молекул-конъюгатов, являющихся транспортерами карго-молекул, таких как D-Tat-саквинавир, r3-L-TAT-саквинавир и r3-L-TATi-саквинавир

10.1. Синтез пептидов (Р-ТАТ-Р-цистеин, r3-L-ТАТ-D-цистеин и r3-L-TATi-D-цистеин)

Пептидные последовательности D-TAT (rrrqrrkkr; SEQ ID NO:251), r3-L-TAT (rKKRrQRRr; SEQ ID NO:20) и r3-L-TATi (rRRQrRKKr; SEQ ID NO:21) синтезировали вручную, используя 0,40 ммоля Fmoc-амидной смолы Ринка, на основе Fmoc-химии. При этом каждую аминокислоту, начиная с С-концевого D-Arg до N-концевого D-Cys, последовательно присоединяли к смоле, осуществляя цикл удаления защитной группы Fmoc (20% пиперидина в ДМФ) и аминокислотного сочетания (ГБТУ/ГОВt/ДИЭА, активация в ДМФ).

Пептид отщепляли от смолы с помощью ТФК, предварительно инкубировали на льду (5 ч в присутствии 2,5% cH2O, 2,5% ЭДТ и 1,0% ТИС), фильтровали при пониженном давлении, осаждали холодным простым эфиром и сушили в вакууме. Неочищенный пептид очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC.

10.2. Получение активного сложного эфира саквинавира (SQV)

375 мкмолей Boc-Gly-OH растворяли в безводном ДХМ при комнатной температуре и к этому раствору добавляли 265 мкмолей ДМАП, 375 мкмолей ДИКДИ и 110 мкмолей саквинавира в виде лекарственной формы Invirase (лактоза, эксципиенты pro compresso obducto) при 0°С. Реакционной смеси навали нагреться до комнатной температуры и перемешивали в течение ночи. Продукт обрабатывали 0,1н. HCl, сушили над MgS04 и упаривали при пониженном давлении, получая твердый продукт SQV-Gly(Boc). Защитную группу Вое удаляли инкубацией сложного эфира SQV-Gly(Boc) в течение 3 ч в смеси CH2Cl2 и ТФК (50:50). Продукт перекристаллизовывали из холодного простого эфира в вакууме в течение ночи. Растворяли 47 мкмолей сложного эфира SQV-Gly в 3 мл безводного ДМСО при комнатной температуре и к этому раствору добавляли 94 мкмоля СПДП. Значение рН реакционной смеси доводили до 8,0 при постоянном перемешивании при комнатной температуре. Реакционную смесь выдерживали в течение 3 ч при постоянном перемешивании. Неочищенный продукт SQV-Gly-СОСН2СН2-SS-пиридил очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC.

10.3. Конъюгация пептида D-TAT (rrrqrrkkr: SEQ ID NO:251), r3-L-TAT (rKKRrORRr: SEO ID NO:20) или r3-L-TATi (rRRQrRKKr: SEO ID NO:21)-D-цистеин с саквинавиром

27 мкмолей SQV-Gly-СОСН2СН2-SS-пиридила растворяли в 0,5 мл ЗФР-буфера, рН 7,5 при комнатной температуре и к раствору добавляли 54 мкмоля конструкции D-TAT (rrrqrrkkr), r3-L-TAT (rKKRrQRRr) или r3-L-TATi (гККОгКККг)-О-цистеин в 0,5 мл ЗФР-буфера, рН 7,5. Реакционную смесь выдерживали при комнатной температуре в течение 3 ч при постоянном перемешивании. Неочищенный конъюгат D-TAT (rrrqrrkkr)-caKBHHaBHp, r3-L-ТАТ (rKKRrQRRr)-caKBHHaBHp и r3-L-TATi (rRRQrRKKr)-саквинавир очищали с помощью полупрепаративной ОФ-ЖХВР и характеризовали с помощью ESI-MC.

Пример 11. Получение молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат в качестве карго-фрагмента последовательности ингибиторов JNK

11.1. Идентификация последовательностей, ингибирующих JNK Аминокислотные последовательности, важные для эффективного взаимодействия с JNK, идентифицировали путем сравнительного анализа последовательностей известных JBD, например, сравнение JBD, присутствующих в IB1, IB2, c-Jun и ATF2, выявило состоящую из 8 аминокислот последовательность со слабым уровнем консервативности. С помощью указанного сравнительного анализа последовательностей ингибиторов JNK можно идентифицировать ряд пригодных последовательностей ингибиторов JNK, которые в настоящем описании представлены в SEQ ID NO:137-220.

11.2. Получение молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат последовательности ингибиторов JNK

Молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат последовательности ингибиторов JNK, синтезировали путем ковалентного связывания С-конца последовательностей ингибиторов JNK, как они представлены в настоящем описании, с N-концом конструкции транспортера общей формулы (I), представленной в настоящем описании, с помощью классического Fmoc-синтеза и дальнейшего анализа с помощью масс-спектрометрии. Компоненты полностью очищали с помощью ЖХВР. Связывание можно осуществлять с помощью линкера, состоящего из двух остатков пролина. Этот линкер можно применять в связи с тем, что он обеспечивает максимальную гибкость и предупреждает нежелательные изменения вторичной структуры.

11.3 Ингибирование гибели клеток

Изучали воздействие на биологическую активность JNK. Конструкцию связывали на N-конце с зеленым флуоресцентным белком и оценивали воздействие этой конструкции на апоптоз панкреатических β-клеток, индуцированный IL-1. Ранее установлено, что такой механизм апоптоза блокируется трансфекцией JBD1-280, при этом не происходит защита специфическими ингибиторами ERK1/2 или р38.

Продуцирующие инсулин клетки рТС-3 культивировали в среде RPMI 1640, дополненной 10% фетальной телячьей сыворотки, 100 мкг/мл стрептомицина, 100 ед./мл пенициллина и 2 мМ глутамином. Продуцирующие инсулин клетки ТС-3 трансфектировали предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, и IL-1β (10 нг/мл) и добавляли в среду для культуры клеток. Подсчитывали количество находящихся в состоянии апоптоза клеток через 48 ч после добавления IL-1β с помощью инвертированного флуоресцентного микроскопа. Находящиеся в состоянии апоптоза клетки отличались от здоровых клеток характерным «вспучиванием» цитоплазмы и их подсчитывали через 2 дня.

Пример 12. Импорт в клетку предлагаемых в изобретении молекул-конъюгатов. являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или 1 В 1 карго-пептиды. последовательность которых представлена в любой из SEQ ID NO:137-220

Оценивали способность проникать в клетки молекул-конъюгатов, которые являются транспортерами карго-молекул, включающих полученные из ТАТ конструкции транспортеров, которые имеют любую из последовательностей, представленных в SEQ ID NO:8-136, и выведенные из JNK1 или IB1 карго-пептиды, которые имеют любую из последовательностей, представленных SEQ ID NO:137-220. Предлагаемые в изобретении конструкции транспортеров и предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, метили, добавляя на N-конец остаток глицина, конъюгированный с флуоресцеином. Меченые пептиды (1 мкМ) добавляли в культуры клеток ТС-3, которые поддерживали согласно методу, описанному в примере 11. В предварительно определенные моменты времени клетки отмывали ЗФР и фиксировали в течение 5 мин в охлажденном на льду метаноле-ацетоне (1:1) перед оценкой с помощью флуоресцентного микроскопа. Меченный флуоресциеном БСА (1 мкМ, 12 молей/моль БСА) применяли в качестве контроля.

Оценивали флуоресцентные сигналы этих конструкций транспортеров и предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул.

Пример 13. In vitro ингибирование фосфорилирования c-JUN, ATF2 и Elk1 предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEO ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220

В опытах in vitro оценивали воздействие_предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, на JNK-опосредуемое фосфорилирование факторов транскрипции, являющихся их мишенями. Рекомбинантные и не активированные JNK1, JNK2 и JNK3 получали с помощью набора для транскрипции и трансляции лизатов кроличьих ретикулоцитов (набор TRANSCRIPTION AND TRANSLATION rabbit reticulocyte lysate) (фирма Promega) и применяли для твердофазных анализов киназ c-Jun, ATF2 и Elk1 либо индивидуально, либо после слияния с глутатион-S-трансферазой (GST) в качестве субстратов. Осуществляли опыты по оценке зависимости ответа от дозы, смешивая предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, с рекомбинантными киназами JNK1, JNK2 или JNK3 в реакционном буфере (20 мМ Трис-ацетат,1 мМ ЭГТК (этиленгликолевая тетраацетиловая кислота), 10 мМ p-нитрофенилфосфат (пНФФ), 5 мМ пирофосфат натрия, 10 мМ n-глицерофосфат, 1 мМ дитиотреитол) в течение 20 мин. Затем инициировали киназные реакции, добавляя 10 мМ MgCl2 и 5 пКи 33Р-γ-дАТФ и 1 мкг либо GST-Jun (ак 1-89), либо GST-AFT2 (ак 1-96), либо GST-ELK1 (ак 307-428). Слитые с GST белки получали от фирмы Stratagene (Ла-Джолла, шт.Калифорния).

В смесь добавляли 10 мкл покрытых глутатионом агарозных гранул. Продукты реакции затем разделяли с помощью ДСН-ПААГ, в которых применяли денатурирующий 10% полиакриламидный гель. Гели сушили и затем экспонировали на рентгеновскую пленку (фирма Kodak) и определяли ингибирование фосфорилирования c-Jun, ATF2 и Elkl этими предлагаемыми в изобретении молекулам-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220.

Пример 14. Ингибирование предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, индуцированной IL-1 гибели панкреатических β-клеток

Изучали воздействие предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, на усиление апоптоза р-клеток, вызванного обработкой IL-1. Культуры рТС-3-клеток инкубировали в течение 30 мин с 1 мкМ предлагаемыми в изобретении пептидами L-TAT-IB1(s) с последующем введением 10 нг/мл IL-1. Второе введение пептида (1 мкМ) осуществляли через 24 ч. Количество находящихся в состоянии апоптоза клеток подсчитывали после инкубации в течение 2 дней с IL-1β с использованием для окрашивания ядер йодида пропидия (клетки, окрашенные в красный цвет, представляют собой погибшие клетки) и Hoechst 33342 (клетки, окрашенные в синий цвет, представляют собой клетки с неповрежденной плазматической мембраной). Добавление предлагаемых в изобретении пептидов TAT-IB(s) ингибировало индуцированный IL-1 апоптоз βТС-3-клеток, культивируемых в присутствии IL-1β в течение 2 дней.

Продолжительное ингибирование индуцируемой IL-1 гибели клеток оценивали путем обработки βТС-3-клеток аналогично описанному выше, за исключением того, что инкубацию клеток с предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, и IL-1β осуществляли в течение 12 дней. Каждый день вносили дополнительную порцию пептидов (1 мкМ) и каждые два дня вносили дополнительную порцию IL-1β (10 нг/мл).

Пример 15. Ингибирование предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, индуцированной облучением гибели панкреатических β-клеток

JNK активировали также ионизирующим излучением. Для решения вопроса о том, могут ли предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, обеспечивать защиту от индуцируемого облучением повреждения JNK, клетки линии «WiDr» облучали (30 Гр) в присутствии D-TAT (SEQ ID NO:251), L-TAT (SEQ ID NO:18) и предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220 (1 мкМ добавляли за 30 мин до облучения), или без них. Контрольные клетки (CTRL) не облучали. Клетки анализировали через 48 ч с помощью окрашивания ИП (йодид пропидия) и Hoechst 3342 согласно описанному выше методу.

Представлены среднеквадратичные отклонения средних значений (СКО) при n=3.

Пример 16: Радиационная защита от ионизирующего излучения с помощью предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEO ID NO:137-220

Для выявления способности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, осуществлять радиационную защиту мышей линии С57 В1/6 (возрастом 2-3 месяца) облучали рентгеновскими лучами (R-лучи) с помощью устройства Phillips RT 250 в дозе 0,74 Гр/мин (17 мА, 0,5 мм Си-фильтр). За 30 мин до облучения животным вводили i.p. предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220. В целом, метод состоял в следующем: для облучения мышей их помещали в небольшие пластиковые боксы, при этом голова оставалась вне бокса. Перед облучением животных клали на спину и фиксировали шею с помощью небольшой пластмассовой трубки для поддержания головы в правильном положении. Тело защищали свинцом. Перед облучением мышей содержали на стандартном пеллетированном корме для мышей, однако после облучения мышей содержали на полужидком корме, который заменяли каждый день. Затем оценивали реакцию слизистой оболочки губ в двух независимых анализах, используя балльную систему, разработанную Parkins с соавторами (Parkins и др., Radiotherapy & Oncology, I, 1983, ее. 165-173), в которой оценивали статус эритемы, а также наличие отека, шелушения и экссудата. Кроме того, животных взвешивали перед каждой оценки статуса эритемы/отека.

Пример 17: Подавление факторов транскрипции JNK с помощью предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136. и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220

Анализы по удерживанию в геле осуществляли с использованием несущего двойную метку зонда АР-1 (5'-CGC TTG ATG AGT CAG CCG GAA-3' (SEQ ID NO:262). Ядерные экстракты клеток линии HeLa обрабатывали в течение 1 ч 5 нг/мл TNF-α или соответственно не обрабатывали. ТАТ и предлагаемые в изобретении_молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, добавляли за 30 мин до TNF-α.

Пример 18: Оценка нейрозащитного действия от очаговой церебральной ишемии на перманентной МСАО-модели - определение эффективности защиты при использовании различных доз

Очаговую церебральную ишемию индуцировали у 12-дневных крыс. Крысят анестезировали в камере для индукции с использованием 2%-ного изофлурана и в процессе операции поддерживали анестезию с использованием маски с 2%-ным изофлураном. МСАО (окклюзию средней церебральной артерии) индуцировали путем электрокоагуляции основной ветви средней церебральной артерии (МСА). Крыс помещали на правый бок и делали продольный разрез кожи между глазом и ухом. После иссечения височной мышцы черепную кость удаляли из фронтального шва до уровня ниже скуловой дуги. Левую МСА, обнаженную непосредственно после ее появления над носовой щелью, перманентно подвергали электрокоагуляции на уровне нижней церебральной вены перед бифуркацией МСА на фронтальную и теменную ветви. Затем закрывали разрез на коже черепа. После этого крысят помещали в инкубатор, в котором поддерживали температуру 37°С до их пробуждения и после этого их переносили к матери.

Через 6 ч путем внутрибрюшинной инъекции вводили предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220. Через 24 ч после коагуляции крыс анестезировали гидратом хлораля и осуществляли перфузию через восходящую аорту, используя 4% параформальдегида в ЗФР. Затем удаляли головной мозг и выдерживали 2 ч в таком же растворе для фиксации и выдерживали в градиенте 30% сахарозы в ЗФР в течение примерно 15 ч при 4°С. Головной мозг замораживали в изопентане (-40°С) и хранили при -20°С. Криостатические фронтальные срезы толщиной 50 мкм помещали на стеклянные предметные стекла. Срезы окрашивали крезиловым фиолетовым. Анализировали каждый десятый срез и общий объем повреждений рассчитывали с помощью программы Neuroleucida.

Пример 19: Оценка нейрозащитного действия с помощью предлагаемых в изобретении химерных пептидов после внутривенного (iv) введения в отношении очаговой церебральной ишемии при использовании кратковременной МСАО-модели.

Создание кратковременной модели ишемии на взрослых мышах. У самцов мышей линии ICR-CD1 (6-недельные; 18-37 г; фирма Harlan) провоцировали ишемию путем интродукции филамента из общей сонной артерии во внутреннюю сонную артерию и продвижения в артериальный круг, тем самым, закупоривая среднюю церебральную артерию. С помощью лазерной Доплеровской флуориметрии с использованием зонда, фиксированного на черепе, осуществляли измерение регионального церебрального потока крови через область ишемии в течение периода времени до 10 мин после реперфузии. Измеряли ректальную температуру и поддерживали ее на уровне 37°С. Мышей умерщвляли через 48 ч после реперфузии. Серийные Криостатические срезы толщиной 20 мкм оценивали с использованием системы компьютер-микроскоп, снабженной программой Neurolucida (фирма MicroBrightField) и рассчитывали (вслепую) объемы области ишемии и всего головного мозга (окрашен в темный цвет) с помощью программы Neuroexplorer.

С использованием созданной на взрослых мышах модели определяли объем области инфаркта (мм3) после болюсной iv-инъекции плацебо и предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, 1,3 мг/кг через 6 ч после реперфузии (30-минутная фиксация).

Пример 20: Анализ культур нейронов, измеренный по уровню лактатдегидрогенакзы (ЛДГ), выделившейся после стимуляции NMDA

Нейрозащитное действие предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, оценивали на сестринских культурах, предварительно обработанных в течение 30 мин указанными концентрациями пептидов или МК-801 перед непрерывной обработки ЮОмкМ NMDA. После 12-часовой обработки NMDA в культурах, предварительно обработанных 5 мкМ предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, оценивали дегенеративные изменения, связанные с обработкой NMDA, морфологические характеристики, количество и распределение нейронов.

Культура кортикальных нейронов. Отсекали небольшие кусочки коры головного мозга двухдневных крысят, инкубировали с 200 ед. папаина в течение 30 мин при 34°С и затем помещали нейроны, исходя из плотности примерно 1×106 клеток/планшет в чашки, предварительно сенсибилизированные 100 мкг/мл поли-D-лизина. Среда для чашек Петри представляла собой B27/Neurobasal (фирма Life Technologies, Геттисберг, шт.Мэдисон), дополненную 0,5 мМ глутамином, 100 ед./мл пенициллина и 100 мкг/мл стрептомицина.

Анализ цитотоксичности лактатдегидрогеназы (ЛДГ). Оценивали количество ЛДГ, высвободившееся в среду для сбора через 12, 24 и 48 ч после введения NMDA, с помощью набора для нерадиоактивного анализа цитотоксичности типа Cytotox 96 (фирма Promega, шт.Висконсин).

Пример 21: Ингибированйе эндогенной активности JNK в клетках линии HepG2 с использованием подхода «все в одной лунке»

Клетки линии HepG2 высевали из расчета 3000 клеток/лунку за 1 день до эксперимента, (а) Затем в течение 30 мин добавляли в возрастающих концентрациях либо интерлейкин-1β (IL-1β), либо фактор некроза опухоли а (TNFa) для активации JNK. Клетки лизировали в 20 мМ Hepes, 0,5% Твин, рН 7,4 и процессировали для осуществления AlphaScreen-анализа JNK. (б): Добавляли Z' для проявления активности JNK, индуцированной с помощью 10 нг/мл IL-1β, и оценивали в 384 лунках/планшет (n=96). (в): Оценивали ингибирование эндогенной индуцированной IL-1β активности JNK химическими ингибиторами JNK (стауроспорин и SP600125). (г): Оценивали воздействие предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и пептидных ингибиторов L-TAT-IB1(s) на зависящую от IL-1α активность JNK.

Методы: AlphaScreen-анализ киназной активности

Принцип: AlphaScreen представляет собой нерадиоактивный метод анализа, основанный на использовании гранул, который применяют для изучения биомолекулярных взаимодействий в формате микропланшета. ALPHA представляет собой сокращение названия Amplified Luminescence Proximity Homogenous Assay (Гомогенный анализ усиленной люминесценции в ближней области). Он основан на биологическом взаимодействии, которое приводит к тому, что гранулы-«доноры» и гранулы-«акцепторы» оказываются близко расположенными друг к другу, после чего в результате каскада химических реакций возникает усиленный сигнал. Под действием создаваемого лазером света с длиной волны возбуждения 680 нм фотодетектор (фталоцианин), присутствующий в грануле-«доноре», переводит находящийся в окружающей среде кислород в возбужденное синглетное состояние. В течение промежутка времени, составляющего 4 мкс, что соответствует ее времени полужизни, синглетная молекула кислорода может продиффундировать в растворе на расстояние, составляющее примерно 200 нм, и, если в этой близкой области находится гранула-«акцептор», то синглетная молекула кислорода вступает во взаимодействие с тиоксеновым производным, присутствующим в грануле-«акцепторе», вызывая хемилюминисценцию при длине волны 370 нм, которая затем активирует флуорофоры, содержащиеся в этой же грануле-«акцепторе». После этого возбужденные флуорофоры испускают свет при длине волны 520-620 нм. При отсутствии гранулы-«акцептора» синглетная молекула кислорода возвращается в основное состояние, и сигнал при этом не возникает.

Реагенты для оценки киназной активности (B-GST-cJun, антитело к P-cJun и активная JNK.3) сначала разбавляли в киназном буфере (20 мМ Трис-HCl, рН 7,6, 10 мМ MgCl2, 1 мМ ДТТ, ЮОмкМ Na3VO4, 0,01% Твин 20) и добавляли в лунки (15 мкл). Затем реакционные смеси инкубировали вместе с 10 мкМ АТФ в течение 1 ч при 23°С. Обнаружение проводили путем добавления 10 мкл смеси гранул (акцептор - белок А, 20 мкг/мл и донор - стрептавидин 20 мкг/мл), разбавляли в буфере для обнаружения (20 мМ Трис-HCl, рН 7,4, 20 мМ NaCl, 80 мМ ЭДТК, 0,3% БСА), после чего осуществляли еще одну инкубацию в течение 1 ч при 23°С в темноте. Для измерения эндогенной активности JNK анализы киназной активности проводили согласно описанному выше методу за исключением того, что активную JNK.3 заменяли на клеточные лизаты и компоненты, входящие в реакционную смесь для киназы, добавляли после лизиса клеток. B-GST-cJun и антитело к P-cJun применяли в тех же самых концентрациях, в то время как АТФ применяли в концентрации 50 мкМ вместо 10 мкМ. AlphaScreen-сигнал анализировали непосредственно с помощью прибора типа Fusion или En Vision.

Пример 22: Лечение шумовой травмы

Предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, наносили на мембрану круглого окна улитки 3 групп морских свинок (по 6 животных в каждой группе) в виде 2 мкл геля на основе 2,6% забуференной гиалуроновой кислоты (Hylumed, фирма Genzyme Corp.) в концентрации ЮОмкМ либо за 30 мин до осуществления шумовой травмы (120 дБ при 6 кГц в течение 30 мин) или через 30 мин или через 4 ч после травмы. В качестве контроля служили необработанные уши. Изменения в уровне слухового порога оценивали путем измерения ответа слухового ствола головного мозга через 20 мин после шумовой травмы (временный сдвиг порога, TTS) и через 15 дней после травмы (перманентный сдвиг порога, PTS). Введение D-TAT-IB1(s) защищало от перманентной потери слуха даже при применении после избыточного шумового воздействия по сравнению с необработанными ушами.

Пример 23. Оценка терапевтической активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров. последовательность которых представлена в SEQ ID NO:8-136. и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, при лечении колита

а) Тест-система:

I) Вид/линия: Мыши линии BALB/c

II) Источник: фирма Harlan Israel, Ltd.

(III) Пол: Самки.

(IV) Общее количество животных: n=150.

(V) Возраст: Молодые взрослые животные возрастом 7 недель в начале опыта.

(VI) Вес тела: Вариации веса тела животных в момент обработки начальными дозами не превышали±20% от среднего веса.

(VII) Состояние здоровья животных: Состояние здоровья животных, которых применяли в этом опыте, оценивали по прибытии; только животных, которые имели хорошее состояние здоровья, акклиматизировали в лабораторных условиях (по меньшей мере 7 дней) и применяли при проведении опыта.

(VIII) Рандомизация: Животных произвольно разделяли на экспериментальные группы согласно Таблице случайных чисел.

(IX) Окончание опыта: В конце опыта выживших животных умерщвляли путем цервикальной дислокации.

б) Процедуры тестирования

Колит индуцировали путем введения тринитробензолсульфоната (TNBS), растворенного в 50%-ном этаноле.

Затем всех животных обрабатывали дозами предлагаемых в изобретении молекул-конъюгатов являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, составляющими от 0,1 до 1000 мкг/кг, либо внутрибрюшино, либо подкожно в виде однократных или повторных суточных доз (см. выше).

в) Обследование и оценка

I) Клинические признаки

В течение описанного выше эксперимента осуществляли тщательные клинические оценки и регистрировали их. Обследование включало определение изменения внешних признаков, например, состояния кожи, шерсти, глаз, слизистых мембран, появление секреции и экскреции (например, диарея), и вегетативной активности. Отмечали также изменения походки, позы и ответ на уход, а также наличие аномального поведения, тремора, конвульсий, состояния сна и наличие комы.

II) Вес тела

Определение веса тела индивидуальных животных осуществляли ежедневно.

(III) Клиническая оценка колита

Все параметры, такие как вес тела, консистенция экскрементов и кровотечение из прямой кишки, регистрировали ежедневно, и они служили в качестве параметров для балльной оценки серьезности болезни:

Балл Потеря веса (%) Консистенция экскрементов Наличие кровотечения из прямой кишки
0 нет нормальная нет
1 1-5 покраснение, отек ануса нет
2 5-10 неоформленные экскременты нет
3 10-15 диарея нет
4 >15 диарея кровотечение
5 смерть

IV) Макроскопическая патология ободочной кишки

В последний день эксперимента животных умерщвляли и изымали ободочную кишку для оценки макроскопической патологии согласно следующей балльной системе:

Степень Показатели
0 Отсутствие выявляемых аномалий
1 Отек и покраснение в одной области
2 Отек и покраснение в более чем одной области или очень сильный отек и покраснение, захватывающие более 50% ободочной кишки
3 Одна язва
4 Более одной язвы или очень длинная серьезная язва

Пример 24. Оценка активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEO ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, при лечении вирусных инфекций, вызываемых вирусом ветряной оспы и опоясывающего лишая (VZV)

Определение активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, осуществляли на культуре клеток-хозяев (фибробласты крайней плоти человека (HFF)). Вирусы являются облигатными внутриклеточными паразитами, для полного жизненного цикла которых необходима функциональная окружающая клетки среда; в умирающих клетках репликация вируса не поддерживается. Кроме того, ингибиторы клеточных функций могут обладать токсичностью для клеток, которые могут неспецифически предупреждать рост вирусов. Таким образом, для больных или умирающих клеток-хозяев могут быть характерны неспецифически пониженные вирусные титры. Поскольку это может фальсифицировать результаты, сначала осуществляли анализ цитотоксичности, определяя толерантность культивируемых клеток к изучаемому соединению. Затем осуществляли анализ снижения уровня бляшек (розеткообразования) и после этого оценивали активность предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK.1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в отношении клеток, зараженных вирусом ветряной оспы и опоясывающего лишая (VZV).

А) Определение цитотоксичности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды. последовательность которых представлена в любой из SEQ ID NO:137-220:

Для определения токсичности культивируемые клетки (фибробласты крайней плоти человека (HFF)) высевали в 96-луночные планшеты для культуры ткани. Добавляли среду, содержащую ДМСО (такая же концентрация, что и в 5 мкМ растворе предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220) в различных концентрациях (1, 2 и 5 мкМ) в течение 24 ч. Затем осуществляли анализ с использованием нейтрального красного. Колориметрические анализы с использованием нейтрального красного для оценки цитотоксичности (проведенные в 6 повторностях) применяли для установления максимальной дозы для последующих анализов эффективности (которые осуществляли согласно методу, описанному у Taylor и др., J. Virology, 78, 2004, cc.2853-2862). Живые клетки абсорбируют нейтральный красный и, следовательно, уровень абсорбции является количественной мерой жизнеспособности клеток и их количества. Поглощение нейтрального красного прямо пропорционально количеству клеток и отражает также нормальный эндоцитоз. Для этой цели в виде короткого импульса добавляли нейтральный красный в среду в моменты времени 0 или 24 ч. После фиксации и экстракции добавляли краситель и количественно оценивали уровень красителя в каждом образце с помощью планшет-ридера для ELISA при 540 нм.

Б) Анализ снижения уровня бляшек (розеткообразования) для оценки антивирусного действия предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды. последовательность которых представлена в любой из SEQ ID NO:137-220, в отношении вируса ветряной оспы и опоясывающего лишая (VZV):

Для решения вопроса о том, могут ли предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, обладать зависящим от дозы антивирусным действием, оценивали диапазон концентраций, близкий к стандартной дозе 1 мкМ. В этом анализе снижения уровня бляшек находящуюся в 24-луночных планшетах культуру фибробластов крайней плоти человека (HFF) на стадии конфлюэнтности инокулировали зараженными VZV HFF в соотношении 1:100 (множественность заражения MOI=0,01) и давали адсорбироваться клетками в течение 2 ч. Избыток вируса удаляли и добавляли среду, содержащую 0 (только ДМСО), 0,5, 1 или 2 предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220. В этот момент времени отбирали один образец для оценки начального уровня заражения; каждая лунка содержала ~150 БОЕ. Через 24 ч взятые с дублированием лунки обрабатывали трипсином и затем клеточные суспензии титровали на монослоях MeWo-клеток в трех повторностях для определения количества зараженных VZV клеток в каждом образце. На стадии неограниченного роста количество VZV, как правило, увеличивается в 10 раз в день 1, поскольку вирус размножается распространением из клетки в клетку. Это обнаружено для культур, обработанных только ДМСО, в которых достигнутый уровень составлял 1200±430 БОЕ. Оценивали цитотоксичность и эффективность. Из этих данных рассчитывали предварительный коэффициент избирательного действия (Тох/ЕС50), составляющий 5,0 мкМ/0,3 мкМ.

В. Количественная оценка репликации вируса ветряной оспы и опоясывающего лишая (VZV) в фибробластах крайней плоти человека (HFF) при использовании предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды. последовательность которых представлена в любой из SEQ ID NO:137-220:

Для определения минимальной эффективной дозы предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, которая предупреждает репликацию_вируса ветряной оспы и опоясывающего лишая (VZV) в фибробластах крайней плоти человека (HFF), конфлюэнтные слои HFF инокулировали штаммом VZV-BAC-Luc в течение 2 ч, затем обрабатывали в течение 24 ч предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в концентрациях 0,25, 0,5 или 1,0 мкМ или отрицательным контролем (DAK, 1,0 мкМ). Достигнутый уровень количественно оценивали с помощью анализа люциферазы. Образцы оценивали в трех повторностях и представляли в виде среднего уровня люминесценции; «усами» обозначали стандартное отклонение среднего значения.

Пример 25. Оценка активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-116, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, при лечении хронического обструктивного заболевания легких (COPD)

Для оценки активности репрезентативных предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в отношении лечения хронического обструктивного заболевания легких (COPD) использовали животную модель индуцированного блеомицином острого воспаления легких и фиброза. Протокол индуцированного блеомицином воспаления и фиброза ранее описан в литературе. Задача эксперимента заключалась в изучении воздействия указанных предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, при подкожном пути (s.c.) введения на рекрутмент нейтрофилов в бронхоальвеолярном лаваже (BAL) и легком при индуцированном блеомицином воспалении и фиброзе:

- в день 1 после однократного введения блеомицина (10 мг/кг)

- и в день 10 при развитом фиброзе.

1) Метод и экспериментальный подход

Тестируемые соединения, выбранные из предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в двух дозах и наполнитель в качестве контроля вводили s.c. в сочетании с однократным интраназальным введением блеомицина и осуществляли анализ мышей через 1 и 10 дней. Применяемые для создания модели животные представляли собой мышей линии C57BL/6 (8-недельного возраста) по 10 особей на группу. Экспериментальные группы представляли собой группу, обработанную наполнителем, 0,001 мг/кг предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, и 0,1 мг/кг предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, и обработка заключалась в повторном подкожном введении этих предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, до введения блеомицина и затем каждые 3 дня. Через 24 ч осуществляли мониторинг острого воспаления легких с помощью осуществления BAL-лаважа, цитологического обследования, определения количества клеток и определения активности легочной миелопероксидазы. Воздействие соединения сравнивали с действием применяемого в качестве контроля наполнителя. Фиброз легкого оценивали гистологически с использованием окрашивания гематоксилином и эозином в день 10 после введения однократной дозы блеомицина.

1.1) Введение блеомицина

Блеомицина сульфат в физиологическом растворе (10 мг/кг веса тела) фирмы Bellon Laboratories (Монруж, Франция) или физиологический раствор вводили в дыхательные пути путем назальной инстилляции в объеме 40 мкл под слабой анестезией кетамином-ксилазином. Группы, обработанные блеомицином с целью индукции блеомицином как воспаления, так и фиброза, включали: группу, обработанную наполнителем, 0,001 мг/кг предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, и 0,1 мг/кг предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул. Для индукции блеомицином воспаления использовали подкожный (s.c.) путь введения, и ее осуществляли посредством введения однократной дозы. Для индукции блеомицином фиброза использовали подкожный (s.c.) путь введения, и ее осуществляли посредством трехкратного введения в течение 10 дней.

1.2) Жидкость бронхоальвеолярного лаважа (промывная бронхоальвеолярная жидкость) (BALF)

После рассечения трахеи встраивали пластиковую канюлю и воздушное пространство промывали, используя 0,3 мл раствора ЗФР, нагретого до 37°С. Собранные образцы разделяли на 2 фракции: первую (1 мл, что соответствует двум первым лаважам) применяли для оценки медиатора, а вторую для определения клеток (4 мл). Первую фракцию центрифугировали (600×g в течение 10 мин) и супернатант фракционировали и выдерживали при -80°С до определения медиатора. Клеточный дебрис затем ресуспендировали в 0,4 мл стерильного 0,9%-ного NaCl, объединяли со второй фракцией и применяли для подсчета клеток.

1.3) Гомогенизация легкого

После осуществления BAL легкое целиком изымали и помещали внутрь микротрубки (лизирующий матрикс D, фирма Q Bio Gene, Иллкирх, Франция) с 1 мл ЗФР, получали экстракт всей легочной ткани с помощью системы Fastprep® (FP120, фирма Q Bio Gene, Иллкирх, Франция), затем экстракт центрифугировали и супернатант хранили при -80°С до определения медиатора и анализа коллагена на основе анализа коллагена с помощью Sircol (фирма France Biochem Division, Франция).

1.4) Подсчет и определение клеток

Общее количество клеток определяли в BAL-жидкости с помощью гемоцитометра Malassez. Дифференциальный подсчет клеток осуществляли на цитоспиновых препаратах (цитоспин 3, фирма Thermo Shandon) после окрашивания с помощью MGG Din-quick (фирма Dade Behring AG). Дифференциальный подсчет клеток проводили для 200 клеток на основе стандартных морфологических критериев.

1.5) Оценка TNF

Уровень TNF в BALF определяли с помощью наборов для ELISA (Mouse DuoSet, фирма R&D system, Миннеаполис, США), используя инструкции производителя. Результаты представлены в пг/мл.

1.6) Оденка МРО

Уровни МРО оценивали после введения предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220.

1.7) Гистология

После осуществления BAL и перфузии легкого большую долю фиксировали в 4% забуференного формальдегида для стандартного микроскопического анализа. 3-микрометровые срезы окрашивали гематоксилином и эозином (Н&Е).

Пример 26: Определение активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136. и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, при лечении болезни Альцгеймера

Для определения активности репрезентативных предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в отношении болезни Альцгеймера эти пептиды изучали, используя в качестве модели трансгенных мышей лини hAPP, которые отличались сверхэкспрессией АРР751 с мутациями типа London и Swedish, с использованием поведенческого теста, основанного на применении водного лабиринта Морриса, а также иммуногистохимических тестов, позволяющих оценивать загрузку бляшками, и ELISA-тестов, позволяющих оценивать уровни β-амилоида1-40 и β-амилоида1-42 в головном мозге мышей.

а) Методы

I) Введение

Опыт был спланирован с целью оценки эффективности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в отношении поведенческих, биохимических и гистологических маркеров, его проводили на самках трансгенных (Tg) мышей линии ЬАРР возрастом 5 месяцев (±2 недели). Для этой цели мышей обрабатывали каждые 2-3 недели в течение вплоть до 4 месяцев и в конце периода обработки оценивали поведение с помощью водного лабиринта Морриса. После умерщвления брали образцы головного мозга, СМЖ и крови. Уровни Аβ40 и Аβ42 определяли в четырех различных фракциях гомогената головного мозга, а также в СМЖ Tg-мышей. Загрузку бляшками оценивали количественно в корковом слое и гиппокампе восьми Tg-животных на каждую группу обработки.

II) Животные

Самок Tg-мышей, имевших генетический фон C57BL/6xDBA, и возрастом 5 месяцев (±2 недели) произвольно разделяли на группы обработки 1-3 (n=12). Животным вводили наполнитель или предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в двух различных концентрациях, начиная с 5-месячного возраста и в течение периода времени, составлявшего вплоть до 4 месяцев, с помощью подкожных (s.c.) инъекций каждую вторую или третью неделю. Все животные, которых использовали для настоящего опыта, имели темные глаза и хорошо воспринимали ориентиры вне MWM-бассейна. Однако животных исключали из опыта при обнаружении того, что они обладают плохой способностью видеть, что контролировали перед началом обработки с помощью обучения всех животных, включая резервных особей, включенных в опыт, с использованием видимой платформы, так называемого предварительного теста. В случае подтверждения обнаруженного у конкретного животного недостатка, мышь исключали из опыта.

III) Идентификация животных и их содержание

Мышам присваивали индивидуальные идентификационные номера с помощью ушных маркеров. Их содержали в отдельных вентилируемых клетках (IVC) на стандартизованной подстилке для грызунов с добавлением Rettenmaier®. В каждую клетку помещали максимум 5 мышей. Мышей содержали согласно стандартным процедурам обращения JSW (Standard Operating Procedures) (SOP GEN017), основанных на международных стандартах. Каждую клетку отмечали цветной карточкой, на которой были указаны номер опыта, пол, индивидуальные регистрационные номера (IRN) животных, дата рождения, а также дата скрининга и принадлежность к группе обработки. Температуру во время опыта поддерживали на уровне примерно 24°С, а относительную влажность поддерживали на уровне примерно 40-70%. Животных содержали при постоянном световом цикле (12 ч свет/темнота). Животные имели свободный доступ к обычной водопроводной воде.

IV) Обработка

Сорок самок трансгенных мышей линии ЬАРР обрабатывали предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в двух различных дозах (n=12/группу), а именно, либо в дозе 0,1 мг/кг веса тела/каждые две недели, либо 10 мг/кг веса тела/каждые три недели, либо наполнителем (n=12) s.c. один раз каждые три недели в течение четырех месяцев.

V) Водный лабиринт Морриса (MWM)

Тест с использованием водного лабиринта Морриса (MWM) проводили в черном округлом бассейне диаметром 100 см. Его заполняли водопроводной водой с температурой 22±1°С и бассейн фактически разделяли на четыре сектора. Прозрачную платформу (диаметром 8 см) помещали примерно на 0,5 см ниже поверхности воды. Во время всего периода испытания за исключением предварительного тестирования платформа находилась в юго-западном квадранте бассейна. За один день до периода обучения продолжительностью 4 дня животных подвергали так называемому «предварительному тестированию (тесту)» с использованием платформы (два опыта продолжительностью по 60 с) для гарантии того, что каждое животное обладало нормальным зрением. Только животные, полностью справившиеся с таким заданием, были включены в MWM-тест. При решении задания, связанного с использованием MWM, каждую мышь подвергали трем испытаниям в течение четырех последовательных дней. Одно испытание продолжалось максимум 1 мин. В это время мышь имела возможность найти укрытие, прозрачную мишень. Если животное не могло найти «путь» вне воды, исследователь направлял мышь к платформе или помещал ее на платформу. После каждого испытания мыши давали отдыхать на платформе в течение 10-15 с. В это время мыши имели возможность сориентироваться в окружающей среде. Исследователи находились в условиях с пониженной освещенностью для предотвращения отрицательного воздействия на систему маршрута (Kaminski; PCS, фирма Biomedical Research Systems). На окружающих бассейн стенках фиксировали плакаты с геометрическими символами, выполненными черным жирным цветом (например, круг или квадрат), которые мыши могли использовать в качестве ориентиров при ориентации. Одна плавающая группа, применяемая в одном испытании, состояла из 5-6 мышей, поэтому был гарантирован промежуток времени между испытаниями, составляющий примерно 5-10 мин. Для количественной оценки латентности избегания (время [с], необходимое мыши для того, чтобы найти укрытие на платформе и, следовательно, избежать попадания в воду), пути (длина траектории [в метрах] до достижения мишени) и пребывания в требуемом квадранте использовали компьютеризованную систему отслеживания пути. Компьютер соединяли с видеокамерой, помещенной над центром бассейна. Камера обнаруживала сигнал светоиспускающего диода (LED), который фиксировали с помощью небольшого зажима для волос на хвосте мыши. Через 1 ч после последнего испытания в день 4 мышей подвергали так называемому пробному испытанию. В этот момент платформу удаляли из бассейна и в течение 1 мин осуществляли пробное испытание; экспериментатор подсчитывал количество пересечений предыдущего положения мишени. Кроме того, подсчитывали время пребывания в этом квадранте, а также в трех других квадрантах. Во время этого испытания мышь не могла получать никакой сколько-нибудь естественной информации («ключа») от платформы.

VI) Получение образцов тканей

В конце периода обработки и после проведения всех поведенческих опытов всех оставшихся мышей (n=28) умерщвляли. Для этого на всех мышей воздействовали седативным средством посредством стандартной ингаляционной анестезии (изофлуран, фирма Baxter) согласно методу, описанному в SOP МЕТ030. Спинномозговую жидкость (СМЖ) получали путем отслаивания и обнажения большого затылочного отверстия (foramen magnum). После обнажения вносили пастеровскую пипетку на глубину примерно 0,3-1 мм в больше затылочное отверстие. СМЖ собирали отсасыванием и посредством капиллярного действия до полного прекращения потока. По две аликвоты каждого образца немедленно замораживали и выдерживали при -80°С до проведения дополнительного анализа с помощью метода ELISA. После получения образцов СМЖ каждую мышь помещали в лежачее положение на спину, вскрывали грудной отдел и вносили иглу 26-размера, присоединенную к шприцу вместимость 1 см, в камеру правого желудочка сердца. Осуществляли слабый отсос через иглу и собирали кровь в ЭДТК и затем использовали для получения плазмы. Для получения плазмы образцы крови каждой мыши центрифугировали при 1750 об/мин (700×g) в течение 10 мин в центрифуге (GS - 6R, фирма Beckman), используя ротор для качающихся корзин (GH - 3.8, фирма Beckman). Плазму замораживали при -20°С и хранили до проведения дальнейшего анализа. После отбора образцов крови осуществляли внутрисердечную перфузию трансгенных мышей 0,9% хлорида натрия. Головной мозг быстро изымали и отрезали мозжечок. Правое полушарие мозга всех мышей подвергали иммерсионной фиксации в свежеприготовленной смеси 4% параформальдегида/ЗФР (рН 7,4) в течение 1 ч при комнатной температуре. Затем головной мозг переносили в раствор ЗФР, содержащий 15% сахарозы, на 24 ч для гарантии криопротекции. На следующий день головной мозг замораживали в изопентане и хранили при -80°С до применения в гистологических исследованиях (SOP MET042). Левое полушарие взвешивали и замораживали в жидком азоте и хранили при -80°С для биохимического анализа.

VII) Определение уровней Aβ1-40 и Aβ1-42

В четырех различных фракциях гомогенатов головного мозга каждой Tg-мыши, а также в образцах СМЖ, оценивали уровни Аβ1-40 и Аβ1-42 с помощью метода ELISA. Тест-наборы ELISA с высокой чувствительностью к Aβ1-40 и Aβ1-42 покупали у фирмы The Genetics Company™, Швейцария (SOP MET058). СМЖ получали согласно описанному выше методу. Для получения гомогенатов головного мозга замороженные полушария гомогенизировали в забуференном ТРИС физиологическом растворе ((TBS) - буфер) (5 мл), содержащем коктейль ингибиторов протеаз. 1,25 мл этого первичного полученного в TBS гомогената головного мозга хранили при -80°С, 1,25 мл подвергали дополнительному изучению. Оставшийся гомогенат головного мозга (2,5 мл) центрифугировали и образовавшийся супернатант (=TBS-фракция) разделяли на аликвоты и выдерживали при -20°С для исследования с помощью ELISA. Дебрис суспендировали в Тритон Х-100 (2,5 мл), центрифугировали и супернатант (= Тритон Х-100-фракция) разделяли на аликвоты и выдерживали при -20°С. Эти стадии повторяли с использованием ДСН (2,5 мл). Дебрис ДСН-фракции суспендировали в 70% муравьиной кислоты (0,5 мл) для осуществления последующего центрифугирования. Полученный супернатант нейтрализовали с помощью 1М ТРИС (9,5 мл), разделяли на аликвоты и выдерживали при -20°С (= фракция муравьиной кислоты, FA-фракция). Образцы четырех фракций гомогенатов головного мозга (TBS, Тритон Х-100, ДСН и FA) применяли для определения уровней Aβ1-40 и Aβ1-42 с помощью метода ELISA. Тест-наборы для ELISA покупали у фирмы The Genetics Company™, Швейцария (SOP MET062). Следует отметить, что TBS и Тритон Х-100 солюбилизировали мономеры с образованием олигомерных структур. Полимеры типа протофибрил и нерастворимые в воде фибриллы могли растворяться в ДСН и FA. Поэтому исследование всех четырех фракций также позволяет получать сведения о статусе полимеризации Аβ.

VIII) Оценка морфологического строения головного мозга

Ткани головного мозга всех изученных Tg-животных подвергали совершенно одинаковой обработке для того, чтобы избежать влияния вариации этой процедуры. Из половины образцов головного мозга, полученных из 24 Tg-мышей (по 8 в каждой группе), приготавливали по 20 сагиттальных криосрезов на слой (всего 5 слоев), каждый толщиной 10 мкм (Leica CM 3050S) и 5 (по одному из каждого слоя) обрабатывали и оценивали количественно загрузку бляшками. Пять сагиттальных слоев соответствовали чертежам 104-105, 107-108, 11-112, 115-116 и 118-119 в морфологическом атласе «The Mouse Brain» Paxinos и Franklin (2-е изд.). Первый слой в соответствии с требованиями включал весь гиппокамп с его областями СА1, СА2, СА3, GD1b и GDmb. Иммунореактивность оценивали количественно в гиппокампе и в корковом слое с использованием моноклонального специфического для человеческого А(3 антитела 6Е10 (фирма Signet), а также путем окрашивания тиофлавином S. Остальные неиспользованные полушария или ткани сберегали и хранили согласно JSW CNS до окончания проекта.

б) Осуществление оценки

I) Поведение

В опытах с использованием водного лабиринта Морриса с помощью специальной компьютерной программы оценивали для каждого Tg-животного длину дорожки, которую проплывали животные, латентность избегания, скорость плавания и в пробном испытании количество пересечений предыдущего положения платформы и время, проведенное в каждом квадранте бассейна.

II) Биохимическая оценка

Образцы СМЖ всех Tg-мышей, а также препараты головного мозга анализировали с помощью имеющихся в продаже Aβ1-40- и Aβ1-42-ELISA. Параллельно осуществляли оценку соответствующих стандартов. Образцы препаратов головного мозга анализировали с дублированием. Из-за небольшого размера образца образцы СМЖ анализировали только с использованием одного измерения.

III) Гистология

II) Оценка отложения амилоида и загрузки бляшками

Для иммуногистохимического анализа с помощь 6Е10 использовали следующую процедуру оценки:

аа) контрастировали изображение для визуализации границ среза без применения контраста для изображения;

бб) интерактивно очерчивали кортикальные контуры и затем измеряли кортикальную площадь (=площадь области);

вв) интерактивно очерчивали представляющую интерес область (AOI), в которой окрашенные объекты выявляли на основе определенной интенсивности относительно порогового уровня (одинаковый для каждого изображения) и по размеру, превышающему 8 мкм2;

гг) измеряли площадь каждого объекта, сумму окрашенных площадей в AOI, а также количество объектов после однородного контрастирования с целью повышения соотношения сигнал/шум (одинаковое для каждого изображения);

дд) повторяли стадии аа)-гг) для гиппокампа;

ее) рассчитывали средний размер бляшек (= «сумма площадей бляшек/количество бляшек»), относительное количество бляшек и площадь (= «количество бляшек/площадь области» и «сумма площадей бляшек/площадь области × 100»);

жж) автоматически экспортировали данные в программу Excel для обработки крупноформатных таблиц, включая следующие параметры «обозначение изображения, площадь области, количество бляшек, сумма площадей бляшек, относительное количество бляшек, относительная площадь бляшек и средний размер бляшек». Поле для комментариев использовали для регистрации качества изображения и критериев исключения соответственно. Критериями исключения являлись: отсутствие частей среза, большое количество складок, наличие доминирующих трещин или противоречивая (изменчивая) окраска (например, из-за выпуклостей, которые могут препятствовать полной реакции блокирующего реагента);

зз) закрывали изображение, не запасая его (чтобы держать необработанные данные в исходном состоянии).

Пример 27. Определение активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, при лечении диабета типа 2

Целью исследования было определение активности предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, в отношении лечения диабета типа 2, прежде всего определение действия длительной обработки предлагаемыми в изобретении молекулами-конъюгатами, являющимися транспортерами карго-молекул, на модели на мышах линии db/db диабета типа 2 по уровням глюкозы в крови натощак каждые три дня (28 дней).

а) Материалы и методы

I) Животные

В целом двадцать (20) самцов мышей линии db/db (8-недельного возраста) получали от фирмы Charles River (Германия). После прибытия животных разделяли на группы (n=6-7/группу) и содержали на обычном корме для грызунов (корм Altromin standard №1324; фирма С.Petersen, Рингстед, Дания) и, если не указано иное, животные имели свободный доступ к воде.

Мышей содержали при световом цикле 12 ч света/12 ч темноты (свет включали в 4:00 и свет выключали в 16:00) и при контролируемой температуре и влажности в помещении.

II) Группы и рандомизация

В день -4 мышей произвольно разделяли на группы в зависимости от уровня глюкозы в крови (натощак; уровень глюкозы в крови измеряли с помощью анализатора Biosen S line (фирма EKF diagnostic, Германия), группы подвергали одному из следующих вариантов обработки лекарственным средством (n=6):

1) наполнитель, контроль, s.c. (физиологический раствор),

2) предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220; 1 мг/кг; s.c.,

3) предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220; 10 мг/кг; s.c.

Все указанные дозы даны в пересчете на свободное основание. Чистота лекарственного средства: 95,28%, содержание пептидов: 78,0%. Все соединения вводили подкожно (s.c.) в объеме 3 мл/кг. Инструкции по приготовлению препаративных форм для применяемого в качестве контроля наполнителя и предлагаемых в изобретении молекул-конъюгатов, являющихся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, включали следующие этапы:

Сначала предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, растворяли в наполнителе. Препаративные формы (концентрации 0,33 и 3,3 мг/мл, соответствующие дозам 1 и 10 мг/кг соответственно) приготавливали согласно описанной ниже процедуре. Рассчитывали концентрации и выражали их величины с учетом чистоты субстанции и содержания пептидов (коэффициент умножения 1,346).

- Получение маточного раствора: высушенные вымораживанием предлагаемые в изобретении молекулы-конъюгаты, являющиеся транспортерами карго-молекул, которые содержат полученные из ТАТ конструкции транспортеров, последовательность которых представлена в любой из SEQ ID NO:8-136, и полученные из JNK1 или IB1 карго-пептиды, последовательность которых представлена в любой из SEQ ID NO:137-220, оттаивали в течение минимум 1 ч и приготавливали в виде маточного раствора в наполнителе в концентрации 1 мМ. Готовили аликвоты для каждого дня обработки и хранили примерно при -80°С. Разведения этого маточного раствора до требуемых концентраций осуществляли в каждый день обработки;

- Хранение маточного раствора: примерно при -80°С;

- Хранение разведенных препаратов: при комнатной температуре в течение максимум 24 ч.

Перед солюбилизацией порошок хранили при -20°С. Стабильность маточного раствора сохранялась в течение 3 месяцев при хранении примерно при -80°С; стабильность разведенных препаративных форм для обработки животных сохранялась в течение 24 ч при хранении при комнатной температуре. Неиспользованный разбавленный продукт можно было хранить в течение периода времени, составлявшего вплоть до 7 дней, если хранение осуществляли при 4-8°С.

в) Экспериментальная процедура

После акклиматизации в течение 8 дней мышей обрабатывали ежедневно в 08.00 AM в течение 21 дня путем соответствующего указанным группам s.c.-введения доз за 8 ч до выключения света в 04.00 РМ.

I) Уровень глюкозы в крови

Уровень глюкозы оценивали у голодавших в течение 7 ч животных через 6 ч после дозирования, для чего собирали по 10 мкл образцов крови из хвостовой вены в пробирку для гематокритной центрифуги и затем анализировали на анализаторе Biosen s-line (фирма EKF-diagnostic; Германия).

II) Клетки для изучения метаболизма (метаболические клетки)

Группы 1+3: Мышей помещали в метаболические клетки для регистрации в течение 24 ч потребления корма, воды, а также выделения в течение 24 ч мочи и экскрементов. Мышей подразделяли на 2 подгруппы n=6-7 и затем осуществляли изучение метаболических характеристик.

III) Панель адипокинов

Группы 1+3: Трижды получали образцы крови из хвостовой вены, используя покрытые ЭДТК пробирки для гематокритной центрифуги (100 мкл). После центрифугирования крови собирали плазму и хранили при -20°С до осуществления оценки. Затем определяли следующую панель адипокинов/цитокинов, используя 7-плексный набор фирмы Luminex: лептин, резистин, МСР-1, PAI-1, TNFα, инсулин и интерлейкин-6 (IL-6).

IV) Окончание опыта

Группы 1+3 (день 111): Изымали и взвешивали следующие органы: ингвинальный подкожный жир, эпидидимальный жир, ретроперитонеальный жир, головной мозг, печень, почка, селезенка и сердце. Образцы всех указанных выше органов приготавливали в 4% PFA для возможной гистопатологической оценки в будущем. Кроме того, готовили образцы поджелудочных желез (целиком) для возможных стереологических и иммуногистохимических анализов, а образцы глаз готовили для возможных анализов ретинопатии. Группа 2 (день 28): Не получали образцов тканей или плазмы.

Пример 28. Популяции человеческих лейкоцитов в качестве мишеней для производных ТАТ

Получали первичные человеческие лейкоциты (WBC) из цельной крови после лизиса эритроцитов. WBC инкубировали с 1 мкМ D-TAT (SEQ ID NO:4)-ФИТЦ или r3- L-TAT (SEQ ID NO:15)-ФИТЦ в течение 30 мин при 37°С, отмывали кислым буфером и окрашивали флуоресцентномеченными антителами к специфическим поверхностным маркерам разных типов клеток (CD 14 для моноцитов, CD 15 для полиморфно-ядерных лейкоцитов, CD3 для Т-лимфоцитов, CD19 для В-лимфоцитов). И, наконец, клетки, содержащие D-TAT-ФИТЦ и r3-L-ТАТ-ФИТЦ, анализировали с помощью проточной цитометрии для оценки содержания в них соответствующего транспортера. Мишенью обоих производных ТАТ являлись популяции человеческих лейкоцитов. dTAT и r3LTAT связывались с моноцитами, нейтрофилами и Т-лимфоцитами и менее эффективно с В-лимфоцитам. Обнаружено небольшое различие специфичности между dTAT и r3-L-TAT, d-TAT, вероятно, более эффективно связывался с Т-лимфоцитами, чем r3-L-TAT.

Пример 29. Поглощение выбранных конструкций транспортеров, предлагаемых в настоящем изобретении, различными типами клеток

Клетки высевали в предварительно сенсибилизированные поли-D-лизином 96-луночные планшеты с плотностью, соответствующей субконфлюэнтной культуре (которая может варьироваться в зависимости от применяемого типа клеток). Затем различные сцепленные с ФИТЦ транспортеры в концентрации 3 мкМ инкубировали с клетками в течение 15 ч. После этого клетки выдерживали на льду для осуществления остальной процедуры. Для удаления связанных с клеточной поверхностью пептидов клетки сначала отмывали дважды, используя кислотную отмывку, для удаления связанных с плазматической мембраной молекул. Затем клетки отмывали дважды ЗФР и лизировали с помощью стандартного буфера для лизиса в течение 30 мин. Затем планшеты, содержащие клеточные лизаты, центрифугировали в течение 5 мин при 1500 об/мин при 4°С. Затем прозрачный супернатант собирали и переносили в черный 96-луночный планшет для оценки флуоресценции внутриклеточного ФИТЦ. Применяли следующие клетки:

Клеточные линии, относящиеся к лейкоцитам: HepG2 : клетки гепатокарциномы не (человеческие)
А549: эпителиальные клетки легкого (человеческие)
Линии клеток лейкоцитов: Raw: клетки макрофагов (мышиные)
J77: клетки макрофагов (мышиные)
Первичные очищенные лейкоциты: BMDM: макрофаги из костного мозга (мышиные)

Результаты выражали в виде процента поглощения D-TAT (SEQ ID NO:251) (фиг.17) или r3-L-TAT (SEQ ID NO:20) (фиг.18). Для всех конструкций транспортеров обнаружено поглощение соответствующими клетками, хотя и с различной скоростью.

1. Конструкция пептидного транспортера, которая содержит последовательность, соответствующую rXXXrXXXr (SEQ ID NO: 252), в которой:
r обозначает D-энантиомерный аргинин;
X обозначает любую L-аминокислоту; и в которой X каждый независимо друг от друга можно выбирать из любого другого X в SEQ ID NO: 252.

2. Конструкция пептидного транспортера по п. 1, в которой по меньшей мере 4 из указанных 6 X, которые обозначают L-аминокислоты, индивидуально выбирают из группы L-аминокислот, включающей K и R.

3. Конструкция пептидного транспортера по п. 1, которая содержит последовательность, которую выбирают из последовательностей SEQ ID NO: 20-122.

4. Конструкция пептидного транспортера по п. 3, которая содержит последовательность, которую выбирают из последовательностей SEQ ID NO: 20-21.

5. Молекула-конъюгат, которая является транспортером карго-молекулы, содержащая:
а) компонент (А), где этот компонент содержит конструкцию транспортера по любому из пп. 1-4, и
б) компонент (Б), содержащий эффекторную молекулу.

6. Молекула-конъюгат, которая является транспортером карго-молекулы, по п. 5, в которой эффекторная молекула выбрана из терапевтически активных белков и пептидов, ингибиторов протеинкиназ, ингибиторов протеинкиназы, такой как аминоконцевая киназа c-Jun, антигенов, антител, проапоптозных факторов, протеаз, участвующих в патологических состояниях, предпочтительно ингибиторов пептидных протеаз, ВН3-доменов или белков «ВН3-только», нуклеиновых кислот, кодирующих эти белки, siРНК, антисмысловых РНК, цитотоксических агентов и небольших органических соединений, включающих ингибиторы протеаз.

7. Молекула-конъюгат, которая является транспортером карго-молекулы, по п. 5 или 6, содержащая также по меньшей мере один дополнительный компонент (В), (Г) и/или (Д), отличный от компонента (Б), где по меньшей мере один необязательный дополнительный компонент (В), (Г) и/или (Д) выбран независимо друг от друга из других эффекторных молекул или их фрагментов или вариантов, указанных в качестве компонента (Б).

8. Молекула-конъюгат, которая является транспортером карго-молекулы, по п. 5 или 6, в которой компоненты (А) и (Б) и необязательные компоненты (В), (Г) и/или (Д) ковалентно связаны друг с другом.

9. Молекула-конъюгат, которая является транспортером карго-молекулы, по п. 5 или 6, в которой по меньшей мере один дополнительный компонент (В), (Г) и/или (Д) выбран из сигнальной последовательности или локализующей последовательности, которая обеспечивает направленность молекулы-конъюгата, которая является транспортером карго-молекулы, в конкретную внутриклеточную целевую область локализации или в конкретный тип клеток.

10. Молекула-конъюгат, которая является транспортером карго-молекулы, по п. 5 или 6, в которой компонент (Б) и/или по меньшей мере один дополнительный компонент (В), (Г) и/или (Д) представляет(ют) собой белковую или пептидную последовательность и состоит(ят) из L-аминокислот, D-аминокислот или их смесей.

11. Молекула-конъюгат, которая является транспортером карго-молекулы, по п. 5 или 6, в которой компонент (А) расположен на С-конце молекулы-конъюгата, которая является транспортером карго-молекулы, при условии, что компонент (Б) представляет собой белковую или пептидную последовательность.

12. Композиция для применения в генной терапии или для переноса карго-молекулы в клетки или ткань пациента, подлежащего лечению, содержащая молекулу-конъюгат по одному из пп. 5-11 и необязательно фармацевтически приемлемый носитель и/или наполнитель.

13. Применение конструкции транспортера по одному из пп. 1-4 для получения молекулы-конъюгата, которая является транспортером карго-молекулы.

14. Применение конструкции транспортера по п. 13, в котором молекула-конъюгат, которая является транспортером карго-молекулы, определена по одному из пп. 5-11.

15. Применение конструкции транспортера по одному из пп. 1-4 или молекулы-конъюгата, которая является транспортером карго-молекулы, по одному из пп. 5-11 для переноса карго-молекулы в клетки или ткань пациента, подлежащего лечению.

16. Применение по п. 15, в котором карго-молекула определена по любому из пп. 5-11.

17. Применение по п. 15 или 16 для переноса карго-молекулы в лейкоциты и/или нервные клетки, прежде всего пациента, подлежащего лечению.

18. Применение молекулы-конъюгата, которая является транспортером карго-молекулы, по одному из пп. 5-11 для приготовления лекарственного средства, предназначенного для профилактики или лечения и/или уменьшения интенсивности рака или опухолевых заболеваний, включая болезни, связанные с нарушенным апоптозом, воспалительные заболевания, инфекционные болезни, вирусные (инфекционные) болезни, болезни, в значительной степени связанные с передачей сигналов JNK, аутоиммунные нарушения или заболевания, сердечно-сосудистые заболевания, нейронные или нейродегенеративные заболевания, болезни печени, болезни позвоночника, болезни матки, большие депрессивные нарушения, нехронические или хронические заболевания пищеварительной системы, потерю слуха, болезни внутреннего уха, или предназначенного для применения при трансплантации ткани.



 

Похожие патенты:

Изобретение относится к области биотехнологии, генной инженерии и иммунологии. Раскрыты связывающие gp41 ВИЧ-1 одноцепочечные 3-нитиевые альфа-спиральные суперспирализованные молекулы, обозначенные как "Альфатела".

Изобретение относится к области биотехнологии. Описано применение специфических молекул-конъюгатов, которые являются транспортерами карго-молекул, для транспортировки представляющей интерес субстанции в лейкоциты.

Изобретение относится к области биотехнологии. .

Изобретение относится к области биотехнологии, вирусологии и иммунологии. .

Изобретение относится к области биотехнологии, вирусологии и медицины. .

Изобретение относится к области вирусологии и генетической инженерии. .

Изобретение относится к нуклеиново-кислотным конструкциям, а также к вакцинным препаратам, содержащим такие конструкции, и к применению таких препаратов в медицине.

Настоящее изобретение относится к медицине, а именно к терапии и иммунологии, и касается лечения болезни Дего. Для этого вводят эффективное количество ингибитора комплемента в виде монотерапии или в составе общепринятой комплексной терапии.

Изобретение касается вакцины для предупреждения инфекции, вызванной по меньшей мере одним из Leptospira, герпес-вируса коров, вируса парагриппа и коровьего респираторного синцитиального вируса.

Изобретение относится к медицине, а именно к терапии и эндокринологии, и касается лечения заболеваний, связанных с нарушениями эндоканнабиноидной системы. Для этого предложено лекарственное средство на основе антител к каннабиноидному рецептору человека, полученное в процессе многократного последовательного разведения этих антител и промежуточного внешнего механического воздействия.
Группа изобретений относится к иммуногенной водной композиции, содержащей биологический антиген и полимер акриловой кислоты, причем данная композиция содержит электролит для обеспечения по меньшей мере на 30% более высокой осмолярности, чем осмолярность водного раствора 0,9 мас./об.% хлорида натрия.

Изобретение относится к медицине, а именно к эндокринологии, и касается лечения сахарного диабета. Для этого на фоне лечения диабета инсулином и/или гипогликемическими препаратами дополнительно вводят фармацевтическую композицию, содержащую активированную-потенцированную форму антител к рецептору инсулина и активированную-потенцированную форму антител к эндотелиальной NO-синтазе.

Настоящая группа изобретений относится к медицине, а именно к урологии, и касается лечения доброкачественной гиперплазии предстательной железы и абактериального простатита.
Изобретение относится к области фармацевтики и касается адъюванта, его применения для получения композиции, непосредственно композиции и набора. Охарактеризованный адъювант представляет собой смесь трех активных соединений, содержащихся в количестве, составляющем соответственно 20-50%, 20-50% и 40-60% от массы всего адъюванта, со следующей структурой: соединение 1: β-N-ацетил-D-глюкозаминил-(1→4)-N-ацетил-D-мурамоил-L-аланил-D-изоглютаминил-мезо-диаминопимелиновая кислота (ГМтри); соединение 2: β-N-ацетил-D-глюкозаминил-(1→4)-N-ацетил-D-мурамоил-L-аланил-D-изоглютаминил-мезо-диаминопимелоил-D-аланин (ГМтетра), и соединение 3: димера ГМтетра (диГМтетра). Связь между мономерными остатками ГМтетра осуществляется за счет карбоксильной группы терминального D-аланина одного остатка ГМтетра и ω-аминогруппы мезо-диаминопимелиновой кислоты другого остатка Гмтетра.

Группа изобретений относится к медицине и фармакологии и касается лечения рассеянного склероза. Предложены: фармацевтическая композиция указанного назначения для детей, содержащая 0,25 мг и менее 2-амино-2-[2-(4-С2-С20алкилфенил)этил]пропан-1,3-диола или его фармацевтически приемлемой соли для введения 1 раз в день, применение указанного соединения (FTY720) по 0,25 мг и менее для изготовления лекарственного средства для лечения, предупреждения или замедления развития рассеянного склероза у пациента педиатрического возраста для введения 1 раз в день и соответствующий способ лечения, предупреждения или замедления развития рассеянного склероза у пациента педиатрического возраста.

Изобретение относится к медицине, а именно стоматологии, и может быть использовано для лечения больных пародонтитом. Для этого сначала проводят снятие над- и поддесневых зубных отложений ультразвуковым аппаратом «PerioScan» одномоментно с антисептической обработкой раствором «Октенисепт» в разведении 1:10.

Изобретение относится к области биотехнологии, конкретно к рекомбинантным вакцинам против Candida albicans, и может быть использовано в медицине. Вакцина для лечения или предупреждения кандидозной инфекции содержит выделенный полипептид с SEQ ID NO: 2 в эффективном количестве, который может быть слит с партнером слияния.

Настоящая группа изобретений относится к медицине, а именно к терапии и фармакологии, и может быть использована для повышения фармакологической активности действующего вещества лекарственного средства. Для этого лекарственное средство, содержащее активированную потенцированную форму антител к антигену, участвующему в патогенезе заболевания, вводят в сочетании с активированной потенцированной формой антител к эндотелиальной NO-синтазе. Такое сочетанное введение обеспечивает повышение терапевтической эффективности лекарственного средства за счет усиливающего действия активированных потенцированных антител к NO-синтазе. 2 н. и 8 з.п. ф-лы, 26 табл., 16 пр.
Наверх