Антитела к тау и способы применения



Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
Антитела к тау и способы применения
C07K2317/24 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2661111:

ДЖЕНЕНТЕК, ИНК. (US)
АЦ ИММУНЕ С.А. (CH)

Настоящее изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий участок, способные к связыванию с фосфорилированным эпитопом на тау-белке человека с высокой специфичностью и/или аффинностью. Также рассмотрен фармацевтический состав, иммуноконъюгат, нуклеиновая кислота, кодирующая такое антитело или его антигенсвязывающий участок, клетка-хозяин и способ получения антитела или его антигенсвязывающего участка. Кроме того, описано применение антитела или его антигенсвязывающего участка для производства лекарственного средства. Данное изобретение может найти дальнейшее применение при лечении различных состояний, ассоциированных с тау-белком, в частности таупатии, болезни Альцгеймера и лобно-височных деменций. 9 н. и 38 з.п. ф-лы, 15 ил., 12 табл.

 

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к антителам к тау, таким как антитела, которые связываются с фосфорилированным эпитопом на тау-белке с высокой специфичностью и/или высокой аффинностью, и способам их применения.

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

Нейрофибриллярные клубки и нити нейропилей (НК) являются основными нейропатологическими признаками болезни Альцгеймера (БА). НК состоят из тау-белка, ассоциированного с микротрубочками, который подвергся посттрансляционным модификациям, включая фосфорилирование, и развиваются путем агрегации гиперфосфорилированных конфомеров тау. Эта патология является общей для БА и многих нейродегенеративных таупатий, в частности, конкретных типов лобно-височных деменций (ЛВД). Тау-белок, по-видимому, является основным игроком в гибели когнитивных функций при БА и родственных нейродегенеративных таупатиях.

Терапевтические подходы, которые нацелены на тау-белок, являются редкими и включают в себя, в основном, ингибиторы киназ, которые, как считают, повышают фосфорилирование тау до патологических уровней, и соединения, которые блокируют цитоплазматическую агрегацию гиперфосфорилированного тау-белка. Эти подходы страдают различными недостатками, связанными со специфичностью и эффективностью. Ранее были описаны антитела мыши, которые связываются с фосфорилированными патологическими конфомерами тау, например, в WO 2012/045882. Однако все еще существует потребность в дополнительной пассивной и/или активной иммунотерапии, которая работает как противодействие патологическим конфомерам белка, о которых известно или предполагается, что они вызывают нейродегенеративные нарушения, такие как амилоидная патология при БА, вызванная, например, внутринейронными агрегатами гиперфосфорилированного тау-белка, которые являются типичными при БА в виде амилоида.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к антителам к тау, таким как антитела, которые связываются с фосфорилированным эпитопом на тау-белке с высокой специфичностью и/или высокой аффинностью, и способам их применения.

В одном из аспектов настоящее изобретение относится к изолированному антителу, которое связывается с фосфорилированным эпитопом тау-белка, где антитело, содержит по меньшей мере одну последовательность, выбранную из группы, состоящей из HVR-L1, HVR-L2 и HVR-L3, где: (a) HVR-L1 содержит аминокислотную последовательность X1SSQX2LX3X4X5X6GX7TYX8H (SEQ ID NO:89), где X1=R или T; X2=S, R или V; X3=V, I или R; X4=H или R; X5=S, R, G или; X6=H, N, R, K или G; X7=K или R; и X8=L или V; (b) HVR-L2 содержит аминокислотную последовательность KVX9X10RFX11 (SEQ ID NO:90), где X9=S, K или R; X10=N, K или H; и X11=S, F, G, K, R, Y или L; и (c) HVR-L3 содержит аминокислотную последовательность SQTX12X13FPX14T (SEQ ID NO:91), где X12=A или R; X13=H, R, Q или Y; X14=Y или R; и где антитело не содержит HVR-L1, HVR-L2 и HVR-L3, где аминокислотная последовательность HVR-L1 представляет собой RSSQSLVHSHGTYLH (SEQ ID NO:15) или RSSQRLVHSHGTYLH (SEQ ID NO:92); аминокислотная последовательность HVR-L2 представляет собой VSNRFS (SEQ ID NO:16); и аминокислотная последовательность HVR-L3 представляет собой SQTAHFPYT (SEQ ID NO:30).

В определенных вариантах осуществления антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белка, который включает фосфорилированный аминокислотный остаток, выбранный из группы, состоящей из серина в положении 409 тау человека (SEQ ID NO:59), серина в положении 404 тау человека (SEQ ID NO:59) и серина в положении 404 и 409 тау человека (SEQ ID NO:59).

В некоторых вариантах осуществления антитело по настоящему изобретению содержит по меньшей мере одну последовательность, выбранную из группы, состоящей из HVR-H1, HVR-H2 и HVR-H3, где HVR-H1 содержит аминокислотную последовательность GYTFTDYYMN (SEQ ID NO:33); HVR-H2 содержит аминокислотную последовательность DINPNRGGTTYNQKFKG (SEQ ID NO:34); и HVR-H3 содержит аминокислотную последовательность YYAVGY (SEQ ID NO:35).

В конкретных вариантах осуществления, антитело по настоящему изобретению содержит по меньшей мере одну последовательность, выбранную из группы, состоящей из HVR-L1, HVR-L2 и HVR-L3, где (a) HVR-L1 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14; (b) HVR-L2 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, и (c) HVR-L3 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32.

В конкретных вариантах осуществления антитело по настоящему изобретению содержит HVR-L1, HVR-L2 и HVR-L3, где (a) HVR-L1 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14; (b) HVR-L2 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, и (c) HVR-L3 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32.

В одном из вариантов осуществления антитело по настоящему изобретению содержит (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:1; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:16; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27.

В одном из вариантов осуществления антитело по настоящему изобретению содержит (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:2; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:17; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27.

В одном из вариантов осуществления антитело по настоящему изобретению содержит (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:8; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:21; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:29.

В одном из вариантов осуществления антитело по настоящему изобретению содержит (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:14; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:25; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:31.

В одном из вариантов осуществления антитело по настоящему изобретению содержит (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:9; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:17; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:31.

В конкретных вариантах осуществления антитело по настоящему изобретению содержит последовательность вариабельного домена легкой цепи (VL), выбранную из группы, состоящей из SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:44, SEQ ID NO:54, и SEQ ID NO:55, или VL, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 98% идентичности последовательности с аминокислотной последовательностью, выбранной из группы, состоящей из SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:44, SEQ ID NO:54 и SEQ ID NO:55.

В определенном варианте осуществления антитело по настоящему изобретению содержит последовательность вариабельного домена тяжелой цепи (VH) из SEQ ID NO:58 или последовательность VH, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 98% идентичности последовательности с аминокислотной последовательностью из SEQ ID NO:58.

В некоторых вариантах осуществления антитело по настоящему изобретению представляет собой моноклональное антитело. В некоторых вариантах осуществления антитело по настоящему изобретению представляет собой человеческое, гуманизированное или химерное антитело. В конкретных вариантах осуществления антитело по настоящему изобретению представляет собой человеческое или гуманизированное антитело.

В конкретных вариантах осуществления, антитело по настоящему изобретению представляет собой полноразмерное антитело IgG1. В других конкретных вариантах осуществления, антитело по настоящему изобретению представляет собой полноразмерное антитело IgG4. В других конкретных вариантах осуществления, антитело по настоящему изобретению представляет собой полноразмерное антитело IgG1 N297G. Еще в других конкретных вариантах осуществления, антитело по настоящему изобретению представляет собой фрагмент антитела, который связывается с фосфорилированным эпитопом на тау-белке человека.

В определенных вариантах осуществления антитело по настоящему изобретению связывается с тау-белком, который представляет собой тау-белок человека (например, тау-белок из SEQ ID NO:59).

В некоторых вариантах осуществления антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белка, но не связывается с тем же самым эпитопом тау-белка, который не фосфорилирован. В некоторых вариантах осуществления антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белка, но связывается с тем же самым эпитопом тау-белка, который не фосфорилирован, по существу, со сниженной аффинностью. В конкретных вариантах осуществления антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белка, где тау-белок содержит аминокислотную последовательность из SEQ ID NO:59. В одном из вариантов осуществления антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белком человека, содержащим аминокислотные остатки 404-411 (SEQ ID NO:59).

В конкретных вариантах осуществления, антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белка с Kd приблизительно от 1 нМ до 45 нМ. В одном из вариантов осуществления антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белка с Kd≤1 нМ. В конкретных вариантах осуществления, антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белка с константой скорости диссоциации ≤5×10-3 с-1. В конкретных вариантах осуществления, антитело по настоящему изобретению связывается с фосфорилированным эпитопом тау-белка с константой скорости ассоциации ≥3×105 М-1⋅с-1 или ≥7×105 М-1⋅с-1.

В некоторых вариантах осуществления антитело по настоящему изобретению связывается с тау-белком, который представляет собой агрегированный ассоциированный с микротрубочками и/или гиперфосфорилированный тау-белок, такой как тау-белок, который присутствует в парных спиральных филаментах (ПСФ).

В другом аспекте настоящее изобретение относится к изолированной нуклеиновой кислоте, кодирующей любое из антител, описываемых в настоящем документе.

В еще одном аспекте настоящее изобретение относится к клетке-хозяину, которая содержит изолированную нуклеиновую кислоту, кодирующую любое из антител, описываемых в настоящем документе. В определенных вариантах осуществления настоящее изобретение относится к способам получения антитела, включающим культивирование такой клетки-хозяина таким образом, что вырабатывается антитело.

В еще одном аспекте настоящее изобретение относится к иммуноконъюгату, содержащему любое из антител, описываемых в настоящем документе, и цитотоксическое средство.

В дополнительном аспекте настоящее изобретение относится к фармацевтическому составу, содержащему любое из антител, описываемых в настоящем документе, и фармацевтически приемлемый носитель.

В некоторых аспектах настоящее изобретение относится к антителу, описываемому в настоящем документе (любому из антител, описываемых в настоящем документе), для применения в качестве лекарственного средства. В некоторых вариантах осуществления антитело по настоящему изобретению предназначено для применения для лечения заболевания или нарушения, ассоциированного с тау-белком, у индивидуума. В конкретных вариантах осуществления антитело по настоящему изобретению предназначено для лечения таупатии у индивидуума. В конкретном варианте осуществления антитело по настоящему изобретению предназначено для применения для лечения болезни Альцгеймера (БА) у индивидуума. В конкретном варианте осуществления антитело по настоящему изобретению предназначено для применения для лечения лобно-височной деменции (ЛВД) у индивидуума. В некоторых вариантах осуществления антитело по настоящему изобретению предназначено для применения для лечения ухудшения или потери когнитивных функций у индивидуума. В конкретном варианте осуществления антитело по настоящему изобретению предназначено для применения для снижения или модулирования общих уровней тау-белка в головном мозге индивидуума. В конкретном варианте осуществления антитело по настоящему изобретению предназначено для применения для снижения или модулирования общих уровней фосфорилированного или гиперфосфорилированного тау-белка в головном мозге индивидуума.

В определенных вариантах осуществления антитело по настоящему изобретению предназначено для применения в производстве лекарственного средства для лечения заболевания или нарушения у индивидуума, выбранных из заболевания или нарушения, ассоциированного с тау-белком, таупатии, БА, ЛВД и ухудшения или потери когнитивных функций у индивидуума. В некоторых вариантах осуществления антитело по настоящему изобретению предназначено для применения в производстве лекарственного средства для снижения или модулирования общих уровней тау-белка в головном мозге индивидуума. В некоторых вариантах осуществления антитело по настоящему изобретению предназначено для применения в производстве лекарственного средства для снижения или модулирования общих уровней фосфорилированного или гиперфосфорилированного тау-белка в головном мозге индивидуума.

В определенных вариантах осуществления настоящее изобретение относится к способам лечения индивидуума с заболеванием или нарушением, выбранным из заболевания или нарушения, ассоциированного с тау-белком, таупатии, БА, ЛВД и ухудшения или потери когнитивных функций, способам, включающим введение индивидууму эффективного количества антитела, описываемого в настоящем документе (любого из антител, описываемых в настоящем документе). В одном из вариантов осуществления заболевание или нарушение, которое лечат в соответствии со способами по изобретению, представляет собой БА.

В определенных вариантах осуществления настоящее изобретение относится к способам снижения уровней общего тау-белка, фосфорилированного тау-белка или гиперфосфорилированного тау-белка в головном мозге индивидуума, включающим введение индивидууму эффективного количества антитела, описываемого в настоящем документе (любого из антител, описываемых в настоящем документе) для снижения уровней общего тау-белка, фосфорилированного тау-белка или гиперфосфорилированного тау-белка в головном мозге индивидуума. В некоторых вариантах осуществления настоящее изобретение относится к способам модулирования уровней общего тау-белка, фосфорилированного тау-белка или гиперфосфорилированного тау-белка в головном мозге индивидуума, включающим введение индивидууму эффективного количества антитела, описываемого в настоящем документе (любого из антител, описываемых в настоящем документе), для модулирования уровней общего тау-белка, фосфорилированного тау-белка или гиперфосфорилированного тау-белка в головном мозге индивидуума.

В конкретных вариантах осуществления индивидуум, которого лечат в соответствии со способами, описываемыми в настоящем документе, является человеком. В конкретных вариантах осуществления, антитела предназначены для введения человеку. В конкретных вариантах осуществления, применения, описываемые в настоящем документе, предназначены для лечения человека.

В другом аспекте настоящее изобретение относится к антителам для применения для детекции нейрофибриллярных клубков, нитей нейропилей и/или дистрофического неврита. В некоторых вариантах осуществления антитело, описываемое в настоящем документе (любое из антител, описываемых в настоящем документе), предназначено для применения для детекции заболевания или нарушения, ассоциированного с тау-белком, таупатии, БА, ЛВД. В конкретном варианте осуществления антитело, описываемое в настоящем документе (любое из антител, описываемых в настоящем документе), предназначено для применения для детекции БА.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Фигура 1 (A-C) показывает выравнивание аминокислотных последовательностей вариабельных областей легкой цепи, включая CDR, антитела 5202.4 и аффинно зрелых вариантов 5202.4 к pTau, т.е. от TAM1 до TAM23. Антитело 5202.4 имеет такую же вариабельную область тяжелой и легкой цепей, что и антитело hACI-36-2B6-Ab1, описанное в PCT/US 13/32341, поданной 15 марта 2013 года. Нумерация остатков приведена в соответствии с системой Kabat. Аминокислотные последовательности CDR указаны как "Kabat-CDR L1", "Kabat-CDR L2" и "Kabat-CDR L3". Остатки CDR анти-pTau аффинно зрелых вариантов, которые отличаются от последовательности 5202.4, выделены (см. остатки в черных рамках).

Фигура 2 (A-F). Связывание антител IgG с тау, фосфорилированным тау и pS129 альфа-синуклеином при измерении посредством ELISA. На фигуре 2 представлено связывание IgG1 5202.4, TAM1, TAM2, TAM9, TAM19, TAM20 и контроля (антитела 5B6 к gD) с нефосфорилированным полноразмерным тау, PKA-фосфорилированным полноразмерным тау, гиперфосфорилированным полноразмерным тау, монофосфорилированным (pS129) альфа-синуклеином или с непокрытой плашкой/BSA контролем.

Фигура 3. Связывание иммобилизованных антител IgG с биотинилированными пептидами, полученными из тау и содержащими pS404 и/или pS409, при измерении посредством ELISA. На фигуре 3 представлено связывание иммобилизованных антител IgG1 5202.4, TAM1, TAM2, TAM9, TAM19, TAM20 и контроля (5B6 анти-gD и без IgG) с биотинилированными пептидами, полученными из тау, включая пептиды, фосфорилированные как по серину 404, так и по серину 409 (pS404, pS409), пептиды, фосфорилированные по серину 404 (pS404), пептиды, фосфорилированные по серину 409 (pS409), нефосфорилированные пептиды или непептидный контроль. Использовали 10 нМ биотинилированных пептидов, показанных на фигуре 3, и 5 мкг/мл IgG.

Фигура 4 (A-E). Связывание антител IgG с иммобилизованными пептидами, полученными из тау и содержащими pS404 и/или pS409, при измерении посредством ELISA. На фигуре 4 представлено связывание иммобилизованных антител IgG1 5202.4, TAM1, TAM2, TAM9, TAM19, TAM20 и контроля (5B6 анти-gD и без IgG) с биотинилированными пептидами, полученными из тау, включая пептиды, фосфорилированные как по серину 404, так и по серину 409 (pS404, pS409), пептиды, фосфорилированные по серину 404 (pS404), пептиды, фосфорилированные по серину 409 (pS409), нефосфорилированные пептиды, непептидный контроль или фоновый контроль. Для каждого эксперимента связывания использовали 20 нМ биотинилированных пептидов и 5 различных концентраций IgG (т.е. 0,01 нМ, 0,1 нМ, 1 нМ, 10 нМ и 100 нМ IgG).

ПОДРОБНОЕ ОПИСАНИЕ ВАРИАНТОВ ОСУЩЕСТВЛЕНИЯ ИЗОБРЕТЕНИЯ

I. ОПРЕДЕЛЕНИЯ

"Акцепторный каркас человека" для целей настоящего документа представляет собой каркас, содержащий аминокислотную последовательность из каркаса вариабельного домена легкой цепи (VL) или каркаса вариабельного домена тяжелой цепи (VH), полученного из каркаса иммуноглобулина человека или консенсусного каркаса человека, как определено ниже. Акцепторный каркас человека "полученный из" каркаса иммуноглобулина человека или консенсусного каркаса человека может содержать такую же аминокислотную последовательность, или может содержать замены в аминокислотной последовательности. В некоторых вариантах осуществления число аминокислотных замен составляет 10 или меньше, 9 или меньше, 8 или меньше, 7 или меньше, 6 или меньше, 5 или меньше, 4 или меньше, 3 или меньше, или 2 или меньше. В некоторых вариантах осуществления акцепторный каркас VL человека идентичен по последовательности с каркасом VL иммуноглобулина человека или с последовательностью консенсусного каркаса человека.

"Аффинность" относится к силе общей суммы нековалентных взаимодействий между единичным участком связывания молекулы (например, антитела) и его партнера по связыванию (например, антигена). Если не указано иначе, применяемая в настоящем документе, "аффинность связывания", относится к внутренней аффинности связывания, которая отражает взаимодействие 1:1 между членами пары связывания (например, антитело и антиген). Аффинность молекулы X к ее партнеру Y, как правило, можно представить посредством константы диссоциации (Kd). Аффинность можно измерять путем общепринятых, известных в данной области способов, включая способы, описываемые в настоящем документе. Конкретные примеры и иллюстративные варианты осуществления для измерения аффинности связывания описаны ниже.

"Аффинно зрелое" антитело относится к антителу с одним или более изменениями в одной или более гипервариабельных областях (HVR), в сравнении с родительским антителом, которое не обладает такими изменениями; такие изменения приводят к улучшению аффинности антитела к антигену.

Термины "антитело к тау" и "антитело, которое связывается с тау" относятся к антителу, которое способно к связыванию с тау с достаточной аффинностью, таким образом, что антитело подходит в качестве диагностического и/или терапевтического средства, нацеленного на тау. В одном из вариантов осуществления степень связывания антитела к тау с неродственным, не-тау-белком составляет менее чем приблизительно 10% от связывания антитела с тау при измерении, например, радиоиммунологическим анализом (РИА). В определенных вариантах осуществления антитело, которое связывается с тау, имеет константу диссоциации (Kd) ≤1 мкМ, ≤100 нМ, ≤10 нМ, ≤1 нМ, ≤0,1 нМ, ≤0,01 нМ или ≤0,001 нМ (например 10-8 M или меньше, например от 10-8 M до 10-13 M, например от 10-9 M до 10-13 M). В определенных вариантах осуществления антитело к тау связывается с эпитопом тау, который является консервативным среди тау от разных видов. Термин "антитело/антитела к тау" включает антитело/антитела к pTau.

Термины "антитело к pTau" и "антитело, которое связывается с pTau" относятся к антителу, которое способно к связыванию с фосфорилированными эпитопами тау с достаточной аффинностью, таким образом, что антитело подходит в качестве диагностического и/или терапевтического средства, нацеленного на pTau. В одном из вариантов осуществления степень связывания антитела к pTau с не- pTau-белком составляет менее чем приблизительно 10% от связывания антитела с pTau при измерении, например, радиоиммунологическим анализом (РИА). В определенных вариантах осуществления антитело, которое связывается с pTau имеет константу диссоциации (Kd) ≤1 мкМ, ≤100 нМ, ≤10 нМ, ≤1 нМ, ≤0,1 нМ, ≤0,01 нМ или ≤0,001 нМ (например 10-8 M или меньше, например от 10-8 M до 10-13 M, например от 10-9 M до 10-13 M). В определенных вариантах осуществления антитело к pTau связывается с фосфорилированным эпитопом тау, который является консервативным среди тау от разных видов. В определенных вариантах осуществления антитело к pTau избирательно связывается с фосфоформой тау или эпитопом тау, который содержит фосфорилированные аминокислотные остатки. В других вариантах осуществления антитело к pTau не связывается, или связывается, по существу, со сниженной аффинностью с нефосфорилированным тау или эпитопом тау, который не фосфорилирован, по сравнению с фосфорилированным тау, фосфоформой тау или эпитопом тау, который содержит фосфорилированные аминокислотные остатки. В некоторых вариантах осуществления фосфорилированный тау или эпитоп тау содержит фосфорилированные серины в аминокислотных положениях 404, 409 или 404 и 409 аминокислотной последовательности тау человека.

Термин "антитело" в настоящем документе применяется в самом широком смысле и охватывает различные структуры антител, включая в качестве неограничивающих примеров моноклональные антитела, поликлональные антитела, полиспецифические антитела (например биспецифические антитела), и фрагменты антител при условии, что они проявляют желательную антигенсвязывающую активность.

"Фрагмент антитела" относится к молекуле, иной чем интактное антитело, которая содержит часть интактного антитела, связывающуюся с антигеном, с которым связывается интактное антитело. Примеры фрагментов антител в качестве неограничивающих примеров включают Fv, Fab, Fab', Fab'-SH, F(ab')2, диатела, линейные антитела, молекулы одноцепочечных антител (например scFv) и полиспецифические антитела, образованные из фрагментов антител.

"Антитело, которое связывается с тем же самым эпитопом", что и референсное антитело, относится к антителу, которое блокирует связывание референсного антитела с его антигеном в конкурентном анализе на 50% или больше, и наоборот, референсное антитело блокирует связывание антитела с его антигеном в конкурентном анализе на 50% или больше. Пример конкурентного анализа приведен в настоящем документе.

Термин "модулирующее антитело" относится к антителу или его функциональному фрагменту, как описано в настоящем документе в различных вариантах осуществления, который может или усиливать (например, активировать или стимулировать), угнетать (например, ингибировать или подавлять) или иным образом менять функциональное свойство, биологическую активность или уровень растворимого и/или нерастворимого тау-белка, в частности, растворимого фосфорилированного тау-белка в головном мозге, в частности, в коре головного мозга и/или гиппокампе животного, в частности, млекопитающего или человека с повышенными уровнями растворимого тау-белка и/или растворимого фосфорилированного тау-белка. Модулирующее антитело или его функциональный фрагмент может действовать, модулируя непосредственно или косвенно тау-белок или полипептид, кодирующий указанный тау-белок. В определенных вариантах осуществления модулирующее антитело или его функциональный фрагмент снижает уровни растворимого и нерастворимого тау-белка, в частности, растворимого фосфорилированного тау-белка в головном мозге, в частности, в коре головного мозга и/или гиппокампе животного, в частности, млекопитающего или человека с повышенными уровнями растворимого тау-белка и/или растворимого фосфорилированного тау-белка.

Фразы "по существу снижает" или "по существу различные", как применяют в настоящем документе, означает достаточно высокую степень различия между двумя числовыми значениями (как правило, одно, ассоциированное с молекулой и другое, ассоциированное с референсной молекулой/молекулой сравнения), такую, что специалист в данной области будет рассматривать разницу между двумя значениями как статистически значимую по отношению к биологической характеристике, которая измеряется указанными значениями (например, значения Kd). Различие между двумя указанными значениями, например, составляет больше чем приблизительно 10%, больше чем приблизительно 20%, больше чем приблизительно 30%, больше чем приблизительно 40% и/или больше чем приблизительно 50% в виде функции значения для референсной молекулы/молекулы сравнения.

"Аффинность связывания", как правило, относится к силе общей суммы нековалентных взаимодействий между единичным участком связывания молекулы (например, антитела) и его партнера по связыванию (например, антигена). Если не указано иначе, применяемая в настоящем документе, "аффинность связывания", относится к внутренней аффинности связывания, которая отражает взаимодействие 1:1 между членами пары связывания (например, антитело и антиген). Аффинность молекулы X к ее партнеру Y, как правило, можно представить посредством константы диссоциации (Kd). Аффинность можно измерять путем общепринятых, известных в данной области способов, включая способы, описываемые в настоящем документе. Низкоаффинные антитела, как правило, связываются с антигеном медленно и имеет тенденцию к легкой диссоциации, в то время как высокоаффинные антитела, как правило, связываются с антигеном быстрее и имеют тенденцию оставаться в связанном состоянии дольше. В данной области известен ряд способов для измерения аффинности связывания, любой из которых можно использовать для целей по настоящему изобретению. Конкретные иллюстративные варианты осуществления описаны ниже. В одном из вариантов осуществления "Kd" или "значение Kd" по настоящему изобретению измеряют путем анализа связывания с антигеном с радиоактивной меткой (РИА), который проводят с Fab-версией интересующего антитела и его антигеном, как описано в последующем анализе. Аффинность связывания раствора Fab к антигену можно измерять, в одном примере, путем уравновешивания Fab с минимальной концентрацией (125I)-меченного антигена в присутствии серии титров немеченого антигена, затем захвата связавшегося антигена на планшет, покрытый антителом против Fab (Chen, et al., (1999) J. Mol Biol 293:865-881). Для определения условий для анализа, планшеты для микротитрования (Dynex) покрывают в течение ночи 5 мкг/мл захватывающим антителом к Fab (Cappel Labs) в 50 мМ карбоната натрия (pH 9,6), и затем блокируют 2% (масс./об.) бычьего сывороточного альбумина в PBS в течение от двух до пяти часов при комнатной температуре (приблизительно 23°C). В неадсорбирующем планшете (Nunc #269620) смешивают 100 пМ или 26 пМ [125I]-антигена с серийными разведениями интересующего Fab (например, в соответствии с оценкой антитела к VEGF, Fab-12, у Presta et al., (1997) Cancer Res. 57:4593-4599). Fab, представляющий интерес, затем инкубируют в течение ночи, однако, инкубация может продолжаться в течение более длительного периода (например 65 часов), чтобы гарантировать достижение равновесия. После этого смеси переносят на планшет для захвата для инкубации при комнатной температуре (например в течение одного часа). Затем удаляют раствор и промывают планшет 8 раз 0,1% Tween-20 в PBS. После высыхания планшетов добавляют 150 мкл/лунку сцинтилляционной жидкости (MicroScint-20; Packard), и считают планшеты на гамма-счетчике Topcount (Packard) в течение десяти минут.

Концентрации каждого Fab, которые дают 20% от максимального связывания или меньше, выбирают для использования в анализах конкурентного связывания. По другому варианту осуществления значение Kd или Kd можно измерять с использованием анализов поверхностного плазмонного резонанса при помощи BIAcore™-2000 или BIAcore™-3000 (BIAcore, Inc., Piscataway, NJ) по инструкциям производителя или при 25°C с чипами CM5 с иммобилизованным антигеном при ~10 единицах ответа (RU). В кратком изложении, карбоксиметилированные декстрановые биосенсорные чипы (CM5, BIAcore Inc.) активируют N-этил-N'-(3-диметиламинопропил)-карбодиимида гидрохлоридом (EDC) и N-гидроксисукцинимидом (NHS) по инструкциям поставщика. Антиген разбавляют 10 мМ ацетата натрия, pH 4,8, до 5 мкг/мл (~0,2 мкМ) перед инжекцией при скорости потока 5 мкл/минуту, для того чтобы достичь приблизительно 10 единиц ответа (RU) спаренного белка. После инжекции антигена инжектируют 1 M этаноламин, для того чтобы заблокировать непрореагировавшие группы. Для измерения кинетики, инжектируют двухкратные серийные разведения Fab (от 0,78 нМ до 500 нМ) в PBS с 0,05% Tween 20 (PBST) при 25°C при скорости потока приблизительно 25 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) можно рассчитать с использованием простой модели связывания Лэнгмюра «один-к-одному» (BIAcore Evaluation Software version 3.2) путем одновременной подгонки сенсограмм ассоциации и диссоциации. Равновесную константу диссоциации (Kd) можно рассчитать как отношение Koff/Kon См., например, Chen, Y., et al., (1999) J. Mol Biol 293:865-881. Если скорость прямой реакции превышает 106 M-1⋅с-1 по вышеописанному анализу поверхностного плазмонного резонанса, то скорость прямой реакции можно определять с использованием способа гашения флуоресценции, который измеряет увеличение или уменьшение интенсивности флуоресценции (возбуждение = 295 нм; эмиссия = 340 нм, полоса пропускания 16 нм) при 25°C с 20 нМ антитела к антигену (форма Fab) в PBS, pH 7,2, в присутствии увеличивающихся концентраций антигена при измерении в спектрофотометре, таком как спектрофотометр с остановкой потока (Aviv Instruments) или спектрофотометр SLM-Aminco (ThermoSpectronic) серии 8000 с перемешивающей кюветой.

"Скорость прямой реакции" или "скорость ассоциации" или "kon" по настоящему изобретению можно также определять путем того же вышеописанного способа поверхностного плазмонного резонанса с использованием BIAcore(TM)-2000 или BIAcore(TM)-3000 (BIAcore, Inc., Piscataway, NJ) при 25°C с чипами CM5 с иммобилизованным антигеном при ~10 единицах ответа (RU). В кратком изложении, карбоксиметилированные декстрановые биосенсорные чипы (CM5, BIAcore Inc.) активируют N-этил-N'-(3-диметиламинопропил)-карбодиимида гидрохлоридом (EDC) и N-гидроксисукцинимидом (NHS) по инструкциям поставщика. Антиген разбавляют 10 мМ ацетата натрия, pH 4,8, до 5 мкг/мл (~0,2 мкМ) перед инжекцией при скорости потока 5 мкл/минуту, для того чтобы достичь приблизительно 10 единиц ответа (RU) спаренного белка. После инжекции антигена инжектируют 1 M этаноламин, для того чтобы заблокировать непрореагировавшие группы. Для измерения кинетики, инжектируют двукратные серийные разведения Fab (от 0,78 нМ до 500 нМ) в PBS с 0,05% Tween 20 (PBST) при 25°C при скорости потока приблизительно 25 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) можно рассчитать с использованием простой модели связывания Лэнгмюра «один-к-одному» (BIAcore Evaluation Software version 3.2) путем одновременной подгонки сенсограмм ассоциации и диссоциации. Равновесную константу диссоциации (Kd) можно рассчитать как отношение Koff/Kon См., например, Chen, Y., et al., (1999) J. Mol Biol 293:865-881. Однако, если скорость прямой реакции превышает 106M-1 с-1 по вышеописанному анализу поверхностного плазмонного резонанса, то скорость прямой реакции можно определять с использованием способа гашения флуоресценции, который измеряет увеличение или уменьшение интенсивности флуоресценции (возбуждение = 295 нм; эмиссия = 340 нм, полоса пропускания 16 нм) при 25°C с 20 нМ антитела к антигену (форма Fab) в PBS, pH 7,2, в присутствии увеличивающихся концентраций антигена при измерении в спектрофотометре, таком как спектрофотометр с остановкой потока (Aviv Instruments) или спектрофотометр SLM-Aminco (ThermoSpectronic) серии 8000 с перемешивающей кюветой.

Термин "химерное" антитело относится к антителу, в котором часть тяжелой и/или легкой цепи получена из конкретного источника или вида, в то время как остаток тяжелой и/или легкой цепи получен из другого источника или вида.

"Класс" антитела относится к типу константного домена или константной области, принадлежащей тяжелой цепи антитела. Существует пять основных классов антител: IgA, IgD, IgE, IgG и IgM, и некоторые из этих классов можно дополнительно разделить на подклассы (изотипы), например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2. Константные домены тяжелой цепи, которые соответствуют различным классам иммуноглобулинов называются α, δ, ε, γ и μ, соответственно.

Применяемый в настоящем документе термин "цитотоксическое средство" относится к веществу, которое ингибирует или блокирует функцию клеток и/или вызывает гибель или разрушение клеток. Цитотоксические средства включают, но не ограничиваются радиоактивные изотопы (например, At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu), химиотерапевтические средства или лекарственные средства (например, метотрексат, адриамицин, алкалоиды барвинка (винкристин, винбластин, этопозид), доксорубицин, мелфалан, митомицин C, хлорамбуцил, даунорубицин или другие интеркаляторы), ингибирующие рост средства, ферменты и их фрагменты, такие как нуклеолитические ферменты, антибиотики, токсины, такие как низкомолекулярные токсины или ферментативно активные токсины бактериального, грибного, растительного или животного происхождения, включая их фрагменты и/или варианты, и различные противоопухолевые или противораковые средства, описанные ниже.

"Эффекторные функции" относятся к видам биологической активности, связанным с Fc-областью антитела, которые меняются с изотипом антитела. Примеры эффекторных функций антитела включают связывание Clq и обусловленную комплементом цитотоксичность (CDC), связывание с Fc-рецептором, антителозависимую клеточную цитотоксичность (ADCC), фагоцитоз, негативную регуляцию рецепторов клеточной поверхности (например, B-клеточный рецептор) и активацию B-клеток.

"Эффективное количество" вещества, например, фармацевтического состава, относится к количеству, которое в необходимых дозах в течение необходимых периодов времени, является эффективным для достижения желаемого терапевтического или профилактического результата.

Термин "Fc-область" в настоящем документе применяют для определения C-концевой области тяжелой цепи иммуноглобулина, которая содержит по меньшей мере часть константной области. Термин включает нативную последовательность Fc-области и вариантные Fc-области. В одном из вариантов осуществления Fc-область тяжелой цепи IgG человека простирается от Cys226 или от Pro230 до карбокси-конца тяжелой цепи. Однако C-концевой лизин (Lys447) Fc-области может присутствовать или отсутствовать.

Если не указано иначе в настоящем документе, нумерация аминокислотных остатков в Fc-области или константной области соответствует системе нумерации EU, также называемой индекс EU, как описано в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.

"Каркас" или "FR" относится к остаткам вариабельного домена, иным чем остатки гипервариабельной области (HVR). FR вариабельного домена, как правило, состоит из четырех FR-доменов: FR1, FR2, FR3 и FR4. Таким образом, последовательности HVR и FR, в основном, появляются в следующей последовательности в VH (или VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.

Термины "полноразмерное антитело", "интактное антитело" и "целое антитело" используют в настоящем документе взаимозаменяемо по отношению к антителу, имеющему структуру, по существу, сходную с нативной структурой антитела или имеющему тяжелые цепи, которые содержат Fc-область, определенную в настоящем документе.

Термины "клетка-хозяин" "клеточная линия-хозяин" и "клеточная культура-хозяин" используют взаимозаменяемо и по отношению к клеткам, в которые была введена экзогенная нуклеиновая кислота, в том числе потомство таких клеток. Клетки-хозяева включают "трансформанты" и "трансформированные клетки", которые включают первичную трансформированную клетку и потомство, полученное от нее, безотносительно числа пассажей.

Потомство может быть не полностью идентичным родительской клетке по составу нуклеиновой кислоты, и может содержать мутации. Мутантное потомство, которое обладает той же функцией или биологической активностью, по которой проводили скрининг и отбор для изначально трансформированной клетки, включено в настоящее изобретение.

"Антитело человека" представляет собой антитело, которое обладает аминокислотной последовательностью, которая соответствует последовательности антитела, производимого человеком или клеткой человека или получены из не принадлежащего человеку источника, который использует репертуар антител человека или другие последовательности, кодирующие антитела человека. Это определение антитела человека конкретно исключает гуманизированное антитело, которое содержит не принадлежащие человеку антигенсвязывающие остатки.

"Консенсусный каркас человека" представляет собой каркас из наиболее часто встречающихся аминокислотных остатков при отборе последовательностей каркаса VL или VH иммуноглобулина человека. В основном отбор последовательностей VL или VH иммуноглобулина человека происходит из подгруппы последовательностей вариабельного домена. Как правило, подгруппа последовательностей представляет собой подгруппу как в Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3. В одном из вариантов осуществления для VL, подгруппа представляет собой подгруппу каппа I как у Kabat et al, выше. В одном из вариантов осуществления для VH, подгруппа представляет собой подгруппу III как в Kabat et al., выше.

"Гуманизированное" антитело относится к химерному антителу, содержащему аминокислотные остатки из не принадлежащих человеку HVR и аминокислотные остатки из FR человека. В определенных вариантах осуществления гуманизированное антитело будет содержать по существу все по меньшей мере из одного, и, как правило, из двух вариабельных доменов, в которых все или по существу все из HVR (например, CDR) соответствуют HVR из не принадлежащего человеку антитела, и все или по существу все из FR соответствуют FR антитела человека. Гуманизированное антитело необязательно может содержать, по меньшей мере, часть константной области антитела, полученной из антитела человека. "Гуманизированная форма" антитела, например, не принадлежащего человеку антитела, относится к антителу, которое подвергли гуманизации.

Применяемый в настоящем документе термин "гипервариабельная область" или "HVR" относится к каждой из областей вариабельного домена антитела, которые являются гипервариабельными по последовательности ("определяющие комплементарность области" или "CDR") и/или образуют структурно определенные петли ("гипервариабельные петли") и/или содержат остатки, контактирующие с антигеном ("антигенные контакты"). Как правило, антитела содержат шесть HVR: три в VH (H1, H2, H3) и три в VL (L1, L2, L3). Примеры HVR в настоящем документе включают:

(a) гипервариабельные петли, образованные аминокислотными остатками 26-32 (L1), 50-52 (L2), 91 -96 (L3). 26-32 (H1), 53-55 (H2), и 96-101 (H3) (Chothia и Lesk, J Mol. Biol. 196:901-917 (1987));

(b) CDR, образованные аминокислотными остатками 24-34 (L1), 50-56 (L2), 89-97 (L3), 31-35b (H1), 50-65 (H2), и 95-102 (H3) (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991);

(c) антигенные контакты, образованные аминокислотными остатками 27c-36 (L1), 46-55 (L2), 89-96 (L3), 30-35b (H1), 47-58 (H2), и 93-101 (H3) (MacCallum et al. J Mol. Biol. 262: 732-745 (1996)); и

(d) сочетания (a), (b) и/или (c), включая аминокислотные остатки HVR 46-56 (L2), 47-56 (L2), 48-56 (L2), 49-56 (L2), 26-35 (H1), 26-35b (H1), 49-65 (H2), 93-102 (H3) и 94-102 (H3).

В одном из вариантов осуществления остатки HVR включают остатки, определенные в таблице 2B (т.е. включают SEQ ID NO:33, SEQ ID NO:34 и/или SEQ ID NO:35) или в других местах в данном описании.

Если не указано иначе, остатки HVR и другие остатки в вариабельном домене (например, остатки FR) пронумерованы в настоящем документе согласно Kabat et al., выше.

"Иммуноконъюгат" представляет собой антитело, конъюгированное с одной или более гетерологичными молекулами, включая в качестве неограничивающих примеров цитотоксическое средство.

"Индивидуум" или "субъект" представляет собой млекопитающее. Млекопитающие в качестве неограничивающих примеров включают домашних животных (например, коров, овец, кошек, собак и лошадей), приматов (например, людей и не являющихся человеком приматов, таких как обезьяны), кроликов и грызунов (например, мышей и крыс). В конкретных вариантах осуществления индивидуум или субъект является человеком.

"Изолированное" антитело представляет собой антитело, которое отделено от компонентов своего природного окружения. В некоторых вариантах осуществления антитело очищают до чистоты более чем 95% или 99%, определенной, например, при помощи электрофореза (например, SDS-PAGE, изоэлектрофокусирование (IEF), капиллярный электрофорез) или хроматографии (например, ионообменной ВЭЖХ или ВЭЖХ с обратной фазой). Для обзоров способов оценки чистоты антител, см., например, Flatman et al., J. Chromatogr. B 848:79-87 (2007).

"Изолированная" нуклеиновая кислота относится к молекуле нуклеиновой кислоты, которая отделена от компонентов своего природного окружения. Изолированная нуклеиновая кислота включает молекулу нуклеиновой кислоты, которая содержится в клетках, как правило, содержащих молекулу нуклеиновой кислоты, но молекула нуклеиновой кислоты присутствует внехромосомно или в положении на хромосоме, которое отличается от ее природного расположения на хромосоме.

"Изолированная нуклеиновая кислота, кодирующая антитело к тау" относится к одной или более молекулам нуклеиновой кислоты, кодирующим тяжелые и легкие цепи антитела (или их фрагменты), включая такую молекулу/молекулы нуклеиновой кислоты в одиночном векторе или раздельных векторах, и такую молекулу/молекулы, присутствующую в одном или более положениях клетки-хозяина.

Применяемый в настоящем документе термин "моноклональное антитело" относится к антителу, полученному из популяции, по существу, гомогенных антител, т.е. индивидуальные антитела, составляющие популяцию, являются идентичными и/или связываются с тем же эпитопом, за исключением возможных вариантных антител, например, содержащих природные мутации или возникающих при производстве препарата моноклонального антитела; такие варианты, как правило, присутствуют в незначительных количествах. В отличие от препаратов поликлональных антител, которые, как правило, включают различные антитела, направленные против различных детерминант (эпитопов), каждое моноклональное антитело из препарата моноклонального антитела направлено против единичной детерминанты антигена. Таким образом, определение "моноклональный" указывает на характер антитела, полученного из гомогенной, по существу, популяции антител, и не должно быть истолковано как требование получения антитела каким-то конкретным способом. Например, моноклональные антитела, применяемые в соответствии с настоящим изобретением, могут быть произведены рядом способов, включая в качестве неограничивающих примеров гибридомный способ, способы рекомбинантной ДНК, способы фагового дисплея и способы с использованием трансгенных животных, содержащих все или часть локусов иммуноглобулина человека, такие способы и другие иллюстративные способы для получения моноклональных антител описаны в настоящем документе.

"Голое антитело" относится к антителу, которое не конъюгировано с гетерологичной частью (например, цитотоксической частью) или радиоактивной меткой. Голое антитело может присутствовать в фармацевтическом составе.

"Нативные антитела" относится к молекулам природного иммуноглобулина с различными структурами. Например, нативные антитела IgG представляют собой гетеротетрамерные гликопротеины массой приблизительно 150000 Дальтон, состоящих из двух идентичных легких цепей и двух идентичных тяжелых цепей, которые связаны дисульфидными мостиками. От N-конца к C-концу каждая тяжелая цепь имеет вариабельную область (VH), которую также называют вариабельный тяжелый домен или вариабельный домен тяжелой цепи, с тремя последующими константными доменами (CH1, CH2, и CH3). Аналогично, от N-конца к C-концу каждая легкая цепь имеет вариабельную область (VL), которую также называют вариабельный легкий домен или вариабельный домен легкой цепи, с последующим константным легким (CL) доменом. Легкая цепь антитела может быть отнесена к одному из двух типов, которые называют каппа (κ) и лямбда (λ), на основании аминокислотной последовательности ее константного домена.

Термин "вкладыш в упаковку" применяют по отношению к инструкциям, которые обычно включают в коммерческие упаковки терапевтических продуктов, которые содержат информацию относительно показаний, применения, дозировки, введения, комбинированного лечения, противопоказаний и/или предупреждений, касающуюся использования таких терапевтических продуктов.

"Процент (%) идентичности аминокислотных последовательностей" по отношению к последовательности референсного полипептида определяют как процент аминокислотных остатков в кандидатной последовательности, которые идентичны аминокислотным остаткам в последовательности референсного полипептида, после выравнивания последовательностей и вставок пропусков, при необходимости, для получения максимального процента идентичности последовательностей, и без учета любых консервативных замен как части идентичности последовательностей. Выравнивание с целью определения процента идентичности аминокислотных последовательностей можно производить различными способами, которые известны специалистам в данной области, например, с использованием общедоступного программного обеспечения, такого как программное обеспечение BLAST, BLAST-2, ALIGN или Megalign (DNASTAR). Специалисты в данной области могут определить подходящие параметры для выравнивания последовательностей, включая любые алгоритмы, необходимые для достижения максимального выравнивания по всей длине сравниваемых последовательностей. Для целей настоящего изобретения, однако, значения % идентичности аминокислотных последовательностей получают с использованием компьютерной программы для сравнения последовательностей ALIGN-2. Компьютерная программа для сравнения последовательностей ALIGN-2 была разработана Genentech, Inc., и исходный код подан с пользовательской документацией в ведомство по охране авторского права США, Washington D.C., 20559, где он был зарегистрирован под номером регистрации авторского права США TXU510087. Программа ALIGN-2 общедоступна у Genentech, Inc., Южный Сан-Франциско, Калифорния, или может быть скомпилирована из исходного кода. Программа ALIGN-2 должна быть скомпилирована для использования в операционной системе UNIX, включая цифровую UNIX V4.0D. Все параметры сравнения последовательностей устанавливаются программой ALIGN-2 и не меняются.

В ситуациях, когда ALIGN-2 используют для сравнения аминокислотных последовательностей, % идентичности аминокислотной последовательности данной аминокислотной последовательности A относительно, по отношению к данной аминокислотной последовательности В или с данной аминокислотной последовательностью B (что может альтернативно быть перефразировано как данная аминокислотная последовательность A, которая имеет или содержит определенный % идентичности аминокислотных последовательностей относительно, по отношению к данной аминокислотной последовательности В или с данной аминокислотной последовательностью B) рассчитывают, как указано ниже:

100 умножить на фракцию X/Y

где X представляет собой число аминокислотных остатков, подсчитанных как идентичные совпадения программой для выравнивания последовательностей ALIGN-2 в выравнивании этой программы для A и B, и где Y представляет собой общее число аминокислотных остатков в B. Следует понимать, что, когда длина аминокислотной последовательности A не равна длине аминокислотной последовательности B, % идентичности аминокислотной последовательности A с B не будет равен % идентичности аминокислотной последовательности B с A. Если конкретно не указано иначе, все значения % идентичности аминокислотных последовательностей, применяемые в настоящем документе, получают, как описано в предшествующем абзаце с использованием компьютерной программы ALIGN-2.

Термин "фармацевтический состав" относится к препарату, который находится в такой форме, которая разрешает эффективную биологическую активность активного ингредиента, содержащегося в препарате, и которая не содержит дополнительных компонентов, являющихся неприемлемо токсичными для индивидуума, которому будут вводить состав.

"Фармацевтически приемлемый носитель" относится к ингредиенту в фармацевтическом составе, иному чем активный ингредиент, который не токсичен для индивидуума. Фармацевтически приемлемый носитель в качестве неограничивающих примеров включает буфер, эксципиент, стабилизатор или консервант.

Применяемый в настоящем документе термин "pTau", относится к тау, в котором остаток серина, треонина или тирозина фосфорилирован протеинкиназой путем добавления ковалентно связанной фосфатной группы. В некоторых вариантах осуществления pTau фосфорилирован по остатку серина или треонина. В некоторых вариантах осуществления pTau фосфорилирован по серину в положении 409 и/или серину в положении 404. В одном из вариантов осуществления pTau фосфорилирован по серину в положении 409.

Применяемый в настоящем документе термин "тау" относится к любому нативному тау-белку из любого источника от позвоночных, включая млекопитающих, таких как приматы (например, люди) и грызуны (например, мыши и крысы), если не указано иначе. Термин включает "полноразмерный" непроцессированный тау, а также любую форму тау, которая является результатом процессинга в клетке. Термин также включает природные варианты тау, например, варианты сплайсинга или аллельные варианты. Аминокислотная последовательность типичного тау человека показана в SEQ ID NO:59.

Применяемый в настоящем документе, термин "лечение" (и его грамматические вариации, такие как "лечить" или "леченный") относится к клиническому вмешательству в попытке изменить природное состояние индивидуума, которого лечат, и его можно проводить или для профилактики или во время течения клинической патологии. Желаемые эффекты лечения в качестве неограничивающих примеров включают профилактику возникновения или рецидива заболевания, облегчение симптомов, уменьшение любых прямых или косвенных патологических последствий заболевания, уменьшение скорости прогрессирования заболевания, улучшение или смягчение состояния болезни, и ремиссию или улучшение прогноза. В некоторых вариантах осуществления антитела по изобретению применяют для замедления развития заболевания или для замедления прогрессирования заболевания.

Термин "вариабельная область" или "вариабельный домен" относится к домену тяжелой или легкой цепи антитела, который участвует в связывании антитела с антигеном. Вариабельные домены тяжелой цепи и легкой цепи (VH и VL, соответственно) нативного антитела, как правило, имеют сходную структуру, с каждым из доменов, включающим четыре консервативные каркасные области (FR) и три гипервариабельные области (HVR). (См., например, Kindt et al. Kuby Immunology, 6th ed., W.H. Freeman и Co., page 91 (2007).) Одиночного домена VH или VL может быть достаточно для придания антигенсвязывающей специфичности. Кроме того, антитела, которые связываются с конкретным антигеном, можно выделять с использованием домена VH или VL из антитела, которое связывается с антигеном, для скрининга библиотеки комплементарных доменов VL или VH, соответственно. См., например, Portolano et al., J Immunol. 150:880-887 (1993); Clarkson et al, Nature 352:624-628 (1991).

Применяемый в настоящем документе термин "вектор" относится к молекуле нуклеиновой кислоты, способной к распространению другой нуклеиновой кислоты, с которой она связана. Термин включает вектор в виде самореплицирующейся структуры нуклеиновой кислоты, а также вектор, встроенный в геном клетки-хозяина, в которую он был введен. Определенные векторы способны к управлению экспрессией нуклеиновой кислоты, с которой они функционально связаны. Такие векторы обозначают в настоящем документе как "экспрессирующие векторы".

Термины "растворимый" или "растворимый тау-белок", применяемые в настоящем документе, относятся к белкам, состоящим как из полностью растворимых мономеров тау-белок/пептид или из тау-подобных пептидов/белков, или из модифицированных или укороченных тау-пептидов/белков или из других производных мономеров тау-пептидов/белков, так и из олигомеров тау-белка. "Растворимый тау" в частности не включает нейрофибриллярные клубки (НФК).

Применяемый в настоящем документе термин "нерастворимый тау" относится к множественным агрегированным мономерам из тау-пептидов или белков или из тау-подобных пептидов/белков или из модифицированных или укороченных тау-пептидов/белков или из других производных тау-пептидов/белков, образующих мономерные или олигомерные структуры, которые нерастворимы как in vitro в водной среде, так и in vivo в организме млекопитающего или человека, более конкретно в головном мозге, а конкретно к множественным агрегированным мономерам тау или модифицированных или укороченных тау-пептидов/белков или их производных, которые нерастворимы в организме млекопитающего или человека, более конкретно в головном мозге, соответственно. "Нерастворимый тау" в частности включает нейрофибриллярные клубки (НФК).

Термины "мономерный тау" или "мономер тау", применяемый в настоящем документе, относится к полностью растворившимся тау-белкам без агрегировавших комплексов в водной среде.

Термины "агрегированный тау", "олигомерный тау" и "олигомер тау", применяемые в настоящем документе, относятся к множественным агрегированным мономерам из тау-пептидов или белков или из тау-подобных пептидов/белков или из модифицированных или укороченных тау-пептидов/белков или из других производных тау-пептидов/белков, образующих олигомерные или полимерные структуры, которые нерастворимы как in vitro в водной среде, так и in vivo в организме млекопитающего или человека, более конкретно в головном мозге, а конкретно к множественным агрегированным мономерам тау или модифицированных или укороченных тау-пептидов/белков или их производных, которые нерастворимы в организме млекопитающего или человека, более конкретно в головном мозге, соответственно.

Термины "pTau PHF", "PHF" и "парные спиральные филаменты", применяемые в настоящем документе как синонимы, относятся к парам филаментов, свернутым в спирали с периодичностью 160 нм, видимые на электронной микроскопии. Ширина варьирует от 10 до 22 нм. PHF являются преобладающими структурами в нейрофибриллярных клубках при болезни Альцгеймера (БА) и нитях нейропилей. PHF можно также наблюдать при некоторых, но не при всех дистрофических невритах, ассоциированных со старческими бляшками. Основным компонентом PHF является гиперфосфорилированная форма тау-белка, ассоциированная с микротрубочками. PHF может частично состоять из гиперфосфорилированных тау-белков, соединенных антипараллельно дисульфидными связями. PHF тау может быть укорочен на 20 C-концевых аминокислотных остатков. Механизмы, лежащие в основе образования PHF неясны, но гиперфосфорилирование тау может высвобождать его из микротрубочек, увеличивая растворимую популяцию тау, из которой может формироваться PHF внутри нейронов.

II. КОМПОЗИЦИИ И СПОСОБЫ

В одном из аспектов изобретение частично основано на создании антител к тау. В определенных вариантах осуществления предлагаются антитела, которые связываются с pTau. В определенных вариантах осуществления предлагаются антитела, которые связываются с pTau с высокой специфичностью и/или высокой аффинностью. В определенных вариантах осуществления предлагаются антитела, которые связываются с тау, фосфорилированным по серину в положении 409, такие как антитела, которые связываются с тау, фосфорилированным по серину в положении с высокой специфичностью и/или высокой аффинностью. Антитела по изобретению подходят, например, для диагностики или лечения таупатий, таких как болезнь Альцгеймера (БА).

A. Примеры антител к тау

В одном из аспектов изобретение относится к изолированным антителам, которые связываются с тау или с его фрагментом. В определенных вариантах осуществления изобретение относится к антителу к pTau, которое связывается с фосфорилированным эпитопом на тау (pTau). В некоторых вариантах осуществления изобретение относится к антителу к pTau, которое связывается с фосфорилированным серином в положении 409 ("pS409") и/или фосфорилированным серином в положении 404 ("pS404"). В одном из вариантов осуществления изобретение относится к антителу к pTau, которое связывается с pS409. В конкретных вариантах осуществления, изобретение относится к антителу к pTau, которое связывается с эпитопом, который содержит аминокислотные остатки 404-411 тау-белка человека, представленные в SEQ ID NO:59 (необязательно, с необходимостью фосфорилированного серина в положении 409, т.е. pS409). В других конкретных вариантах осуществления изобретение относится к антителу к pTau, которое связывается с эпитопом, который содержит аминокислотные остатки 405-411 тау-белка человека, представленные в SEQ ID NO:59 (необязательно, с необходимостью фосфорилированного серина в положении 409, т.е. pS409). В других конкретных вариантах осуществления, изобретение относится к антителу к pTau, которое связывается с эпитопом, который содержит аминокислотные остатки 401-418 тау-белка человека, представленные в SEQ ID NO:59 (необязательно, с необходимостью фосфорилированного серина в положении 409, т.е. pS409). В конкретных вариантах осуществления изобретение относится к антителу к тау, которое связывается с патологическим фосфорилированным эпитопом на тау (например, фосфорилированным эпитопом, ассоциированным с таупатией, такой как БА). В конкретных вариантах осуществления, изобретение относится к антителу к тау, которое связывается с патологическим конформером тау (например, конформером тау, ассоциированным с таупатией, такой как БА). В одном из вариантов осуществления изобретение относится к антителу к тау, которое связывается с гиперфосфорилированным тау (например, гиперфосфорилированным тау, ассоциированным с таупатией, такой как БА). В конкретных вариантах осуществления изобретение относится к антителу к тау, которое связывается с агрегированным тау (например, агрегированным тау, ассоциированным с таупатией, такой как БА). В одном из вариантов осуществления изобретение относится к антителу к тау, которое связывается с агрегированным фосфорилированным тау (например, с агрегированным тау-белком, фосфорилированным по эпитопу, ассоциированному с таупатией, такой как БА). В некоторых вариантах осуществления изобретение относится к антителу к тау, которое связывается с растворимым тау (например, с растворимым pTau). В других вариантах осуществления изобретение относится к антителу к тау, которое связывается с нерастворимым тау (например, с нерастворимым pTau). В конкретных вариантах осуществления, изобретение относится к антителу к тау, которое связывается с тау, ассоциированным с микротрубочками (например, с тау, ассоциированным с микротрубочками, который связан с таупатией, такой как БА). В одном из вариантов осуществления изобретение относится к антителу к тау, которое связывается с агрегированным тау, ассоциированным с микротрубочками (например, с агрегированным тау, ассоциированным с микротрубочками, который связан с таупатией, такой как БА). В одном из вариантов осуществления изобретение относится к антителу к тау, которое связывается с агрегированным и гиперфосфорилированным тау, ассоциированным с микротрубочками (например, с агрегированным и гиперфосфорилированным тау, ассоциированным с микротрубочками, который связан с таупатией, такой как БА). В одном из вариантов осуществления изобретение относится к антителу к тау, которое связывается с тау, присутствующим в парных спиральных филаментах (например, в парных спиральных филаментах, ассоциированных с таупатией, такой как БА). В конкретных вариантах осуществления изобретение относится к антителу к тау, которое связывается с тау, присутствующим в парных нейрофибриллярных клубках, нитях нейропилей и/или при дистрофическом нейрите (например, с pTau или гиперфосфорилированным тау).

В некоторых аспектах изобретение относится к антителу к тау, которое специфически распознает и связывается с тау (например, pTau) или его фрагментом. В определенных вариантах осуществления изобретение относится к антителу к pTau, которое распознает pTau с высокой специфичностью.

В определенных вариантах осуществления изобретение относится к антителу к pTau, которое связывается с фосфорилированным эпитопом на тау (например, с фосфосерином 409, фосфосерином 404, или фосфосерином 409 и фосфосерином 404), но не связывается с соответствующим нефосфорилированным эпитопом на тау и/или с неродственными эпитопами. В определенных вариантах осуществления изобретение относится к антителу к pTau, которое связывается с фосфорилированным эпитопом на тау (например, с фосфосерином 409, фосфосерином 404, или фосфосерином 409 и фосфосерином 404), но связывается с тем же эпитопом тау, когда он не фосфорилирован, со сниженной, по существу, аффинностью. В конкретных вариантах осуществления, изобретение относится к антителу к pTau, которое связывается с фосфорилированным эпитопом на тау (например, с фосфосерином 409, фосфосерином 404, или фосфосерином 409 и фосфосерином 404) с аффинностью, которая по меньшей мере в 3 раза, по меньшей мере в 5 раз, по меньшей мере в 10 раз, по меньшей мере в 15 раз, по меньшей мере в 20 раз, по меньшей мере в 50 раз или по меньшей мере в 100 раз больше чем его аффинность к соответствующему нефосфорилированному эпитопу на тау и/или к неродственному эпитопу. В конкретных вариантах осуществления, изобретение относится к антителу к pTau, которое связывается с фосфорилированным эпитопом на тау (например, с фосфосерином 409, фосфосерином 404, или фосфосерином 409 и фосфосерином 404) с аффинностью, которая по меньшей мере в 10 раз больше чем его аффинность к соответствующему нефосфорилированному эпитопу на тау и/или к неродственному эпитопу.

В определенных вариантах осуществления изобретение относится к антителу к тау (например, антителу к pTau), которое имеет высокую аффинность к тау (например, pTau).

В конкретных вариантах осуществления изобретение относится к антителу к pTau, которое связывается с фосфорилированным эпитопом на тау (например, с фосфосерином 409 и/или фосфосерином 404) с константой диссоциации (Kd) менее чем 70 нМ, менее чем 60 нМ, менее чем 50 нМ, менее чем 45 нМ, менее чем 40 нМ, менее чем 35 нМ, менее чем 30 нМ, менее чем 25 нМ, менее чем 20 нМ, менее чем 15 нМ, менее чем 10 нМ, менее чем 9 нМ, менее чем 8 нМ, менее чем 7 нМ, менее чем 6 нМ, менее чем 5 нМ, менее чем 4 нМ, менее чем 3 нМ, менее чем 2 нМ, менее чем 1 нМ, менее чем 0,9 нМ, менее чем 0,8 нМ, менее чем 0,7 нМ, менее чем 0,6 нМ, менее чем 0,5 нМ, менее чем 0,4 нМ, менее чем 0,3 нМ, менее чем 0,2 нМ или менее чем 0,1 нМ (или равной любому из вышеперечисленных значений).

В некоторых вариантах осуществления изобретение относится к антителу к pTau, которое связывается с pTau с константой скорости ассоциации, которая больше чем 1,5×105 M-1⋅с-1, больше чем 2×105 M-1⋅с-1, больше чем 2,5×105 M-1⋅с-1, больше чем 3×105 M-1⋅с-1, больше чем 3,5×105 M-1⋅с-1, больше чем 4×105 M-1⋅с-1, больше чем 4,5×105 M-1⋅с-1, больше чем 5×105 M-1⋅с-1, больше чем 5×105 M-1⋅с-1, больше чем 5,5×105 M-1⋅с-1, больше чем 6×105 M-1⋅с-1, больше чем 6,5×105 M-1⋅с-1, больше чем 7×105 M-1⋅с-1, больше чем 7,5×105 M-1⋅с-1, больше чем 8×105 M-1⋅с-1, больше чем 8,5×105 M-1⋅с-1, больше чем 9×105 M-1⋅с-1, больше чем 10×105 M-1⋅с-1, больше чем 12,5×105 M-1⋅с-1, больше чем 15×105 M-1⋅с-1, больше чем 20×105 M-1⋅с-1, больше чем 25×105 M-1⋅с-1, больше чем 30×105 M-1⋅с-1, больше чем 35×105 M-1⋅с-1, больше чем 40×105 M-1⋅с-1, больше чем 45×105 M-1⋅с-1, больше чем 50×105 M-1⋅с-1, или больше чем 75×105 M-1⋅с-1 или больше чем 100×105 M-1⋅с-1 (или равной любому из вышеперечисленных значений).

В некоторых вариантах осуществления изобретение относится к антителу к pTau, которое связывается с pTau с константой скорости диссоциации, которая меньше чем 10×10-3 с-1, менее чем 9×10-3 с-1, менее чем 8×10-3 с-1, менее чем 7×10-3 с-1, менее чем 6×10-3 с-1, менее чем 5×10-3 с-1, менее чем 4×10-3 с-1, менее чем 3×10-3 с-1, менее чем 2×10-3 с-1, менее чем 1×10-3 с-1 или менее чем 0,5×10-3 с-1 (или равной любому из вышеперечисленных значений). Еще в других вариантах осуществления, изобретение относится к антителу к pTau, которое связывается с pTau с константой скорости диссоциации, которая больше чем 1×10-4 с-1, больше чем 2×10-4 с-1, больше чем 3×10-4 с-1, больше чем 4×10-4 с-1, больше чем 5×10-4 с-1, больше чем 6×10-4 с-1, больше чем 7×10-4 с-1, больше чем 8×10-4 с-1, больше чем 9×10-4 с-1, менее чем 10×10-4 с-1 или больше чем 12×10-4 с-1 (или равной любому из вышеперечисленных значений).

В некоторых вариантах осуществления изобретение относится к антителу к тау, которое обладает высокой специфичностью и/или высокой аффинностью к патологическому фосфорилированному эпитопу/эпитопам на тау, патологическому конформеру тау (например, патологическому pTau), гиперфосфорилированному тау, агрегированному тау (например, агрегированному pTau), растворимому Tau (например, растворимому pTau), нерастворимому тау (например, нерастворимому pTau), тау, ассоциированному с микротрубочками (например, pTau, ассоциированному с микротрубочками), агрегированному и гиперфосфорилированному тау, ассоциированному с микротрубочками, тау, присутствующему в парных спиральных филаментах, или тау, присутствующему в нейрофибриллярных клубках, нитях нейропилей и/или при дистрофическом нейрите. В некоторых вариантах осуществления изобретение относится к антителу к тау, которое связывается с Kd, константой скорости ассоциации или константой скорости диссоциации, равной любому из вышеприведенных значений, с патологическим фосфорилированным эпитопом/эпитопами на тау, патологическим конформером тау (например, патологическим pTau), гиперфосфорилированным тау, агрегированным тау (например, агрегированным pTau), растворимым Tau (например, растворимым pTau), нерастворимым тау (например, нерастворимым pTau), тау, ассоциированным с микротрубочками (например, pTau, ассоциированным с микротрубочками), агрегированным и гиперфосфорилированным тау, ассоциированным с микротрубочками, тау, присутствующим в парных спиральных филаментах, или тау, присутствующим в нейрофибриллярных клубках, нитях нейропилей и/или при дистрофическом нейрите. В некоторых из этих вариантов осуществления антитело к тау связывается с фосфорилированным эпитопом на тау, но не связывается (или связывается с аффинностью в 5, 10, 50 или 100 раз ниже) с соответствующим нефосфорилированным эпитопом на тау и/или с неродственными эпитопами.

В некоторых вариантах осуществления изобретение относится к антителу к pTau, которое высокой специфичностью и/или высокой аффинностью к эпитопу, который содержит аминокислотные остатки 404-411, 405-41 или 401-418, и включает pS409 и/или pS404 тау-белка человека. В некоторых вариантах осуществления, изобретение относится к антителу к pTau, которое связывается с Kd, константой скорости ассоциации или константой скорости диссоциации, равной любому из вышеприведенных значений с эпитопом, который содержит аминокислотные остатки 404-411, 405-411 или 401-418, и включает pS409 тау-белка человека. В некоторых из этих вариантов осуществления антитело к pTau связывается с эпитопом на тау, который содержит аминокислотные остатки 404-411, 405-411 или 401-418, и включает pS409, но не связывается (или связывается с аффинностью в 5, 10, 50 или 100 раз ниже) с соответствующим нефосфорилированным эпитопом на тау и/или с неродственными эпитопами.

В определенных вариантах осуществления изобретение относится к антителу к тау, которое связывается с тау млекопитающего (например, pTau млекопитающего), таким как тау человека (например, pTau человек).

В определенных вариантах осуществления изобретение относится к антителу к тау (например, антителу к pTau), которое представляет собой моноклональное антитело или его фрагмент. В одном из вариантов осуществления изобретение относится к антителу к тау (например, антителу к pTau), которое представляет собой химерное антитело или его фрагмент. В одном из вариантов осуществления изобретение относится к антителу к тау (например, антителу к pTau), которое представляет собой гуманизированное антитело или его фрагмент. В одном из вариантов осуществления изобретение относится к антителу к тау (например, антителу к pTau), которое представляет собой антитело человека или его фрагмент.

В одном из аспектов изобретение относится к антителу к тау, содержащему по меньшей мере одну, две, три, четыре, пять или шесть HVR, выбранных из (a) HVR-H1, содержащей аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащей аминокислотную последовательность из SEQ ID NO:34; (c) HVR-H3, содержащей аминокислотную последовательность из SEQ ID NO:35; (d) HVR-L1, содержащей аминокислотную последовательность из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 или SEQ ID NO:14; (e) HVR-L2, содержащей аминокислотную последовательность из SEQ ID NO:16, SEQ ID NO:17 SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 или SEQ ID NO:26; и (f) HVR-L3, содержащей аминокислотную последовательность из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 или SEQ ID NO:32.

В одном из аспектов изобретение относится к антителу, содержащему, по меньшей мере одну, по меньшей мере две или все три последовательности HVR VH, выбранные из (a) HVR-H1, содержащей аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащей аминокислотную последовательность из SEQ ID NO:34; и (c) HVR-H3, содержащей аминокислотную последовательность из SEQ ID NO:35. В одном из вариантов осуществления антитело содержит HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35. В другом варианте осуществления антитело содержит HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35 и HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 или SEQ ID NO:32. В дополнительном варианте осуществления антитело содержит HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35, HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 или SEQ ID NO:32, и HVR-H2, содержащую аминокислотную последовательность из SEQ ID NO:34. В дополнительном варианте осуществления антитело содержит (a) HVR-H1, содержащую аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащую аминокислотную последовательность из SEQ ID NO:34; и (c) HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35.

В другом аспекте изобретение относится к антителу, содержащему по меньшей мере одну, по меньшей мере две или все три последовательности HVR VL, выбранные из (a) HVR-L1, содержащей аминокислотную последовательность из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 или SEQ ID NO:14; (b) HVR-L2, содержащей аминокислотную последовательность из SEQ ID NO:16, SEQ ID NO:17 SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 или SEQ ID NO:26; и (c) HVR-L3, содержащей аминокислотную последовательность из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 или SEQ ID NO:32. В одном из вариантов осуществления антитело содержит (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 или SEQ ID NO:14; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 или SEQ ID NO:26; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 или SEQ ID NO:32.

В другом аспекте антитело по изобретению содержит (a) VH домен, содержащий по меньшей мере одну, по меньшей мере две или все три последовательности HVR VH, выбранные из (i) HVR-H1, содержащей аминокислотную последовательность из SEQ ID NO:33, (ii) HVR-H2, содержащей аминокислотную последовательность из SEQ ID NO:34, и (iii) HVR-H3, содержащей c аминокислотную последовательность, выбранную из SEQ ID NO:35; и (b) VL домен, содержащий по меньшей мере одну, по меньшей мере две или все три последовательности HVR VL, выбранные из (i) HVR-L1, содержащей аминокислотную последовательность из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 или SEQ ID NO:14, (ii) HVR-L2, содержащей аминокислотную последовательность из SEQ ID NO:16, SEQ ID NO:17 SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 или SEQ ID NO:26, и (c) HVR-L3, содержащей аминокислотную последовательность из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 или SEQ ID NO:32.

В другом аспекте изобретение относится к антителу, содержащему (a) HVR-H1, содержащую аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащую аминокислотную последовательность из SEQ ID NO:34; (c) HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35; (d) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 или SEQ ID NO:14; (e) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 или SEQ ID NO:26; и (f) HVR-L3, содержащую аминокислотную последовательность, выбранную из SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 или SEQ ID NO:32.

В определенных вариантах осуществления любая одна или более аминокислот антитела к тау, содержащего HVR-L1 из SEQ ID NO:15, HVR-L2 из SEQ ID NO:16 и HVR-L3 из SEQ ID NO:30 замещены по следующим положениям HVR (определенным по Kabat):

в HVR-L1 (SEQ ID NO:15): положения по Kabat 24, 27A, 27C, 27D, 27E, 28, 30 и 33,

в HVR-L2 (SEQ ID NO:16): положения по Kabat 52, 53, и 56,

в HVR-L3 (SEQ ID NO:30): положения по Kabat 92, 93, и 96.

В определенных вариантах осуществления замены представляют собой консервативные замены, приведенные в настоящем документе. В определенных вариантах осуществления может быть произведена любая одна или более следующих замен в любом сочетании по указанным положениям Kabat:

в HVR-L1 (SEQ ID NO:15): R24T; S27aR или V; V27CR или I; H27dR; S27eR, G или K; H28R, K, N или G; K30R; или L33V,

в HVR-L2 (SEQ ID NO:16): S52K или R; N53K или H; или S56F, G, K, R, Y, или L,

в HVR-L3 (SEQ ID NO:30): A92R, H93R, Q или Y; или Y96R.

Все возможные сочетания вышеуказанных замен охватываются следующими консенсусными последовательностями:

HVR-L1, содержащей аминокислотную последовательность X1SSQX2LX3X4X5X6GX7TYX8H (SEQ ID NO:89), где X1=R или T; X2=S, R или V; X3=V, I или R; X4=H или R; X5=S, R, G или K; X6=H, N, R, K или G; X7=K или R; и X8=L или V;

HVR-L2, содержащей аминокислотную последовательность KVX9X10RFX11 (SEQ ID NO:90), где X9=S, K или R; X10=N, K или H; и X11=S, F, G, K, R, Y или L,

HVR-L3, содержащей аминокислотную последовательность SQTX12X13FPX14T (SEQ ID NO:91), где X12=A или R; X13=H, R, Q или Y; X14=Y или R.

В конкретных вариантах осуществления антитело, с консенсусной последовательностью, представленной выше, не содержит все три из следующих последовательностей HVR-L1, HVR-L2 и HVR-L3: HVR-L1, состоящую из RSSQSLVHSHGKTYLH (SEQ ID NO:15) или RSSQRLVHSHGKTYLH (SEQ ID NO:92); HVR-L2, состоящую из KVSNRFS (SEQ ID NO:16); и HVR-L3, состоящую из SQTAHFPYT (SEQ ID NO:30).

В конкретном варианте осуществления изобретение относится к антителу, содержащему (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:1; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:16; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27. В одном из вариантов осуществления изобретение относится к антителу, содержащему (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:2; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:17; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27. В одном из вариантов осуществления изобретение относится к антителу, содержащему (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:8; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:21; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:29. В одном из вариантов осуществления изобретение относится к антителу, содержащему (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:14; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:25; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:31. В одном из вариантов осуществления изобретение относится к антителу, содержащему (a) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:9; (b) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:17; и (c) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:31.

В конкретном варианте осуществления изобретение относится к антителу, содержащему (a) HVR-H1, содержащую аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащую аминокислотную последовательность из SEQ ID NO:34; (c) HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35; (d) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:1; (e) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:16; и (f) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27. В другом конкретном варианте осуществления изобретение относится к антителу, содержащему (a) HVR-H1, содержащую аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащую аминокислотную последовательность из SEQ ID NO:34; (c) HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35; (d) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:2; (e) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:17; и (f) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:27. В другом конкретном варианте осуществления изобретение относится к антителу, содержащему (a) HVR-H1, содержащую аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащую аминокислотную последовательность из SEQ ID NO:34; (c) HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35; (d) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:8; (e) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:21; и (f) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:29. Еще в другом конкретном варианте осуществления, изобретение относится к антителу, содержащему (a) HVR-H1, содержащую аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащую аминокислотную последовательность из SEQ ID NO:34; (c) HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35; (d) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:14; (e) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:25; и (f) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:31. Еще в другом конкретном варианте осуществления, изобретение относится к антителу, содержащему (a) HVR-H1, содержащую аминокислотную последовательность из SEQ ID NO:33; (b) HVR-H2, содержащую аминокислотную последовательность из SEQ ID NO:34; (c) HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35; (d) HVR-L1, содержащую аминокислотную последовательность из SEQ ID NO:9; (e) HVR-L2, содержащую аминокислотную последовательность из SEQ ID NO:17; и (f) HVR-L3, содержащую аминокислотную последовательность из SEQ ID NO:31.

В любом из вышеописанных вариантов осуществления, антитело к тау может быть гуманизированным. В одном из вариантов осуществления антитело к тау содержит HVR, как в любом из вышеописанных вариантов осуществления, и дополнительно содержит акцепторный каркас человека, например, каркас иммуноглобулина человека или консенсусный каркас человека. В другом варианте осуществления антитело к тау содержит HVR, как в любом из вышеописанных вариантов осуществления, и дополнительно содержит VH, содержащий последовательность из SEQ ID NO:58. В другом варианте осуществления антитело к тау содержит HVR, как в любом из вышеописанных вариантов осуществления, и дополнительно содержит VL, содержащий последовательность из SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56 или SEQ ID NO:57.

В другом аспекте антитело к тау содержит последовательность вариабельного домена тяжелой цепи (VH), имеющую по меньшей мере 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентичности последовательности с аминокислотной последовательностью из SEQ ID NO:58. В определенных вариантах осуществления последовательность VH, имеющая по меньшей мере 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности, содержит замены (например, консервативные замены), вставки или делеции относительно референсной последовательности, но антитело к тау, содержащее эту последовательность, сохраняет способность связываться с тау. В определенных вариантах осуществления в целом от 1 до 10 аминокислот замещены, вставлены и/или удалены в SEQ ID NO:58. В определенных вариантах осуществления замены, вставки, или делеции происходят в областях за пределами HVR (т.е. в FR). Необязательно, антитело к тау содержит последовательность VH в SEQ ID NO:58, включая посттрансляционные модификации этой последовательности. В конкретном варианте осуществления VH содержит одну, две или три HVR, выбранные из: (a) HVR-H1, содержащей аминокислотную последовательность из SEQ ID NO:33, (b) HVR-H2, содержащей аминокислотную последовательность из SEQ ID NO:34, и (c) HVR-H3, содержащую аминокислотную последовательность из SEQ ID NO:35.

В другом аспекте предлагается антитело к тау, где антитело содержит вариабельный домен легкой цепи (VL), имеющий по меньшей мере 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентичности последовательности с аминокислотной последовательностью из SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56 или SEQ ID NO:57. В определенных вариантах осуществления последовательность VL, имеющая по меньшей мере 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности содержит замены (например, консервативные замены), вставки или делеции относительно референсной последовательности, но антитело к тау, содержащее эту последовательность, сохраняет способность связываться с тау. В определенных вариантах осуществления в целом от 1 до 10 аминокислот замещены, вставлены и/или удалены в SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56 или SEQ ID NO:57. В определенных вариантах осуществления замены, вставки, или делеции происходят в областях за пределами HVR (т.е. в FR). Необязательно, антитело к тау содержит последовательность VL в SEQ ID NO:36, включая посттрансляционные модификации этой последовательности. В одном из вариантов осуществления антитело к тау содержит VL последовательность в SEQ ID NO:37, включая посттрансляционные модификации этой последовательности. В другом варианте осуществления антитело к тау содержит последовательность VL в SEQ ID NO:44, включая посттрансляционные модификации этой последовательности. В еще одном варианте осуществления антитело к тау содержит последовательность VL в SEQ ID NO:54, включая посттрансляционные модификации этой последовательности. В другом варианте осуществления антитело к тау содержит последовательность VL в SEQ ID NO:55, включая посттрансляционные модификации этой последовательности. В конкретном варианте осуществления VL содержит одну, две или три HVR, выбранные из (a) HVR-L1, содержащей аминокислотную последовательность из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:8, SEQ ID NO:9 или SEQ ID NO:14; (b) HVR-L2, содержащей аминокислотную последовательность из SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:21 или SEQ ID NO:25; и (c) HVR-L3, содержащей аминокислотную последовательность из SEQ ID NO:27, SEQ ID NO:29 или SEQ ID NO:31.

В другом аспекте предлагается антитело к тау, где антитело содержит VH по любому из вышеописанных вариантов осуществления, и VL по любому из вышеописанных вариантов осуществления. В одном из вариантов осуществления антитело содержит последовательности VH и VL в SEQ ID NO:58 и SEQ ID NO:36, соответственно, включая посттрансляционные модификации этих последовательностей. В одном из вариантов осуществления антитело содержит последовательности VH и VL в SEQ ID NO:58 и SEQ ID NO:37, соответственно, включая посттрансляционные модификации этих последовательностей. В одном из вариантов осуществления антитело содержит последовательности VH и VL в SEQ ID NO:58 и SEQ ID NO:44, соответственно, включая посттрансляционные модификации этих последовательностей. В одном из вариантов осуществления антитело содержит последовательности VH и VL в SEQ ID NO:58 и SEQ ID NO:54, соответственно, включая посттрансляционные модификации этих последовательностей. В одном из вариантов осуществления антитело содержит последовательности VH и VL в SEQ ID NO:58 и SEQ ID NO:55, соответственно, включая посттрансляционные модификации этих последовательностей.

В дополнительном аспекте изобретение относится к антителу, которое связывается с тем же эпитопом, что и антитело к тау, предлагаемое в настоящем документе. Например, в определенных вариантах осуществления предлагается антитело, которое связывается с тем же эпитопом, что и антитело, содержащее последовательность VH из SEQ ID NO:58 и последовательность VL, выбранную из группы, состоящей из: SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:44, SEQ ID NO:54 и SEQ ID NO:55. В определенных вариантах осуществления предлагается антитело, которое связывается с фосфорилированным эпитопом внутри фрагмента тау, состоящего из аминокислот 401-418 или состоящего из аминокислот 404-411, или состоящего из аминокислот 405-411 из SEQ ID NO:59.

В дополнительном аспекте по изобретению, антитело к тау по любому из вышеописанных вариантов осуществления представляет собой моноклональное антитело, в том числе химерное, гуманизированное или человеческое антитело. В одном из вариантов осуществления антитело к тау представляет собой фрагмент антитела, например, Fv, Fab, Fab', scFv, диатело или F(ab')2 фрагмент. В другом варианте осуществления антитело представляет собой полноразмерное антитело, например, интактное антитело IgG1, IgG1 N297G, IgG2, IgG3 или IgG4 или антитело другого класса или изотипа, определенного в настоящем документе.

В дополнительном аспекте антитело к тау по любому из вышеописанных вариантов осуществления может обладать любой из отличительных характеристик, отдельно или в сочетании, как описано в разделах 1-7 ниже:

1. Аффинность антител

В определенных вариантах осуществления антитело, предлагаемое в настоящем документе, имеет константу диссоциации (Kd) ≤1 мкМ, ≤100 нМ, ≤10 нМ, ≤1 нМ, ≤0,1 нМ, ≤0,01 нМ или ≤0,001 нМ (например, 10-8 M или меньше, например, от 10-8 M до 10-13 M, например, от 10-9 M до 10-13 M).

В одном из вариантов осуществления Kd измеряют путем анализа связывания с антигеном с радиоактивной меткой (RIA). В одном из вариантов осуществления RIA проводят с Fab-версией интересующего антитела и его антигеном.

Например, аффинность связывания раствора Fab к антигену измеряют путем уравновешивания Fab с минимальной концентрацией (125I)-меченого антигена в присутствии серии титров немеченого антигена, затем захвата связавшегося антигена антителом к планшету, покрытому Fab (см., например, Chen et al., J Mol. Biol. 293:865-881 (1999)). Для определения условий для анализа многолуночные планшеты MICROTITER® (Thermo Scientific) покрывают в течение ночи покрывают в течение ночи 5 мкг/мл захватывающего антитела к Fab (Cappel Labs) в 50 мМ карбоната натрия (pH 9,6), и затем блокируют 2% (масс./об.) бычьего сывороточного альбумина в PBS в течение от двух до пяти часов при комнатной температуре (приблизительно 23°C). В неадсорбирующем планшете (Nunc #269620) 100 пМ или 26 пМ [125I]-антигена смешивают с серийными разведениями интересующего Fab (например, в соответствии с оценкой антитела к VEGF, Fab-12, у Presta et al., (1997) Cancer Res. 57:4593-4599). Fab, представляющий интерес, затем инкубируют в течение ночи, однако, инкубация может продолжаться в течение более длительного периода (например, 65 часов), чтобы гарантировать достижение равновесия. После этого смеси переносят на планшет для захвата для инкубации при комнатной температуре (например, в течение одного часа). Затем удаляют раствор и промывают планшет 8 раз 0,1% полисорбата 20 (TWEEN-20®) в PBS. После высыхания планшетов добавляют 150 мкл/лунку сцинтилляционной жидкости (MicroScint-20; Packard), и считают планшеты на гамма-счетчике TOPCOUNT™ (Packard) в течение десяти минут. Концентрации каждого Fab, которые дают 20% от максимального связывания или меньше, выбирают для использования в анализах конкурентного связывания.

По другому варианту осуществления Kd измеряют с использованием анализов поверхностного плазмонного резонанса. Например, анализ с использованием BIACORE -2000 или a BIACORE -3000 (BIAcore, Inc., Piscataway, NJ) проводят при 25°C с чипами CM5 с иммобилизованным антигеном при ~10 единицах ответа (RU). В одном из вариантов осуществления карбоксиметилированные декстрановые биосенсорные чипы (CM5, BIAcore Inc.) активируют N-этил-N'-(3-диметиламинопропил)-карбодиимида гидрохлоридом (EDC) и N-гидроксисукцинимидом (NHS) по инструкциям поставщика. Антиген разбавляют 10 мМ ацетата натрия, pH 4,8, до 5 мкг/мл (~0,2 мкМ) перед инжекцией при скорости потока 5 мкл/минуту, для того чтобы достичь приблизительно 10 единиц ответа (RU) спаренного белка. После инжекции антигена, инжектируют 1 M этаноламин, для того чтобы заблокировать непрореагировавшие группы. Для измерения кинетики, инжектируют двукратные серийные разведения Fab (от 0,78 нМ до 500 нМ) в PBS с поверхностно-активным веществом 0,05% полисорбатом 20 (TWEEN-20™) (PBST) при 25°C при скорости потока приблизительно 25 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) рассчитывают с использованием простой модели связывания Лэнгмюра «один-к-одному» (BIAcore Evaluation Software version 3.2) путем одновременной подгонки сенсограмм ассоциации и диссоциации. Равновесную константу диссоциации (Kd) можно рассчитать как отношение Koff/Kon. См., например, Chen et al., J Mol. Biol. 293:865-881 (1999). Если скорость прямой реакции превышает 106 M-1⋅с-1 по вышеописанному анализу поверхностного плазмонного резонанса, то скорость прямой реакции можно определять с использованием способа гашения флуоресценции, который измеряет увеличение или уменьшение интенсивности флуоресценции (возбуждение = 295 нм; эмиссия = 340 нм, полоса пропускания 16 нм) при 25°C с 20 нМ антитела к антигену (форма Fab) в PBS, pH 7,2, в присутствии увеличивающихся концентраций антигена при измерении в спектрофотометре, таком как спектрофотометр с остановкой потока (Aviv Instruments) или спектрофотометр SLM-Aminco (ThermoSpectronic) серии 8000 с перемешивающей кюветой.

2. Фрагменты антител

В определенных вариантах осуществления антитело, предлагаемое в настоящем документе, представляет собой фрагмент антитела. Фрагменты антител в качестве неограничивающих примеров включают Fab, Fab', Fab'-SH, F(ab')2, Fv и scFv фрагменты, и другие фрагменты, описанные ниже. Для обзора конкретных фрагментов антител см. Hudson et al. Nat. Med. 9: 129-134 (2003). Для обзора фрагментов scFv см., например, Pluckthiin, в The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp. 269-315 (1994); см. также WO 93/16185; и патенты США №№ 5571894 и 5587458. Для обсуждения фрагментов Fab и F(ab')2, содержащих остатки, связывающиеся с эпитопом рецептора спасения, и имеющих увеличенное время полувыведения in vivo, см. патент США № 5869046.

Диатела представляют собой фрагменты антител с двумя антигенсвязывающими участками, которые могут быть бивалентными или биспецифическими. См., например, EP 404097; WO 1993/01161; Hudson et al., Nat. Med. 9:129-134 (2003); и Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Триотела и тетратела также описаны в Hudson et al., Nat. Med. 9:129-134 (2003).

Однодоменные антитела представляют собой фрагменты антител, содержащие все или часть из вариабельных доменов тяжелой цепи или все или часть из вариабельных доменов легкой цепи антитела. В определенных вариантах осуществления однодоменное антитело представляет собой однодоменное антитело человека (Domantis, Inc., Waltham, MA; см., например, патент США № 6248516 B1).

Фрагменты антител можно получать при помощи различных способов, включая в качестве неограничивающих примеров протеолитическое расщепление интактного антитела, а также производство рекомбинантными клетками-хозяевами (например, E. coli или фагом), как описано в настоящем документе.

3. Химерные и гуманизированные антитела

В определенных вариантах осуществления антитело, предлагаемое в настоящем документе, представляет собой химерное антитело. Конкретные химерные антитела описаны, например, в патенте США № 4816567; и Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). В одном из примеров химерное антитело содержит не принадлежащую человеку вариабельную область (например, вариабельную область, полученную от мыши, крысы, хомяка, кролика, или не являющегося человеком примата, такого как обезьяна) и константную область человека. В дополнительном примере, химерное антитело представляет собой антитело с «переключенным классом», в котором класс или подкласс был изменен по сравнению с родительским антителом. Химерные антитела включают их антигенсвязывающие фрагменты.

В определенных вариантах осуществления химерное антитело представляет собой гуманизированное антитело. Как правило, не принадлежащее человеку антитело гуманизируют для снижения иммуногенности для людей, с одновременным сохранением специфичности и аффинности не принадлежащего человеку родительского антитела. Как правило, гуманизированное антитело содержит один или более вариабельных доменов, в которых HVR, например, CDR (или их части), получены из не принадлежащего человеку антитела, и FR (или их части) получены из последовательностей антитела человека. Гуманизированное антитело необязательно будет также содержать по меньшей мере часть константной области человека. В некоторых вариантах осуществления некоторые остатки FR в гуманизированном антителе замещены соответствующими остатками из не принадлежащего человеку антитела (например, антитела, из которого получают остатки HVR), например, для восстановления или улучшения специфичности или аффинности антитела.

Гуманизированные антитела и способы их получения рассмотрены, например, в Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008), и дополнительно описаны, например, в Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Natl. Acad. Sci. USA 86:10029-10033 (1989); патентах США №№ 5821337, 7527791, 6982321 и 7087409; Kashmiri et al., Methods 36:25-34 (2005) (описывающие прививку области определяющей специфичность (SDR)); Padlan, Mol. Immunol. 28:489-498 (1991) (описывающие "изменение поверхности"); Dall'Acqua et al., Methods 36:43-60 (2005) (описывающие "перемешивание FR"); и Osbourn et al., Methods 36:61-68 (2005) и Klimka et al., Br. J. Cancer, 83:252-260 (2000) (описывающие подход "направленного отбора" для перемешивания FR).

Каркасные области человека, которые можно использовать для гуманизации, в качестве неограничивающих примеров включают: каркасные области, выбранные с использованием способа "наилучшего соответствия" (см., например,. Sims et al. J Immunol. 151:2296 (1993)); каркасные области, полученные из консенсусной последовательности антител человека из конкретной подгруппы вариабельных областей легкой или тяжелой цепи (см., например, Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); и Presta et al. J Immunol. 151:2623 (1993)); человеческие зрелые (соматические мутированные) каркасные области или каркасные области зародышевой линии человека (см., например, Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008)); и каркасные области, полученные при скриниге библиотек FR (см., например, Baca et al., J. Biol. Chem. 272: 10678- 10684 (1997) и Rosok et al., J. Biol. Chem. 271:2261 1-22618 (1996)).

4. Антитела человека

В определенных вариантах осуществления антитело, предлагаемое в настоящем документе, представляет собой антитело человека. Антитела человека можно получать при помощи различных способов, известных в данной области. Антитела человека описаны в основном у van Dijk и van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) и Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).

Антитела человека можно получать при введении иммуногена трансгенному животному, которое было модифицировано для выработки интактных антител человека или интактных антител с вариабельными областями человека в ответ на стимуляцию антигеном. Такие животные, как правило, содержать все или часть локусов иммуноглобулина человека, которые замещают эндогенные локусы иммуноглобулина или которые присутствуют внехромосомно или внедрены случайным образом в хромосомы животного. У таких трансгенных мышей эндогенные локусы иммуноглобулина, как правило, инактивированы. Для обзора способов для получения антител человека из трансгенных животных, см. Lonberg, Nat. Biotech. 23: 117-1125 (2005). См. также, например, патенты США №№ 6075181 и 6150584, описывающие технологию XENOMOUSE™; патент США № 5770429, описывающий технологию HUMAB®; патент США № 7041870, описывающий технологию K-M MOUSE®, и публикацию патентной заявки США № US 2007/0061900, описывающую технологию VELOCIMOUSE®). Вариабельные области человека из интактных антител, произведенные такими животными, могут быть дополнительно модифицированы, например, путем комбинирования различных константных областей человека.

Антитела человека можно также получать способами на основе гибридом. Были описаны клеточные линии миеломы человека и гетеромиеломы человек-мышь для выработки моноклональных антител человека. (См. например, Kozbor J Immunol, 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); и Boerner et al., J. Immunol., 147: 86 (1991).) Антитела человека, созданные посредством технологии В-клеточной гибридомы человека, также описаны в Li et al, Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Дополнительные способы включают способы, описанные, например, в патенте США № 7189826 (описывающем получение моноклональных антител IgM человека из гибридомных клеточных линий) и Ni, Xiandai Mianyixue, 26(4): 265-268 (2006) (описывающем гибридомы человек-человек).

Технология человеческих гибридом (технология Trioma) также описана в Vollmers and Brandlein, Histology and Histopathology, 20(3): 927-937 (2005) и Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3): 185-91 (2005).

Антитела человека можно также получать путем выделения клона последовательностей Fv вариабельного домена, выбранных из полученных от человека библиотек фагового дисплея. Такие последовательности вариабельного домена можно затем комбинировать с желаемым константным доменом человека. Способы для отбора антител человека из библиотек антител описаны ниже.

5. Антитела, полученные из библиотек

Антитела по изобретению можно выделять путем скрининга комбинаторных библиотек на антитела с желаемым свойством или свойствами. Например, в данной области известен ряд способов для создания библиотек фагового дисплея и скрининга таких библиотек на антитела, обладающие желаемыми характеристиками связывания. Такие способы рассматриваются, например, в Hoogenboom et al. в Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, 2001) и дополнительно описаны, например, в the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, NJ, 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); и Lee et al., J. Immunol. Methods 284(1-2): 119-132 (2004).

В конкретных способах фагового дисплея репертуары генов VH и VL раздельно клонируют посредством полимеразной цепной реакции (ПЦР) и рекомбинируют случайным образом в фаговые библиотеки, в которых затем можно проводить скрининг по антигенсвязывающему фагу, как описано в Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Фаг, как правило, представляет на поверхности фрагменты антител, или в виде одноцепочечных Fv (scFv) фрагментов или в виде Fab фрагментов. Библиотеки из иммунизированных источников обеспечивают высокоаффинные антитела к иммуногену без необходимости конструирования гибридом. Альтернативно, можно клонировать наивный репертуар (например, от человека) для создания единого источника антител к широкому спектру чужеродных, а также аутоантигенов без какой-либо иммунизации, как описано Griffiths et al., EMBO J, 12: 725-734 (1993). Наконец, наивные библиотеки можно также создать синтетическим путем при клонировании неарранжированных сегментов V-гена из стволовых клеток и при помощи праймеров для ПЦР, содержащих случайную последовательность для кодирования высоковариабельных областей CDR3 и выполнения реарранжировки in vitro, как описано Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992). Патентные публикации, описывающие фаговые библиотеки антител человека, включают, например: патент США № 5750373, и патентные публикации США 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936 и 2009/0002360.

Антитела или фрагменты антител, выделенные из библиотек антител человека, в настоящем документе рассматриваются как антитела человека или фрагменты антитела человека.

6. Полиспецифические антитела

В определенных вариантах осуществления антитело, предлагаемое в настоящем документе, представляет собой полиспецифическое антитело, например, биспецифическое антитело. Полиспецифические антитела представляют собой моноклональные антитела, которые имеют специфичность связывания, по меньшей мере, для двух различных участков. В определенных вариантах осуществления одна из специфичностей связывания предназначена для тау (например, pTau) и другая предназначена для любого другого антигена. В определенных вариантах осуществления биспецифические антитела могут связываться с двумя различными эпитопами тау (например, pTau). Биспецифические антитела также можно использовать для локализации цитотоксических средств на клетках, которые экспрессируют тау. Биспецифические антитела можно получать в виде полноразмерных антител или фрагментов антител.

Способы для получения полиспецифических антител в качестве неограничивающих примеров включают рекомбинантную совместную экспрессию двух пар тяжелая цепь иммуноглобулина/легкая цепь иммуноглобулина с различными специфичностями (см. Milstein и Cuello, Nature 305: 537 (1983)), WO 93/08829, и Traunecker et al., EMBO J. 10: 3655 (1991)), и конструирование "выступ во впадину" (см., например, патент США № 5731168). Мультиспецифические антитела можно также получать путем конструирования электростатических управляющих эффектов для создания Fc-гетеродимерных молекул антитела (WO 2009/089004A1); перекрестную сшивку двух или более антител или фрагментов (см., например, патент США № 4676980, и Brennan et al., Science, 229: 81 (1985)); использование лейциновых молний для получения биспецифических антител (см., например, Kostelny et al., J. Immunol, 148(5): 1547-1553 (1992)); использование технологии "диатело" для создания фрагментов биспецифического антитела (см., например, Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993)); и использование одноцепочечных Fv (sFv) димеров (см., например, Gruber et al., J Immunol., 152:5368 (1994)); и изготовление триспецифических антител, как описано, например, в Tutt et al. J. Immunol. 147: 60 (1991).

Сконструированные антитела с тремя или более функциональными антигенсвязывающими участками, включая «антитела-осьминоги», также включены в настоящее изобретение (см., например, US 2006/0025576A1).

Антитело или фрагмент в настоящем документе также включает "Fab двойного действия" или "DAF", содержащий антигенсвязывающий участок, который связывается с тау (например, pTau), а также с другим отличным от него антигеном (см., US 2008/0069820, например).

Дополнительно, антитела по настоящему изобретению могут быть сконструированы для получения преимущества, связанного с рецептор-опосредованным транспортом (RMT) через гематоэнцефалический барьер (ГЭБ) за счет различного использования рецепторов ГЭБ (т.е. рецептора трансферрина, рецептора инсулина, белка 8, родственного рецептору липопротеинов низкой плотности, транспортера глюкозы 1 (Glutl) и т.п.) (см., например, WO9502421). Например, антитела по настоящему изобретению можно сделать мультиспецифическими, нацеленными на тау и рецептор ГЭБ. Неограничивающий пример полиспецифического антитела включает биспецифическое антитело, в котором одно плечо антитела представляет собой фрагмент антитела по настоящему изобретению и другое плечо антитела нацелено на рецептор ГЭБ, который опосредует транспорт через ГЭБ. Рецептор ГЭБ, например, может включать рецептор трансферрина (TfR), рецептор инсулина, рецептор инсулиноподобного фактора роста (рецептор IGF), белок 8, родственный рецептору липопротеинов низкой плотности (LRP8), белок 1, родственный рецептору липопротеинов низкой плотности (LRP1), транспортер глюкозы 1 (Glutl) и фактор роста, подобный гепаринсвязывающему эпидермальному фактору роста (HB-EGF).

7. Варианты антител

В определенных вариантах осуществления рассматриваются варианты аминокислотной последовательности антител, предлагаемых в настоящем документе. Например, может быть желательным улучшение аффинности связывания и/или других биологических свойств антитела. Варианты аминокислотной последовательности антитела можно получать при введении подходящих модификаций в нуклеотидную последовательность, кодирующую антитело, или путем пептидного синтеза. Такие модификации включают, например, делеции, и/или вставки и/или замены остатков в пределах аминокислотных последовательностей антитела. Для получения окончательной конструкции могут быть произведены любые комбинации делеции, вставки и замены, при условии, что окончательная конструкция обладает желаемыми характеристиками, например, связывается с антигеном.

a) Варианты с заменами, вставками и делециями

В определенных вариантах осуществления предлагаются варианты антител с одной один или более заменами аминокислот. Участки, представляющие интерес для замещающего мутагенеза, включают HVR и FR.

Консервативные замены представлены в таблице A под заголовком "Предпочтительные замены". Более существенные замены приведены в таблице A под заголовком "Примеры замен", и как дополнительно описано ниже, относительно классов боковой цепи аминокислот. Замены аминокислот можно производить в антителе, представляющем интерес, и проводить скрининг продуктов по желаемому свойству, например, сохраненное/улучшенное связывание с антигеном, сниженная иммуногенность, или улучшенная ADCC или CDC.

ТАБЛИЦА A
Исходный остаток Примеры замен Предпочтительные замены
Ala (A) Val; Leu; Ile Val
Arg(R) Lys; Gln; Asn Lys
Asn (N) Gln; His; Asp, Lys; Arg Gln
Asp (D) Glu; Asn Glu
Cys(C) Ser; Ala Ser
Gln (Q) Asn; Glu Asn
Glu (E) Asp; Gln Asp
Gly(G) Ala Ala
His (H) Asn; Gln; Lys; Arg Arg
Ile (I) Leu; Val; Met; Ala; Phe; норлейцин Leu
Leu (L) норлейцин; Ile; Val; Met; Ala; Phe Ile
Lys (K) Arg; Gln; Asn Arg
Met (M) Leu; Phe; He Leu
Phe(F) Trp; Leu; Val; Ile; Ala; Tyr Tyr
Pro (P) Ala Ala
Ser(S) Thr Thr
Thr (T) Val; Ser Ser
Trp (W) Tyr; Phe Tyr
Tyr(Y) Trp; Phe; Thr; Ser Phe
Val (V) Ile; Leu; Met; Phe; Ala; норлейцин Leu

Аминокислоты можно сгруппировать по общим свойствам боковых цепей:

(1) гидрофобные: норлейцин, Met, Ala, Val, Leu, Ile;

(2) нейтральные гидрофильные: Cys, Ser, Thr, Asn, Gln;

(3) кислые: Asp, Glu;

(4) основные: His, Lys, Arg;

(5) остатки, которые влияют на ориентацию цепи: Gly, Pro;

(6) ароматические: Trp, Tyr, Phe.

Неконсервативные замены повлекут за собой замену члена одного из этих классов на другой класс.

Один из типов варианта с заменой включает замену одного или более остатков гипервариабельной области родительского антитела (например, гуманизированного антитела или антитела человека). Как правило, полученный вариант(-ы), выбранный для дальнейшего исследования, будет иметь модификации (например, улучшения) конкретных биологических свойств (например, повышенная аффинность, сниженная иммуногенность) по сравнению с родительским антителом и/или будет иметь по существу сохраненные конкретные биологические свойства родительского антитела. Примером варианта с заменой является аффинно зрелое антитело, которое может быть легко создано, например, с использованием способов созревания аффинности на основе фагового дисплея, таких как способы, описываемые в настоящем документе. В кратком изложении, мутируют один или более остатков HVR, вариантные антитела располагают на фаге и отбирают по конкретной биологической активности (например, аффинности связывания).

Изменения (например, замены) можно производить в HVR, например для того, чтобы улучшить аффинность антитела.

Такие изменения можно производить в «горячих точках» HVR, т.е. в остатках, которые кодируются кодонами, мутирующими с высокой частотой в процессе соматического созревания (см., например, Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), и/или в остатках, которые контактируют с антигеном, с получением вариантной VH или VL, которую тестируют на аффинность связывания. Описано созревание аффинности путем конструирования и повторного отбора из вторичных библиотек, например, в Hoogenboom et al. в Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, (2001).) В некоторых вариантах осуществления созревания аффинности, вносят разнообразие в вариабельные гены, выбранные для созревания, любым из ряда способов (например, ПЦР со сниженной точностью, перестановка цепей или сайт-специфический мутагенез). Затем создают вторичную библиотеку. После этого проводят скрининг библиотеки для выявления любых вариантов антител с желаемой аффинностью. Другой способ для внесения разнообразия включает HVR-направленные подходы, в которых рандомизируют несколько остатков HVR (например, 4-6 остатков за один раз). Можно специфически выявлять остатки HVR, участвующие в связывании с антигеном, например, с использованием аланин-сканирующего мутагенеза или моделирования. В частности, часто целью являются CDR-H3 и CDR-L3.

В определенных вариантах осуществления замены, вставки или делеции могут происходить в пределах одной или более при условии, что такие замены по существу не снижают способность антитела связываться с антигеном. Например, в HVR можно производить консервативные изменения (например, консервативные замены, приведенные в настоящем документе), которые по существу не снижают аффинность связывания. Такие изменения могут, например, находиться вне антиген-контактирующих остатков в HVR. В определенных вариантах осуществления последовательностей вариантных VH и VL, предложенных выше, каждая HVR или не изменена, или содержит не более чем одну, две или три замены аминокислот.

Подходящий способ для выявления остатков или областей антитела, которые могут являться мишенью для мутагенеза, называется "аланин-сканирующий мутагенез", описанный Cunningham и Wells (1989) Science, 244: 1081-1085. В этом способе, остаток или группу целевых остатков (например, заряженные остатки, такие как arg, asp, his, lys и glu) выявляют и замещают нейтрально или отрицательно заряженной аминокислотой (например, аланином или полиаланином), чтобы определить, изменится ли взаимодействие антитела с антигеном. Можно вводить дополнительные замены по аминокислотным положениям, демонстрирующим функциональную чувствительность к исходным заменам. Альтернативно, или дополнительно, кристаллическая структура комплекса антиген-антитело для выявления точек контакта между антителом и антигеном. Такие остатки в точке контакта и соседние остатки могут быть выбраны или отвергнуты в качестве кандидатов на замены. Варианты проходят отбор, для того чтобы определить, обладают ли они желаемыми свойствами.

Вставки в аминокислотную последовательность включают амино- и/или карбоксил-концевые слияния в диапазоне длин от одного остатка до полипептидов, содержащих сто или более остатков, а также вставки внутри последовательности из одного или множества аминокислотных остатков. Примеры концевых вставок включают антитело с N-концевым остатком метионина. Другие варианты со вставками в молекулу антитела включают слияние N- или C-конца антитела с ферментом (например, для антитело-опосредованной терапии с использованием ферментов и пролекарств ADEPT) или полипептидом, который увеличивает время полувыведения антитела из сыворотки.

b) Варианты гликозилирования

В определенных вариантах осуществления антитело, предлагаемое в настоящем документе, изменяют для увеличения или уменьшения степени, в которой антитело гликозилировано. Добавление или удаление участков гликозилирования в антителе может быть легко достигнуто путем изменения аминокислотной последовательности таким образом, что создается или удаляется один или более участков гликозилирования.

Если антитело содержит Fc-область, можно изменить углевод, присоединенный к ней. Нативные антитела, которые вырабатываются клетками млекопитающих, как правило, содержат разветвленный биантенный олигосахарид, который, как правило, присоединен посредством N-связи к Asn297 CH2-домена Fc-области. См., например, Wright et al. TIBTECH 15:26-32 (1997). Олигосахарид может включать различные углеводы, например, маннозу, N-ацетил глюкозамин (GlcNAc), галактозу и сиаловую кислоту, а также фукозу, присоединенную к GlcNAc в "стебле" структуры биантенного олигосахарида. В некоторых вариантах осуществления можно производить модификации олигосахарида в антителе по изобретению для создания вариантов антител с определенными улучшенными свойствами.

В одном из вариантов осуществления предлагаются варианты антител с углеводной структурой, в которой отсутствует фукоза, присоединенная (прямо или косвенно) к Fc-области. Например, количество фукозы в таком антителе может составлять от 1% до 80%, от 1% до 65%, от 5% до 65% или от 20% до 40%. Количество фукозы определяют путем расчета среднего количества фукозы в сахарной цепи у Asn297, по отношению к сумме всех гликоструктур у Asn 297 (например, комплексных, гибридных и структур с высоким содержанием маннозы), при измерении MALDI-TOF масс-спектрометрией, например, как описано в WO 2008/077546. Asn297 относится к остатку аспарагина, расположенному приблизительно в положении 297 в Fc-области (нумерация остатков Fc-области по EU), однако Asn297 может также быть расположен приблизительно ±3 аминокислоты до или после положения 297, т.е. между положениями 294 и 300, из-за небольших вариаций последовательности в антителах. Такие варианты гликозилирования могут иметь улучшенную функцию ADCC. См., например, патентные публикации США US 2003/0157108 (Presta, L.), US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Примеры публикаций, связанных с "дефукозилированными" или "фукозодефицитными" вариантами антител, включают: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Примеры клеточных линий, способных к выработке дефукозилированных антител, включают клетки Lec13 CHO, дефицитные по фукозилированию (Ripka et al. Arch. Biochem. Biophys. 249: 533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; и WO 2004/056312 A1, Adams et al., особенно в примере 11), и нокаутные клеточные линии, такие как клетки CHO, нокаутные по гену альфа-1,6-фукозилтрансферазы, FUT8 (см., например, Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4): 680-688 (2006); и WO2003/08107).

Дополнительно предлагаются варианты антител с разделенными пополам олигосахаридами, например, в которых биантенный олигосахарид, присоединенный к Fc-области антитела, разделенным пополам посредством GlcNAc. Такие варианты антител могут иметь уменьшенное фукозилирование и/или улучшенную функцию ADCC. Примеры таких вариантов антител описаны, например, в WO 2003/011878 (Jean-Mairet et al.), патенте США № 6602684 (Umana et al.) и US 2005/0123546 (Umana et al). Также предлагаются варианты антител по меньшей мере с одним остатком галактозы в олигосахариде, присоединенном к Fc-области. Такие варианты антител могут иметь улучшенную функцию CDC. Такие варианты антител описаны, например, в WO 1997/30087 (Patel et al.), WO 1998/58964 (Raju, S.) и WO 1999/22764 (Raju, S.).

c) Варианты Fc-области

В определенных вариантах осуществления можно вводить одну или более аминокислотных модификаций в Fc-область антитела, предлагаемого в настоящем документе, создавая, таким образом, вариант Fc-области. Вариант Fc-области может содержать последовательность Fc-области человека (например, Fc-области IgG1, IgG2, IgG3 или IgG4 человека) с аминокислотной модификацией (например, заменой) по одному или более аминокислотным положениям.

В определенных вариантах осуществления изобретение относится к вариантным антителам, которые обладают некоторыми, но не всеми эффекторными функциями, что делает их желаемыми кандидатами для применений, для которых важно время полувыведения антитела in vivo, в то время как конкретные эффекторные функции (такие как комплемент и ADCC) необязательны или вредны. Можно проводить анализы цитотоксичности in vitro и/или in vivo, чтобы подтвердить снижение/элиминацию функций CDC и/или ADCC. Например, можно проводить анализы связывания c Fc-рецептором (FcR), чтобы убедиться, что антитело утратило способность связывания с FcyR (таким образом, по всей видимости, утратило функцию ADCC), но сохранило способность связывания с FcRn. Первичные клетки для опосредования ADCC, NK-клетки, экспрессируют только FcγRIII, в то время как моноциты экспрессируют FcγRI, FcγRII и FcγRIII. Экспрессия FcR на гематопоэтических клетках обобщена в таблице 3 на стр.464 Ravetch и Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Неограничивающие примеры анализов in vitro для оценки функции ADCC у молекулы, представляющей интерес, описаны в патенте США № 5500362 (см., например, Hellstrom, I. et al. Proc. Natl Acad. Sci. USA 83:7059-7063 (1986)) и Hellstrom, I et al., Proc. Natl Acad. Sci. USA 82: 1499-1502 (1985); 5821337 (см. Bruggemann, M. et al., J. Exp. Med. 166: 1351-1361 (1987)). Альтернативно, можно использовать не-радиоактивные анализы (см., например, не-радиоактивный анализ цитотоксичности для проточной цитометрии ACTI™ (CellTechnology, Inc. Mountain View, CA) и не-радиоактивный анализ цитотоксичности CytoTox 96® (Promega, Madison, WI)). Подходящие эффекторные клетки для таких анализов включают мононуклеарные клетки периферической крови (PBMC) и клетки - естественные киллеры (NK). Альтернативно, или дополнительно, активность ADCC у молекулы, представляющей интерес, можно оценивать in vivo, например, на животной модели, такой как описанная в Clynes et al. Proc. Natl. Acad. Sci. USA 95:652-656 (1998). Можно также проводить анализы связывания Clq, чтобы подтвердить, что антитело не способно связываться с Clq и, таким образом, утратило функцию CDC. См., например, иммуноферментный анализ (ELISA) для связывания Clq и C3c в WO 2006/029879 и WO 2005/100402. Для оценки активации комплемента, можно проводить анализ CDC (см., например, Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996); Cragg. M.S. et al. Blood 101: 1045-1052 (2003); и Cragg, M.S. and M.J. Glennie, Blood 103:2738-2743 (2004)). Можно также проводить определение связывания с FcRn и клиренса/времени полужизни in vivo с использованием способов, известных в данной области (см., например, Petkova, S.B. et al., Intl. Immunol. 18(12): 1759- 1769 (2006)).

Антитела со сниженной эффекторной функцией включают антитела с заменой одного или более остатков Fc-области 238, 265, 269, 270, 297, 327 и 329 (патент США № 6737056). Такие Fc-мутанты включают Fc-мутанты с заменами по двум и более аминокислотным положениям из 265, 269, 270, 297 и 327, включая так называемый Fc-мутант "DANA" с аланиновой заменой по остаткам 265 и 297 (патент США № 7332581).

Описаны конкретные варианты антител с улучшенным или ослабленным связыванием с FcR. (См., например, патент США № 6737056, WO 2004/056312 и Shields et al., J Biol. Chem. 9(2): 6591-6604 (2001)).

В определенных вариантах осуществления вариантное антитело содержит Fc-область с одной или более заменами аминокислот, которые улучшают ADCC, например, заменами по положениям 298, 333 и/или 334 Fc-области (нумерация остатков по EU).

В некоторых вариантах осуществления можно производить изменения в Fc-области, которые приводят к изменению (т.е. или улучшают или ослабляют) связывания с C1q и/или обусловленной комплементом цитотоксичности (CDC), например, как описано в патент США № 6194551, WO 99/51642, и Idusogie et al. J. Immunol. 164: 4178-4184 (2000).

Антитела с увеличенным временем полуизни и улучшенным связыванием с неонатальным Fc-рецептором (FcRn), который отвечает за перенос материнских IgG к плоду (Guyer et al., J. Immunol. 117: 587 (1976) и Kim et al, J. Immunol. 24:249 (1994)), описаны в US2005/0014934A1 (Hinton et al.). Эти антитела содержат Fc-область с одной или более заменами, которые улучшают связывание Fc-области с FcRn. Такие варианты Fc включают Fc с заменами по одному или более остаткам Fc-области: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 или 434, например, с заменой остатка 434 Fc-области (патент США № 7371826).

См. также Duncan & Winter, Nature 322:738-40 (1988), патент США № 5648260, патент США № 5624821 и WO 94/29351 относительно других примеров вариантов Fc-области.

d) Варианты антител, сконструированных с цистеином

В определенных вариантах осуществления может быть желательным создать антитела, сконструированные с цистеином, например, "thioMAb", в которых один или более остатков антитела замещены остатками цистеина. В конкретных вариантах осуществления замещенные остатки расположены в доступных участках антитела. При замещении этих остатков цистеином реактивные тиоловые группы, таким образом, располагаются в доступных участках антитела и их можно использовать для конъюгирования антитела с другими группами, такими как лекарственная группа или группа линкер-лекарственное средство, для создания иммуноконъюгата, как описано далее в настоящем документе. В определенных вариантах осуществления можно замещать цистеином любой один или более следующих остатков: V205 (нумерация по Kabat) легкой цепи, A118 (нумерация EU) тяжелой цепи и S400 (нумерация EU) Fc-области тяжелой цепи. Антитела, сконструированные с цистеином, можно получать, как описано, например, в патенте США № 7521541.

e) Производные антител

В определенных вариантах осуществления антитело, предлагаемое в настоящем документе, можно дополнительно модифицировать для включения дополнительных небелковых групп, которые легкодоступны и известны в данной области. Группы, подходящие для получения производных антител, в качестве неограничивающих примеров включают водорастворимые полимеры. Водорастворимые полимеры в качестве неограничивающих примеров включают, полиэтиленгликоль (PEG), сополимеры этиленгликоль/пропиленгликоль, карбоксиметилцеллюлозу, декстран, поливиниловый спирт, поливинилпирролидон, поли-1,3-диоксолан, поли-1,3,6-триоксан, сополимер этилен/малеиновый ангидрид, полиаминокислоты (или гомополимеры или случайные сополимеры), и декстран или поли(н-винилпирролидон)полиэтиленгликоль, гомополимеры пропропиленгликоля, coполимеры пролипропиленоксид/этиленоксид, полиоксиэтилированные полиолы (например, глицерин), поливиниловый спирт, и их смеси. Полиэтиленгликоль пропиональальдегид может иметь преимущества в производстве из-за его стабильности в воде. Полимер может быть любой молекулярной массы, и может быть разветвленным или неразветвленным. Число полимеров, присоединенных к антителу, может варьировать, и если присоединено более одного полимера, они могут представлять собой одинаковые или различные молекулы. В основном число и/или тип полимеров, используемых для получения производных, можно определять на основании потребностей, включая в качестве неограничивающих примеров, конкретные свойства или функции улучшаемого антитела, будет производное антитела использоваться в терапии при определенных условиях, и т.д.

В другом варианте осуществления предлагаются конъюгаты антитела и небелковой части, которые могут избирательно нагреваться под воздействием облучения. В одном из вариантов осуществления небелковая часть представляет собой углеродную нанотрубку (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). Облучение может быть любой длины волны, и в качестве неограничивающих примеров включает длины волн, которые не повреждают обычные клетки, но которые нагревают небелковую до температуры, при которой погибают клетки, расположенные рядом с антителом-небелковой частью.

B. Рекомбинантные способы и композиции

Антитела можно получать при помощи рекомбинантных способов и композиций, например, как описано в патенте США № 4816567. В одном из вариантов осуществления предлагается изолированная нуклеиновая кислота, кодирующая антитело к тау (например, антитело к pTau), описываемое в настоящем документе. Такая нуклеиновая кислота может кодировать аминокислотную последовательность, содержащую VL и/или аминокислотную последовательность, содержащую VH антитела (например, легкие и/или тяжелые цепи антитела). В дополнительном варианте осуществления предлагаются один или более векторов (например, экспрессирующие векторы), содержащие такую нуклеиновую кислоту. В дополнительном варианте осуществления предлагается клетка-хозяин, содержащая такую нуклеиновую кислоту. В одном из таких вариантах осуществления клетка-хозяин содержит (например, была трансформирована): (1) вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VL антитела, и аминокислотную последовательность, содержащую VH антитела, или (2) первый вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VL антитела, и второй вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VH антитела. В одном из вариантов осуществления клетка-хозяин является эукариотической, например, клетка китайского хомячка (CHO) или лимфоидная клетка (например, клетка Y0, NSO, Sp20). В одном из вариантов осуществления предлагается способ получения антитела к тау, где способ включает культивирование клетки-хозяина, содержащей нуклеиновую кислоту, кодирующую антитело, как указано выше, в условиях, подходящих для экспрессии антитела, и необязательно восстановление антител из клетки-хозяина (или среды-хозяина для культивирования клеток).

Для рекомбинантной выработки антитела к тау, выделяют нуклеиновую кислоту, кодирующую антитело, например, описанное выше, и вводят в один или более векторов для дальнейшего клонирования и/или экспрессии в клетке-хозяине. Такую нуклеиновую кислоту можно легко выделить и секвенировать при помощи общепринятых способов (например, с использованием олигонуклеотидных зондов, которые способны к специфическому связыванию с генами, кодирующими тяжелые и легкие цепи антитела).

Подходящие клетки-хозяева для клонирования или экспрессии антитело-кодирующих векторов включают прокариотические или эукариотические клетки, описываемые в настоящем документе. Например, антитела можно получать в бактериях, в частности, если не нужны гликозилирование и эффекторная функция Fc. Для экспрессии фрагментов антител и полипептидов в бактериях, см., например, патенты США №№ 5648237, 5789199 и 5840523. (См. также Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, описывающие экспрессию фрагментов антител в E. coli.) После экспрессии, антитело можно выделить из бактериальной клеточной массы в растворимой фракции и затем дополнительно очистить.

В дополнение к прокариотам, подходящими хозяевами для клонирования или экспрессии антитело-кодирующих векторов являются эукариотические микроорганизмы, такие как нитевидные грибы или дрожжи, включая штаммы грибов и дрожжей, с «гуманизированными» путями гликозилирования, что в результате приводит к продукции антитела с частично или полностью человеческим паттерном гликозилирования. См. Gerngross, Nat. Biotech. 22: 1409-1414 (2004), и Li et al., Nat. Biotech. 24: 210-215 (2006).

Подходящими клетками-хозяевами для экспрессии гликозилированного антитела также являются клетки, полученные из многоклеточных организмов (беспозвоночных и позвоночных). Примеры клеток беспозвоночных включают клетки растений и насекомых. Были обнаружены некоторые штаммы бакуловирусов, которые можно использовать в сочетании с клетками насекомых, в частности, для трансфекции клеток Spodoptera frugiperda.

Растительные клеточные культуры также можно использовать в качестве хозяев. См., например, патенты США №№ 5959177, 6040498, 6420548, 7125978 и 6417429 (описывающие технологию PLANTIBODIES™ для выработки антител в трансгенных растениях).

Клетки позвоночных также можно использовать в качестве хозяев. Например, могут подойти клеточные линии млекопитающих, которые адаптированы для роста в суспензии. Другие примеры подходящих клеточных линий-хозяев от млекопитающих представляют собой линию почки обезьяны CV1, трансформированную SV40 (COS-7), линию эмбриональной почки человека (293 или клетки 293, описанные, например, в Graham et al., J. Gen Virol. 36: 59 (1977)), клетки почки новорожденного хомяка (BHK), клетки Сертоли мыши (клетки TM4, описанные, например, в Mather, Biol. Reprod. 23: 243-251 (1980)), клетки почки обезьяны (CV1), клетки почки африканской зеленой мартышки (VERO-76), клетки карциномы шейки матки человека (HELA), клетки почки собаки (MDC), клетки печени крысы буффало (BRL3A), клетки человеческого легкого (W138), клетки печени человека (HepG2), опухоль молочной железы мыши (MMT060562), клетки TRI, описанные например, в Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982), клетки MRC5 и клетки FS4. Другие подходящие клеточных линий-хозяев от млекопитающих включают клетки яичника китайского хомяка (CHO), включая DHFR- клетки CHO (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)) и клеточные линии миеломы, такие как Y0, NSO и Sp2/0. Для обзора конкретных клеточных линий-хозяев от млекопитающих, подходящих для выработки антител, см., например, Yazaki и Wu, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NT), pp. 255-268 (2003).

C. Анализы

Антитела к тау (например, антитела к pTau), предлагаемые в настоящем документе, можно идентифицировать, подвергать скринингу или характеризовать по их физико-химическим свойствам и/или видам биологической активности при помощи различных анализов, известных в данной области.

1. Анализы связывания и другие анализы

В одном из аспектов антитело по изобретению тестируют по активности связывания с антигеном, например, известными способами, такими как ELISA, Вестерн-блоттинг, Biacore и т.д.

В другом аспекте можно использовать конкурентный анализ для выявления антитела, которое конкурирует с одним или более антителами, описываемыми в настоящем документе (например, антитело с легкой цепью из SEQ ID NO:61 и тяжелой цепью из SEQ ID NO:63, антитело с легкой цепью из SEQ ID NO:64 и тяжелой цепью из SEQ ID NO:87, антитело с легкой цепью из SEQ ID NO:65 и тяжелой цепью из SEQ ID NO:87, антитело с легкой цепью из SEQ ID NO:72 и тяжелой цепью из SEQ ID NO:87, антитело с легкой цепью из SEQ ID NO:82 и тяжелой цепью из SEQ ID NO:87, или антитело с легкой цепью из SEQ ID NO:83 и тяжелой цепью из SEQ ID NO:87), за связывание с pTau. В определенных вариантах осуществления такое конкурирующее антитело связывается с тем же самым эпитопом (например, линейным или конформационным эпитопом), который связвается с такими антителами. Подробные примеры способов для картирования эпитопа, с которым связывается антитело, изложены в Morris (1996) "Epitope Mapping Protocols" в Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).

В примере конкурентного анализа, иммобилизованный pTau инкубируют в растворе, содержащем первое меченое антитело, которое связывается с pTau (например, антитело с легкой цепью из SEQ ID NO:61 и тяжелой цепью из SEQ ID NO:63, антитело с легкой цепью из SEQ ID NO:64 и тяжелой цепью из SEQ ID NO:87, антитело с легкой цепью из SEQ ID NO:65 и тяжелой цепью из SEQ ID NO:87, антитело с легкой цепью из SEQ ID NO:72 и тяжелой цепью из SEQ ID NO:87, антитело с легкой цепью из SEQ ID NO:82 и тяжелой цепью из SEQ ID NO:87, или антитело с легкой цепью из SEQ ID NO:83 и тяжелой цепью из SEQ ID NO:87) и второе немеченое антитело, которое исследуют на его способность конкурировать с первым антителом за связывание с pTau. Второе антитело может присутствовать в гибридомном супернатанте. В качестве контроля, инкубируют иммобилизованный pTau в растворе, содержащем первое меченое антитело, но без второго немеченого антитела. После инкубации в условиях, позволяющих связывание первого антитела с pTau, удаляют избыток несвязавшегося антитела и измеряют количество метки, связанной с иммобилизованным pTau. Если количество метки, связанной с иммобилизованным pTau, по существу снижено в тестируемом образце по сравнению с контрольным образцом, это указывает на то, что второе антитело конкурирует с первым антителом за связывание с pTau. См. Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).

2. Анализы активности

В одном из аспектов предлагаются анализы для выявления антител к тау (например, антитела к pTau), имеющих биологическую активность. Биологическая активность может включать, например, связывание таких антител с тау (например, с нейрофибриллярными клубками в головном мозге, содержащими тау) и снижение уровня тау-белка (например, общего тау, общего растворимого тау, растворимого фосфорилированного тау, общего нерастворимого тау, нерастворимого фосфорилированного тау, гиперфосфорилированного тау или парных спиральных филаментов, содержащих гиперфосфорилированный тау) в головном мозге, например, в коре головного мозга и/или гиппокампе. Также предлагаются антитела, имеющие такую биологическую активность in vivo и/или in vitro.

В определенных вариантах осуществления антитело по изобретению тестируют на такую биологическую активность. Например, можно использовать животную модель таупатии, такую как тау-трансгенные мыши (например, P301L), для выявления связывания антител к тау в отделах головного мозга, и, в частности, с нейрофибриллярными клубками в мозге трансгенных мышей. Дополнительно, использовать животную модель таупатии, такую как тау-трансгенные мыши (например, P301L), можно лечить антителами к тау (например, антителами к pTau) и можно использовать экспериментальные способы, известные в данной области, чтобы оценить, снижает ли такое лечение уровень тау-белка (например, общего тау, общего растворимого тау, растворимого фосфорилированного тау, общего нерастворимого тау, нерастворимого фосфорилированного тау, гиперфосфорилированного тау или парных спиральных филаментов, содержащих гиперфосфорилированный тау) в головном мозге мыши (например, в коре головного мозга и/или гиппокампе).

D. Иммуноконъюгаты

Изобретение также относится к иммуноконъюгатам, содержащим антитело к тау (например, антитело к pTau) по настоящему изобретению, конъгированное с одним или более цитотоксическими средствами, такими как химиотерапевтические средства или лекарственные средства, средства, ингибирующие рост, токсины (например, белковые токсины, ферментативно активные токсины бактериального, грибного, растительного или животного происхождения, или их фрагменты) или радиоактивные изотопы.

В одном из вариантов осуществления иммуноконъюгат представляет собой конъюгат антитело-лекарственное средство (ADC), в котором антитело конъгировано с одним или более лекарственными средствами, включая в качестве неограничивающих примеров майтанзиноид (см. патенты США №№ 5208020, 5416064 и европейский патент EP 0425235 B1), ауристатин, такой как лекарственные части монометилауристатина DE и DF (MMAE и MMAF) (см. патенты США №№ 5635483 и 5780588 и 7498298), доластатин, калихимицин или его производное (см. патенты США №№ 5712374, 5714586, 5739116, 5767285, 5770701, 5770710, 5773001 и 5877296; Hinman et al., Cancer Res. 53: 3336-3342 (1993), и Lode et al. Cancer Res. 58: 2925-2928 (1998)), антрациклин, такой как дауномицин или доксорубицин (см. Kratz et al., Current Med. Chem. 13: 477-523 (2006); Jeffrey et al., Bioorganic & Med. Chem. Letters 16: 358-362 (2006); Torgov et al., Bioconj. Chem. 16: 717-721 (2005); Nagy et al., Proc. Natl. Acad. Sci. USA 97: 829-834 (2000); Dubowchik et al., Bioorg. & Med. Chem. Letters 12:1529-1532 (2002); King et al., J. Med. Chem. 45: 4336-4343 (2002); и патент США № 6630579), метотрексат, виндезин, таксан, такой как доцетаксел, паклитаксел, ларотаксел, тесетаксел и ортатаксел, трихотецен и CC 1065.

В другом варианте осуществления иммуноконъюгат содержит антитело, описанное в настоящем документе, конъгированное с ферментативно активным токсином или его фрагментом, включая в качестве неограничивающих примеров А-цепь дифтерии, несвязывающие активные фрагменты дифтерийного токсина, А-цепь экзотоксина (из Pseudomonas aeruginosa), А-цепь рицина, А-цепь абрина, А-цепь модексина, альфа-сарцин, белки Aleurites fordii, белки диантина, белки Phytolaca americana (PAPI, PAPII, и PAP-S), ингибитор Momordica charantia, курцин, кротин, ингибитор Sapaonaria officinalis, гелонин, митогеллин, рестриктоцин, феномицин, эномицин и трихотецены.

В другом варианте осуществления иммуноконъюгат содержит антитело, описанное в настоящем документе, конъгированное с радиоактивным атомом для образования радиоконъюгата. Для производства радиоконъюгатов доступен ряд радиоактивных изотопов. Примеры включают At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu. Если радиоконъюгат применяют для детекции, он может содержать радиоактивный атом для сцинтиграфических исследований, например tc99m или I123, или спиновую метку для ядерного магнитного резонанса (ЯМР) (также известного, как магнитно-резонансная томография, МРТ), такую как йод-123, йод-131, индий-111, флуорин-19, углерод-13, азот-15, кислород-17, гадолиний, марганец или железо.

Конъюгаты антитела и цитотоксического средства можно получать при помощи ряда бифункциональных белковых связывающих агентов, таких как N-сукцинимидил-3-(2-пиридилдитио)пропионат (SPDP), сукцинимидил-4-(N-малеимидометил)циклогексан-1-карбоксилат (SMCC), иминотиолан (IT), бифункциональные производные имидоэфиров (такие как диметил адипимидат HCl), активные сложные эфиры (такие как дисукцинимидил суберат). альдегиды (такие как глутаральдегид), бис-азидо-соединения (такие как бис(п-азидобензоил)гександиамин), производные бис-диазония (такие как бис-(п-диазонийбензоил)-этилендиамин), диизоцианаты (такие как толуол 2,6-диизоцианат) и бис-активные флуориновые соединения (такие как 1,5-дифтор-2,4-динитробензол). Например, рициновый иммунотоксин можно получать, как описано в Vitetta et al., Science 238: 1098 (1987). Примером хелатирующего средства для конъюгации радионуклида с антителом является 1-изотиоцианатобензил-3-метилдиэтилен триаминпентауксусная кислота (MX-DTPA), меченая углеродом-14. См. W094/11026. Линкер может представлять собой "расщепляемый линкер", облегчающий высвобождение цитотоксического лекарственного средства в клетке. Например, можно использовать кислото-неустойчивый линкер, чувствительный к пептидазе линкер, фоточувствительный линкер, линкер, содержащий диметил или дисульфид (Chari et al., Cancer Res. 52: 127-131 (1992), патент США № 5208020).

Иммуноконъюгаты или ADC в настоящем документе явным образом включают, но не ограничиваются такими конъюгатами, которые получены с перекрестно-сшивающими реагентами, включая в качестве неограничивающих примеров, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, сульфо-EMCS, сульфо-GMBS, сульфо-KMUS, сульфо-MBS, сульфо-SIAB, сульфо-SMCC и сульфо-SMPB, и SVSB (сукцинимидил-(4-винилсульфон)бензоат), которые являются коммерчески доступными (например, у Pierce Biotechnology, Inc., Rockford, IL., USA).

E. Способы и композиции для диагностики и детекции

В определенных вариантах осуществления любое из антител к тау, предлагаемое в настоящем документе, подходит для детекции наличия тау в биологическом образце. Применяемый в настоящем документе термин "детекция" включает количественную или качественную детекцию. В определенных вариантах осуществления биологический образец содержит клетку или ткань, такую как цереброспинальная жидкость, клетка или ткань головного мозга (например, коры головного мозга или гиппокампа) или кровь. В одном из вариантов осуществления биологический образец представляет собой цереброспинальную жидкость.

В одном из вариантов осуществления предлагается антитело к тау (например, антитело к pTau) для применения в способе диагностики или детекции. В дополнительном аспекте предлагается способ детекции наличия тау (например, pTau) в биологическом образце. В определенных вариантах осуществления способ включает контакт биологического образца с антителом к тау, описанным в настоящем документе, в условиях позволяющих связывание антитела к тау с тау, и детекцию того, образуется ли комплекс между антителом к тау и тау. В определенных вариантах осуществления способ включает контакт биологического образца с антителом к pTau, описанным в настоящем документе, в условиях позволяющих связывание антитела к pTau с pTau, и детекцию того, образуется ли комплекс между антителом к pTau и pTau. Такой способ может быть способом in vitro или in vivo. Дополнительно, комплекс, образовавшийся между антителом к тау и тау в исследуемом биологическом образце можно сравнивать с комплексом, образовавшимся в контрольном биологическом образце (например, биологическом образце от здорового индивидуума или индивидуумов). Количество комплекса, образовавшегося между антителом к тау и тау в исследуемом биологическом образце, можно также измерить количественно и сравнить с количеством комплекса, образовавшегося в контрольном биологическом образце (например, биологическом образце от здорового индивидуума или индивидуумов) или со средним известным количеством комплекса, который образуется у здоровых индивидуумов.

В одном из вариантов осуществления антитело к тау применяют для отбора индивидуумов, подходящих для терапии антителом к тау, например, когда тау является биомаркером для отбора пациентов. В одном из вариантов осуществления антитело к pTau применяют для отбора индивидуумов, подходящих для терапии антителом pTau, например, когда pTau является биомаркером для отбора пациентов. Например, в некоторых вариантах осуществления антитело к тау (например, антитело к pTau) применяют для выявления того, есть ли у индивидуума заболевание или нарушение, связанное с белком тау, или есть ли у индивидуума высокий риск развития (или предрасположенность) заболевания или нарушения, связанного с белком тау.

Примеры заболеваний или нарушений, которые можно диагностировать при помощи антитела по изобретению, включают заболевания или нарушения, ассоциированные с тау-белком, и заболевания или нарушения, вызванные или ассоциированные с образованием нейрофибриллярных клубков или нитей нейропилей. В некоторых вариантах осуществления заболевания или нарушения, которые можно диагностировать при помощи антитела по изобретению, включают заболевания или нарушения, ассоциированные с тау-белком, которые проявляются в ухудшении или потере когнитивных функций, включая логическое рассуждение, оценку ситуаций, возможности памяти, обучение и/или целенаправленную ориентацию. В частности, заболевания или нарушения, которые можно диагностировать при помощи антитела по изобретению, включают таупатии, такие как нейродегенеративные таупатии. Примеры заболеваний или нарушений, которые можно диагностировать с использованием антитела по изобретению, в качестве неограничивающих примеров включают, болезнь Альцгеймера, боковой амиотрофический склероз, болезнь Паркинсона, болезнь Кройнцфельд-Якоба, деменцию боксеров, синдром Дауна, болезнь Герстманна-Штраусслера-Шейнкера, миозит с включенными тельцами, церебральную амилоидную ангиопатию с прионовыми белками, травматическое повреждение головного мозга, Гуамский комплекс из бокового амиотрофического склероза/паркинсонизма-деменции, не-Гуамскую болезнь мотонейронов с нейрофибриллярными клубками, деменцию с аргирофильной зернистостью, кортикобазальную дегенерацию, диффузные нейрофибриллярные клубки с кальцификацией, фронтотемпоральную деменцию, фронтотемпоральную деменцию с паркинсонизмом, сцепленную с хромосомой 17, болезнь Галлевордена-Шпатца, множественную системную атрофию, болезнь Ниманна-Пика, тип C, паллидо-понто-нигральную дегенерацию, болезнь Пика, прогрессирующий подкорковый глиоз, прогрессирующий супрануклеарный паралич, подострый склерозирующий панэнцефалит, деменцию с нейрофибриллярными клубками, постэнцефалитный паркинсонизм и миотоническую дистрофию. В одном из вариантов осуществления нарушение, которое можно диагностировать с использованием антитела по изобретению, представляет собой болезнь Альцгеймера (БА).

В определенных вариантах осуществления предлагаются меченые антитела к тау. Метки в качестве неограничивающих примеров включают, метки или группы, которые детектируются напрямую (такие как флуоресцентные, хромофорные, электроноплотные, хемилюминесцентные и радиоактивные метки), а также составные группы, такие как ферменты или лиганды, которые детектируются опосредованно, например, путем ферментативной реакции или молекулярного взаимодействия. Примеры меток в качестве неограничивающих примеров включают, радиоактивные изотопы 32P, 14C, 125I, 3H и 131I, флуорофоры, такие как хелаты редкоземельных элементов или флуоресцеин и его производные, родамин и его производные, дансил, умбеллиферон, люциферазы, например, люциферазу светлячка и бактериальную люциферазу (патент США № 4737456), люциферин, 2,3-дигидрофталазиндионы, пероксидазу хрена (HRP), щелочную фосфатазу, β-галактозидазу, глюкоамилазу, лизоцим, сахаридоксидазы, например, глюкозооксидазу, галактозооксидазу, и глюкоза-6-фосфат дегидрогеназу, гетероциклические оксидазы, так как уриказа и ксантиноксидаза, соединенные с ферментом, который использует пероксид водорода для окисления предшественника красителя, таким как HRP, лактопероксидаза, или микропероксидаза, биотин/авидин, спиновые метки, бактериофаговые метки, стабильные свободные радикалы, и т.п.

F. Фармацевтические составы

Фармацевтические составы антитела к тау (например, антитела к pTau), описанного в настоящем документе, получают путем смешивания такого антитела желаемой степени чистоты с одним или более необязательными фармацевтически приемлемыми носителями {Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)) в форме лиофилизированных составов или водных растворов.

Фармацевтически приемлемые носители в основном не токсичны для реципиентов в используемых дозировках и концентрациях, и в качестве неограничивающих примеров включают буферы, такие как фосфат, цитрат и другие органические кислоты, антиоксиданты, включая аскорбиновую кислоту и метионин, консерванты (такие как октадецилдиметилбензилхлорид аммония, гексаметоний хлорид, хлорид бензалкония, хлорид бензетония, фенол, бутил или бензиловый спирт, алкилпарабены, такие как метил или пропилпарабен, катехол, резорцинол, циклогексанол, 3-пентанол и м-крезол), низкомолекулярные (менее чем приблизительно 10 остатков) полипептиды, белки, такие как сывороточный альбумин, желатин, или иммуноглобулины, гидрофильные полимеры, такие как поливинилпирролидон, аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин, или лизин, моносахариды, дисахариды, и другие углеводы, включая глюкозу, маннозу или декстрины, хелатирующие средства, такие как ЭДТА, сахара, такие как сахароза, маннит, трегалоза или сорбит, солеобразующие противоионы, такме как натрий, комплексные соединения с металлами (например, Zn-белковые комплексы), и/или неионные поверхностно-активные вещества, такие как полиэтиленгликоль (ПЭГ). Примеры фармацевтически приемлемых носителей в настоящем документе дополнительно включают средства диспергирования лекарственных средств в межклеточном пространстве, такие как растворимые нейтрально-активные гиалуронидазные гликопротеины (sHASEGP), например, растворимые PH-20 гиалуронидазные гликопротеины человека, такие как rHuPH20 (HYLENEX®, Baxter International, Inc.). Конкретные примеры sHASEGPs и способы применения, включая rHuPH20, описаны в патентных публикациях США 2005/0260186 и 2006/0104968. В одном из аспектов, sHASEGP комбинируют с одной или более дополнительными гликозаминогликанaзами, такими как хондроитиназы.

Примеры лиофилизированных составов антител описаны в патенте США № 6267958.

Водные составы антител включают составы, описанные в патенте США № 6171586 и WO2006/044908, составы, описанные в последнем, включают гистидин-ацетатный буфер.

Состав, предлагаемый в настоящем документе, может также содержать более одного активного ингредиента по мере необходимости для конкретного случая, подлежащего лечению, предпочтительно с дополняющими действиями, которые не влияют негативно друг на друга. Такие активные ингредиенты удобно использовать в комбинации в количествах, которые эффективны для намеченного использования.

Композицию по изобретению можно вводить в комбинации с другими композициями, содержащими биологически активное вещество или соединение, такое как, например, известное соединение, которое используют для лечения таупатий и/или амилоидозов, группы заболеваний и нарушений, ассоциированных с амилоидом или амилоидоподобным белком, таким как β-амилоидный белок, вовлеченный в болезнь Альцгеймера.

Как правило, другое биологически активное соединение может включать усилители нейрональной передачи, психотерапевтические лекарственные средства, ингибиторы ацетилхолинэстеразы, блокаторы кальциевых каналов, биогенные амины, бензодиазепиновые транквилизаторы, усилители синтеза, хранения или высвобождения ацетилхолина, агонисты постсинаптического рецептора ацетилхолина, ингибиторы моноаминоксидазы A или B, антагонисты рецептора N-метил-D-аспартатглутамината, нестероидные противовоспалительные лекарственные средства, антиоксиданты и антагонисты серотониновых рецепторов. В частности, биологически активное средство или соединение может включать, по меньшей мере, одно соединение, выбранное из группы, состоящей из соединений против окислительного стресса, соединений против апоптоза, хелаторов металлов, ингибиторов репарации ДНК, таких как пирензепин и метаболиты, 3-амино-1-пропансульфоновой кислоты (3-APS), 1,3-пропандисульфоната (1,3PDS), активаторов секретазы, ингибиторов [бета]- и 7-секретазы, тау-белков, нейромедиатора, разрушители β-спирали, противовоспалительных молекул, "атипичных антипсихотических средств", таких как, например клозапин, зипрасидон, рисперидон, арипипразол, или оланзапин, или ингибиторы холинэстеразы (ИХЭ), такие как такрин, ривастигмин, донепезил, и/или галантамин и другие лекарственные средства и пищевые добавки, такие как, например, витамин B12, цистеин, предшественник ацетилхолина, лецитин, холин, Ginkgo biloba, aцетил-L-карнитин, идебенон, пропентофиллин, или производное ксантина, вместе со связывающим пептидом по изобретению включая антитела, в частности, моноклональные антитела и их активные фрагменты, и, необязательно, фармацевтически приемлемый носитель, и/или разбавитель, и/или эксципиент, и инструкции для лечения заболеваний.

В дополнительном варианте осуществления композиция по изобретению может содержать ниацин или мемантин вместе с химерным антителом или гуманизированным антителом по изобретению, включая антитела, в частности, моноклональные антитела и их активные фрагменты, и, необязательно, фармацевтически приемлемый носитель и/или разбавитель, и/или эксципиент.

В другом варианте осуществления изобретения предлагаются композиции, которые содержат "атипичные антипсихотические средства", такие как, например, клозапин, зипрасидон, рисперидон, арипипразол или оланзапин для лечения позитивных и негативных психотических симптомов, включая галлюцинации, бред, нарушения мышления (которые проявляются заметной непоследовательностью, соскальзыванием, тангенциальностью мышления), и причудливое или неорганизованное поведение, а также ангедонию, эмоциональную тупость, апатию, и социальное отчуждение, вместе с химерным антитело или гуманизированным антителом по изобретению или их активными фрагментами, и, необязательно, фармацевтически приемлемый носитель и/или разбавитель, и/или эксципиент.

Другие соединения, которые могут быть использованы соответствующим образом в композициях в дополнение к химерному антителу или гуманизированному антителу по изобретению, представляют собой соединения, описанные, например, в WO 2004/058258 (см. в особенности страницы 16 и 17), включая мишени терапевтических лекарственных средств (страницы 36-39), алкансульфоновые кислоты и алканолсерная кислота (страницы 39-51), ингибиторы холинэстеразы (страницы 51-56), антагонисты рецептора NMDA (страницы 56-58), эстрогены (страницы 58-59), нестероидные противовоспалительные лекарственные средства (страницы 60-61), антиоксиданты (страницы 61-62), агонисты рецепторов активаторов пролиферации пероксисом (PPAR) (страницы 63-67), вещества, снижающие содержание холестерина (страницы 68-75), ингибиторы амилоида (страницы 75-77), ингибиторы образования амилоида (страницы 77-78), хелаторы металлов (страницы 78-79), антипсихотические средства и антидепрессанты (страницы 80-82), питательные добавки (страницы 83-89) и соединения, повышающие доступность биологически активных веществ в головном мозге (см. страницы 89-93) и пролекарственные средства (страницы 93 и 94). Этот документ включен в настоящий документ в качестве ссылки, в особенности соединения, упомянутые на вышеуказанных страницах.

Активные ингредиенты можно включать в подготовленные микрокапсулы, например, посредством способов коацервации или интерфазной полимеризации, например, в микрокапсулы из гидроксиметилцеллюлозы или желатина и полиметилметакрилата, соответственно, в коллоидные системы доставки лекарственных средств (например, липосомы, альбуминовые микросферы, микроэмульсии, наночастицы и нанокапсулы) или в микроэмульсии. Такие способы описаны в Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).

Можно получать препараты с пролонгированным высвобождением. Подходящие примеры препаратов с пролонгированным высвобождением включают полупроницаемые матрицы из твердых гидрофобных полимеров, содержащие антитело, при этом матрицы находятся в виде формованных изделий, например, пленок или микрокапсул.

Составы, которые используют для введения in vivo, как правило, являются стерильными. Стерильности можно легко достигнуть, например, при фильтрации через стерильные фильтрующие мембраны.

G. Терапевтические способы и композиции

Любое из антител к тау (например, антитела к pTau), предлагаемое в настоящем документе, можно использовать в терапевтических способах.

В одном из аспектов предлагается антитело к таудля применения в качестве лекарственного средства. В дополнительных аспектах предлагается антитело к тау для применения в лечении заболевания или нарушения, ассоциированного с тау. В некоторых вариантах осуществления предлагается антитело к тау для применения в лечении заболевания или нарушения, вызванного или ассоциированного с образованием нейрофибриллярных клубков или нитей нейропилей. В конкретных вариантах осуществления предлагается антитело к тау для применения в лечении таупатии, такой как нейродегенеративная таупатия. Примеры заболеваний или нарушений, ассоциированных с белком тау, которые можно лечить антителами к тау, в качестве неограничивающих примеров включают, болезнь Альцгеймера, боковой амиотрофический склероз, болезнь Паркинсона, болезнь Кройнцфельд-Якоба, деменцию боксеров, синдром Дауна, болезнь Герстманна-Штраусслера-Шейнкера, миозит с включенными тельцами, церебральную амилоидную ангиопатию с прионовыми белками, травматическое повреждение головного мозга, Гуамский комплекс из бокового амиотрофического склероза/паркинсонизма-деменции, не-Гуамскую болезнь мотонейронов с нейрофибриллярными клубками, деменцию с аргирофильной зернистостью, кортикобазальную дегенерацию, диффузные нейрофибриллярные клубки с кальцификацией, фронтотемпоральную деменцию, фронтотемпоральную деменцию с паркинсонизмом, сцепленную с хромосомой 17, болезнь Галлевордена-Шпатца, множественную системную атрофию, болезнь Ниманна-Пика, тип C, паллидо-понто-нигральную дегенерацию, болезнь Пика, прогрессирующий подкорковый глиоз, прогрессирующий супрануклеарный паралич, подострый склерозирующий панэнцефалит, деменцию с нейрофибриллярными клубками, постэнцефалитный паркинсонизм и миотоническую дистрофию. В одном из вариантов осуществления в настоящем документе предлагается антитело к тау для применения в лечении болезни Альцгеймера (БА). Дополнительно, заболевания или нарушения, ассоциированные с тау-белком, которые можно лечить антителом к тау, включают заболевания или нарушения, которые проявляются в ухудшении или потере когнитивных функций, включая логическое рассуждение, оценку ситуаций, возможности памяти, обучение и/или целенаправленную ориентацию. В определенных вариантах осуществления предлагается антитело к тау для применения в способе лечения. В определенных вариантах осуществления изобретение относится к антителу к тау для применения в способе лечения индивидуума, имеющего любое из вышеописанных заболеваний или нарушений, ассоциированных с тау, включающем введение индивидууму эффективного количества антитела к тау (например, антитела к pTau). В одном из таких вариантов осуществления способ дополнительно содержит введение индивидууму эффективного количества, по меньшей мере, одного дополнительного терапевтического средства, например, как описано ниже.

В дополнительных вариантах осуществления изобретение относится к антителу к тау для применения для снижения уровней тау-белка (например, общего тау, общего растворимого тау, растворимого фосфорилированного тау, общего нерастворимого тау, нерастворимого фосфорилированного тау, гиперфосфорилированного тау или парных спиральных филаментов, содержащих гиперфосфорилированный тау) у индивидуума. Например, такое снижение может происходить в головном мозге (например, в коре головного мозга и/или гиппокампе). В одном из вариантов осуществления изобретение относится к антителу к тау для применения для снижения уровней фосфорилированного тау. В одном из вариантов осуществления изобретение относится к антителу к тау для применения для снижения уровней нерастворимого тау (например, нерастворимого фосфорилированного тау). В одном из вариантов осуществления изобретение относится к антителу к тау для применения для снижения уровней гиперфосфорилированного тау. В одном из вариантов осуществления изобретение относится к антителу к тау для применения для снижения уровней парных спиральных филаментов (например, парных спиральных филаментов, содержащих гиперфосфорилированный тау) в ткани головного мозга (например, в коре головного мозга и/или гиппокампе). В определенных вариантах осуществления изобретение относится к антителу к тау (например, антителу к pTau) для применения в способе снижения уровней тау-белка (например, общего тау, общего растворимого тау, растворимого фосфорилированного тау, общего нерастворимого тау, нерастворимого фосфорилированного тау, гиперфосфорилированного тау или парных спиральных филаментов, содержащих гиперфосфорилированный тау) в головном мозге (например, в коре головного мозга и/или гиппокампе) у индивидуума, который включает введение индивидууму эффективного количества антитела к тау для снижения уровней тау-белка. "Индивидуум" по любому из вышеописанных вариантов осуществления представляет собой млекопитающего, предпочтительно человека.

В некоторых вариантах осуществления изобретение относится к антителу к тау для применения для модуляции уровней тау-белка (например, общего тау, общего растворимого тау, растворимого фосфорилированного тау, общего нерастворимого тау, нерастворимого фосфорилированного тау, гиперфосфорилированного тау или парных спиральных филаментов, содержащих гиперфосфорилированный тау), например, в головном мозге (например, в коре головного мозга и/или гиппокампе) индивидуума.

В дополнительном аспекте изобретение относится к использованию антитела к тау в производстве или приготовлении лекарственного средства. В одном из вариантов осуществления лекарственное средство предназначено для лечения заболевания или нарушения, ассоциированного с тау-белком. Заболевание или нарушение, ассоциированное с тау-белком, может быть заболеванием или нарушениями, вызванными или ассоциированными с образованием нейрофибриллярных клубков или нитей нейропилей. В конкретных вариантах осуществления лекарственное средство предназначено для лечения таупатии, такой как нейродегенеративная таупатия. В конкретных вариантах осуществления лекарственное средство предназначено для лечения заболевания или нарушения, выбранного из группы, которая вклюяает болезнь Альцгеймера, боковой амиотрофический склероз, болезнь Паркинсона, болезнь Кройнцфельд-Якоба, деменцию боксеров, синдром Дауна, болезнь Герстманна-Штраусслера-Шейнкера, миозит с включенными тельцами, церебральную амилоидную ангиопатию с прионовыми белками, травматическое повреждение головного мозга, Гуамский комплекс из бокового амиотрофического склероза/паркинсонизма-деменции, не-Гуамскую болезнь мотонейронов с нейрофибриллярными клубками, деменцию с аргирофильной зернистостью, кортикобазальную дегенерацию, диффузные нейрофибриллярные клубки с кальцификацией, фронтотемпоральную деменцию, фронтотемпоральную деменцию с паркинсонизмом, сцепленную с хромосомой 17, болезнь Галлевордена-Шпатца, множественную системную атрофию, болезнь Ниманна-Пика, тип C, паллидо-понто-нигральную дегенерацию, болезнь Пика, прогрессирующий подкорковый глиоз, прогрессирующий супрануклеарный паралич, подострый склерозирующий панэнцефалит, деменцию с нейрофибриллярными клубками, постэнцефалитный паркинсонизм и миотоническую дистрофию. В одном из вариантов осуществления лекарственное средство предназначено для лечения БА. В конкретных вариантах осуществления лекарственное средство предназначено для лечения заболевания или нарушения, ассоциированного с тау, которые проявляются в ухудшении или потере когнитивных функций, включая логическое рассуждение, оценку ситуаций, возможности памяти, обучение и/или целенаправленную ориентацию. В дополнительном варианте осуществления лекарственное средство предназначено для применения в способе лечения одного из вышеперечисленных заболеваний (например, таупатии, такой как БА), включающем введение индивидууму с таким заболеванием эффективного количества лекарственного средства. В одном из таких вариантах осуществления способ дополнительно содержит введение индивидууму эффективного количества, по меньшей мере, одного дополнительного терапевтического средства, например, как описано ниже.

В дополнительном варианте осуществления лекарственное средство предназначено для снижения уровней тау-белка (например, общего тау, общего растворимого тау, растворимого фосфорилированного тау, общего нерастворимого тау, нерастворимого фосфорилированного тау, гиперфосфорилированного тау или парных спиральных филаментов, содержащих гиперфосфорилированный тау). Например, такое снижение тау-белка можно наблюдать в головном мозге (например, в коре головного мозга и/или гиппокампе) или в цереброспинальной жидкости индивидуума. В одном из вариантов осуществления лекарственное средство предназначено для снижения уровней фосфорилированного тау. В одном из вариантов осуществления лекарственное средство предназначено для снижения уровней нерастворимого тау (например, нерастворимого фосфорилированного тау). В одном из вариантов осуществления лекарственное средство предназначено для снижения уровней гиперфосфорилированного тау. В одном из вариантов осуществления лекарственное средство предназначено для снижения уровней парных спиральных филаментов (например, парных спиральных филаментов, содержащих гиперфосфорилированный тау). В дополнительном варианте осуществления лекарственное средство предназначено для применения в способе снижения уровней тау-белка (например, общего тау, общего растворимого тау, растворимого фосфорилированного тау, общего нерастворимого тау, нерастворимого фосфорилированного тау, гиперфосфорилированного тау или парных спиральных филаментов, содержащих гиперфосфорилированный тау) у индивидуума, который включает введение индивидууму эффективного количества антитела к тау для снижения уровней тау-белка. "Индивидуум" по любому из вышеописанных вариантов осуществления представляет собой млекопитающего, предпочтительно человека.

В дополнительном аспекте изобретение относится к способу лечения заболевания или нарушения, ассоциированного с тау-белком. Заболевание или нарушение, ассоциированное с тау-белком, которое можно лечить способами, предлагаемыми в настоящем документе, включает заболевания или нарушения, вызванные или ассоциированные с образованием нейрофибриллярных клубков или нитей нейропилей. В конкретных вариантах осуществления изобретение относится к способу лечения таупатии, такой как нейродегенеративное таупатия. В конкретных вариантах осуществления изобретение относится к способу лечения заболевания или нарушения, выбранного из группы, которая включает болезнь Альцгеймера, боковой амиотрофический склероз, болезнь Паркинсона, болезнь Кройнцфельд-Якоба, деменцию боксеров, синдром Дауна, болезнь Герстманна-Штраусслера-Шейнкера, миозит с включенными тельцами, церебральную амилоидную ангиопатию с прионовыми белками, травматическое повреждение головного мозга, Гуамский комплекс из бокового амиотрофического склероза/паркинсонизма-деменции, не-Гуамскую болезнь мотонейронов с нейрофибриллярными клубками, деменцию с аргирофильной зернистостью, кортикобазальную дегенерацию, диффузные нейрофибриллярные клубки с кальцификацией, фронтотемпоральную деменцию, фронтотемпоральную деменцию с паркинсонизмом, сцепленную с хромосомой 17, болезнь Галлевордена-Шпатца, множественную системную атрофию, болезнь Ниманна-Пика, тип C, паллидо-понто-нигральную дегенерацию, болезнь Пика, прогрессирующий подкорковый глиоз, прогрессирующий супрануклеарный паралич, подострый склерозирующий панэнцефалит, деменцию с нейрофибриллярными клубками, постэнцефалитный паркинсонизм и миотоническую дистрофию. В одном из вариантов осуществления изобретение относится к способу лечения болезнь Альцгеймера (БА). В конкретных вариантах осуществления изобретение относится к способу лечения заболевания или нарушения, ассоциированного с тау-белком, которые проявляются в ухудшении или потере когнитивных функций, включая логическое рассуждение, оценку ситуаций, возможности памяти, обучение и/или целенаправленную ориентацию. В одном из вариантов осуществления способ включает введение индивидууму, имеющему любое из вышеописанных заболеваний или нарушений, эффективного количества антитела к тау (например, антитела к pTau). В одном из таких вариантов осуществления способ дополнительно содержит введение индивидууму эффективного количества, по меньшей мере, одного дополнительного терапевтического средства, например, как описано ниже. В одном из вариантов осуществления способ включает введение индивидууму, имеющему одно из вышеописанных заболеваний или нарушений, эффективного количества антитела к тау (например, антитела к pTau). В одном из таких вариантов осуществления способ дополнительно содержит введение индивидууму эффективного количества по меньшей мере одного дополнительного терапевтического средства, например, как описано ниже. "Индивидуум" по любому из вышеописанных вариантов осуществления может быть человеком.

В дополнительном аспекте изобретение относится к способу для снижения уровней тау-белка (например, общего тау, общего растворимого тау, растворимого фосфорилированного тау, общего нерастворимого тау, нерастворимого фосфорилированного тау, гиперфосфорилированного тау или парных спиральных филаментов, содержащих гиперфосфорилированный тау) у индивидуума. Например, такое снижение тау-белка можно наблюдать в головном мозге (например, в коре головного мозга и/или гиппокампе) или в цереброспинальной жидкости индивидуума. В одном из вариантов осуществления изобретение относится к способу для снижения уровней фосфорилированного тау. В одном из вариантов осуществления изобретение относится к способу для снижения уровней нерастворимого тау (например, нерастворимого фосфорилированного тау). В одном из вариантов осуществления изобретение относится к способу для снижения уровней гиперфосфорилированного тау. В одном из вариантов осуществления изобретение относится к способу для снижения уровней парных спиральных филаментов (например, парных спиральных филаментов, содержащих гиперфосфорилированный тау). В одном из вариантов осуществления способ включает введение индивидууму эффективного количества антитела к тау (например, антитела к pTau) для снижения уровней тау-белка. В одном из вариантов осуществления "индивидуум" является человеком.

В некоторых аспектах изобретение относится к способу для облегчения одного или более симптомов заболевания или нарушения, ассоциированного с тау-белком, или к антителу к тау или к лекарственному средству, содержащему антитело к тау, для облегчения одного или более симптомов заболевания или нарушения, ассоциированного с тау-белком (такого как любое из заболеваний или нарушений, описываемых в настоящем документе, например, БА). В некоторых аспектах изобретение относится к способу для уменьшения числа симптомов или тяжести одного или более симптомов заболевания или нарушения, ассоциированного с тау-белком, или к антителу к тау или к лекарственному средству, содержащему антитело к тау, для уменьшения числа симптомов или тяжести одного или более симптомов заболевания или нарушения, ассоциированного с тау-белком (такого как любое из заболеваний или нарушений, описываемых в настоящем документе, например, БА). В конкретном варианте осуществления симптом заболевания или нарушения, ассоциированного с тау-белком, представляет собой ухудшение познавательной способности. В конкретном варианте осуществления симптом заболевания или нарушения, ассоциированного с тау-белком, представляет собой ухудшение обучаемости и/или памяти. В конкретном варианте осуществления симптом заболевания или нарушения, ассоциированного с тау-белком, представляет собой потерю долговременной памяти. В конкретном варианте осуществления симптом заболевания или нарушения, ассоциированного с тау-белком, представляет собой деменцию. В некоторых вариантах осуществления симптом заболевания или нарушения, ассоциированного с тау-белком, представляет собой замешательство, раздражительность, агрессию, перепады настроения или нарушения речи. В некоторых вариантах осуществления симптом заболевания или нарушения, ассоциированного с тау-белком, представляет собой ухудшение или потерю одной или более когнитивных функций, таких как логическое рассуждение, оценку ситуаций, возможности памяти, обучение и/или целенаправленную ориентацию. Способы, предлагаемые в настоящем документе, включают введение некоторого количества (например, терапевтически эффективного количества) антитела к тау индивидууму (например, тому, кто демонстрирует один или более симптомов заболевания или нарушения, ассоциированного с тау-белком).

В конкретных аспектах изобретение относится к способу для сохранения или улучшения емкости познавательной памяти, или для замедления потери памяти, связанной с заболеванием или нарушением, ассоциированным с тау-белком, или к антителу к тау или к лекарственному средству, содержащему антитело к тау, для сохранения или улучшения объема познавательной памяти, или для замедления потери памяти, связанной с заболеванием или нарушением, ассоциированным с тау-белком (таким как любое из заболеваний или нарушений, описываемых в настоящем документе, например, БА). Способы, предлагаемые в настоящем документе, включают введение некоторого количества (например, терапевтически эффективного количества) антитела к тау индивидууму (например, тому, кто демонстрирует один или более симптомов потери памяти или снижение объема памяти).

В некоторых аспектах изобретение относится к способу для снижения скорости прогрессирования заболевания или нарушения, ассоциированного с тау-белком, или к антителу к тау или к лекарственному средству, содержащему антитело к тау, для снижения скорости прогрессирования заболевания или нарушения, ассоциированного с тау-белком, (таким как любое из заболеваний или нарушений, описываемых в настоящем документе, например, БА). Способы, предлагаемые в настоящем документе, включают введение некоторого количества (например, терапевтически эффективного количества) антитела к тау индивидууму (например, тому, кто демонстрирует один или более симптомов заболевания или нарушения, ассоциированного с тау-белком).

В некоторых аспектах изобретение относится к способу для профилактики развития заболевания или нарушения, ассоциированного с тау-белком, или к антителу к тау или к лекарственному средству, содержащему антитело к тау, для профилактики развития заболевания или нарушения, ассоциированного с тау-белком, (таким, как любое из заболеваний или нарушений, описываемых в настоящем документе, например, БА). Способы, предлагаемые в настоящем документе, включают введение некоторого количества (например, терапевтически эффективного количества) антитела к тау индивидууму (например, тому, у кого есть риск развития заболевания или нарушения, ассоциированного с тау-белком).

В некоторых аспектах изобретение относится к способу для замедления развития заболевания или нарушения, ассоциированного с тау-белком, или к антителу к тау или к лекарственному средству, содержащему антитело к тау, для замедления развития заболевания или нарушения, ассоциированного с тау-белком, (таким, как любое из заболеваний или нарушений, описываемых в настоящем документе, например, БА). Способы, предлагаемые в настоящем документе, включают введение некоторого количества (например, терапевтически эффективного количества) антитела к тау индивидууму (например, тому, кто демонстрирует один или более симптомов заболевания или нарушения, ассоциированного с тау-белком).

В дополнительном аспекте изобретение относится к фармацевтическим составам, содержащим любое из антител к тау (например, антител к pTau), предлагаемых в настоящем документе, например, для применения в любом из вышеописанных терапевтических способов. В одном из вариантов осуществления фармацевтический состав содержит любое из антител к тау (например, антител к pTau), предлагаемых в настоящем документе, и фармацевтически приемлемый носитель. В другом варианте осуществления фармацевтический состав содержит любое из антител к тау (например, антител к pTau), предлагаемых в настоящем документе, и по меньшей мере одно дополнительное терапевтическое средство, например, как описано ниже.

Антитела по изобретению можно использовать отдельно или в комбинации с другими веществами в терапии. Например, антитело по изобретению можно вводить совместно по меньшей мере с одним дополнительным терапевтическим средством.

Например, композицию по изобретению можно вводить в комбинации с другими композициями, содержащими биологически активное вещество или соединение, такое как, например, известное соединение, которое используют для лечения таупатий и/или амилоидозов, группы заболеваний и нарушений, ассоциированных с амилоидом или амилоидоподобным белком, таким как β-амилоидный белок, вовлеченный в болезнь Альцгеймера.

Как правило, другое биологически активное соединение может включать усилители нейрональной передачи, психотерапевтические лекарственные средства, ингибиторы ацетилхолинэстеразы, блокаторы кальциевых каналов, биогенные амины, бензодиазепиновые транквилизаторы, усилители синтеза, хранения или высвобождения ацетилхолина, агонисты постсинаптического рецептора ацетилхолина, ингибиторы моноаминоксидазы A или B, антагонисты рецептора N-метил-D-аспартатглутамината, нестероидные противовоспалительные лекарственные средства, антиоксиданты и антагонисты серотониновых рецепторов. В частности, биологически активное средство или соединение может включать по меньшей мере одно соединение, выбранное из группы, состоящей из соединений против окислительного стресса, соединений против апоптоза, хелаторов металлов, ингибиторов репарации ДНК, таких как пирензепин и метаболиты, 3-амино-1-пропансульфоновой кислоты (3-APS), 1,3-пропандисульфоната (1,3PDS), активаторов секретазы, ингибиторов [бета]- и 7-секретазы, тау-белков, нейромедиатора, разрушители β-спирали, противовоспалительных молекул, "атипичных антипсихотических средств", таких как, например клозапин, зипрасидон, рисперидон, арипипразол, или оланзапин, или ингибиторы холинэстеразы (ИХЭ), такие как такрин, ривастигмин, донепезил, и/или галантамин и другие лекарственные средства и пищевые добавки, такие как, например, витамин B12, цистеин, предшественник ацетилхолина, лецитин, холин, Ginkgo biloba, acyэтил-L-карнитин, идебенон, пропентофиллин, или производное ксантина, вместе со связывающим пептидом по изобретению включая антитела, в частности, моноклональные антитела и их активные фрагменты, и, необязательно, фармацевтически приемлемый носитель, и/или разбавитель, и/или эксципиент, и инструкции для лечения заболеваний.

В дополнительном варианте осуществления композиция по изобретению может содержать ниацин или мемантин вместе с химерным антителом или гуманизированным антителом по изобретению, включая антитела, в частности, моноклональные антитела и их активные фрагменты, и, необязательно, фармацевтически приемлемый носитель и/или разбавитель, и/или эксципиент.

В другом варианте осуществления изобретения предлагаются композиции, которые содержат "атипичные антипсихотические средства", такие как, например, клозапин, зипрасидон, рисперидон, арипипразол или оланзапин для лечения позитивных и негативных психотических симптомов, включая галлюцинации, бред, нарушения мышления (которые проявляются заметной непоследовательностью, соскальзыванием, тангенциальностью мышления), и причудливое или неорганизованное поведение, а также ангедонию, эмоциональную тупость, апатию и социальное отчуждение, вместе с химерным антитело или гуманизированным антителом по изобретению или их активными фрагментами, и, необязательно, фармацевтически приемлемый носитель и/или разбавитель, и/или эксципиент.

Другие соединения, которые могут быть использованы соответствующим образом в композициях в дополнение к химерному антителу или гуманизированному антителу по изобретению, представляют собой соединения, описанные, например, в WO 2004/058258 (см. в особенности страницы 16 и 17), включая мишени терапевтических лекарственных средств (страницы 36-39), алкансульфоновые кислоты и алканолсерная кислота (страницы 39-51), ингибиторы холинэстеразы (страницы 51-56), антагонисты рецептора NMDA (страницы 56-58), эстрогены (страницы 58-59), нестероидные противовоспалительные лекарственные средства (страницы 60-61), антиоксиданты (страницы 61-62), агонисты рецепторов активации пролиферации пероксисом (PPAR) (страницы 63-67), вещества, снижающие содержание холестерина (страницы 68-75), ингибиторы амилоида (страницы 75-77), ингибиторы образования амилоида (страницы 77-78), хелаторы металлов (страницы 78-79), антипсихотические средства и антидепрессанты (страницы 80-82), питательные добавки (страницы 83-89) и соединения, повышающие доступность биологически активных веществ в головном мозге (см. страницы 89-93) и пролекарственные средства (страницы 93 и 94). Этот документ включен в настоящий документ в качестве ссылки, в особенности соединения, упомянутые на вышеуказанных страницах.

Такие вышеуказанные способы комбинированного лечения включают комбинированное введение (когда два или более терапевтических средства включены в один или раздельные составы) и раздельное введение, когда введение антитела по изобретению происходит до, одновременно и/или после введения дополнительного терапевтического средства или веществ. В одном из вариантов осуществления введение антитела к тау и введение дополнительного терапевтического средства происходит в пределах приблизительно одного месяца или в пределах приблизительно одной, двух или трех недель, или в пределах приблизительно одного, двух, трех, четырех, пяти или шести дней друг от друга.

Антитело по изобретению (и любое дополнительное терапевтическое средство) можно вводить любыми подходящими способами, включая парентеральное, внутрилегочное и интраназальное, и, при желании для местного лечения, введение в очаг поражения. Парентеральные вливания включают внутримышечное, внутривенное, внутриартериальное, интраперитонеальное или подкожное введение. Можно производить дозирование любым подходящим путем, например, посредством инъекций, таких как внутривенные или подкожные инъекции, частично в зависимости от того, является ли введение краткосрочным или длительным. В настоящем документе рассматриваются различные схемы дозирования, включая в качестве неограничивающих примеров, единичное или множественное введение в различные временные точки, болюсное введение и импульсное вливание.

Антитела по изобретению формулируют, дозируют и вводят в соответствии с добросовестной медицинской практикой. Факторы для рассмотрения в данном контексте включают конкретное нарушение, которое лечат, конкретное млекопитающее, которое лечат, клиническое состояние пациента, причину заболевания, место доставки препарата, способ введения, режим введения и другие факторы, известные врачам-терапевтам. Антитела могут быть необязательно сформулированы с одним или более веществами, которые в настоящее время используются для профилактики или лечения обсуждаемого заболевания. Эффективное количество таких других веществ зависит от количества антитела, присутствующего в составе, типа нарушения или лечения и других вышеописанных факторов. Эти вещества в основном используют в тех же дозировках и с теми же способами введения, как описано в настоящем документе, или приблизительно от 1 до 99% от дозировок, описываемых в настоящем документе, или в любой дозировке и с любым путем введения, которые эмпирически/клинически были определены, как подходящие.

Для профилактики или лечения заболевания соответствующая доза антитела по изобретению (при использовании отдельно или в комбинации с одним или более другими дополнительными терапевтическими средствами) будет зависеть от типа заболевания, которое нуждается в лечении, типа антитела, тяжести и протекания заболевания, вводят ли антитело с профилактической или терапевтической целью, предшествующей терапии, истории болезни пациента и ответа на антитело, и усмотрения лечащего врача. Антитело соответственно вводят пациенту однократно или в течение серии лечений. В зависимости от типа и тяжести заболевания, приблизительно от 1 мкг/кг до 15 мг/кг (например, 0,1 мг/кг - 10 мг/кг) антитела может быть начальной кандидатной дозировкой для введения пациенту, без разницы, например, посредством одного или более раздельных введений или посредством непрерывного вливания. Одно обычное суточное дозирование может находиться в диапазоне приблизительно от 1 мкг/кг до 100 мг/кг или более, в зависимости от вышеупомянутых факторов. Для повторных введений в течение нескольких суток или дольше, в зависимости от заболевания, лечение, как правило, поддерживают до появления желаемого подавления симптомов заболевания. Одна иллюстративная дозировка антитела может быть в диапазоне приблизительно от 0,05 мг/кг до приблизительно 10 мг/кг. Таким образом, пациенту можно вводить одну или более доз приблизительно по 0,5 мг/кг, 2,0 мг/кг, 4,0 мг/кг или 10 мг/кг (или любое их сочетание). Такие дозы можно вводить с перерывами, например, раз в неделю или раз в три недели (например, таким образом, что пациент получает приблизительно от двух до приблизительно двадцати, или например, приблизительно шесть доз антитела). Можно вводить более высокую начальную ударную дозу с последующими более низкими одной или более дозами. Однако могут подходить и другие режимы дозирования. Прогресс этой терапии легко контролировать общепринятыми способами и анализами.

Следует понимать, что любые из вышеуказанных составов или терапевтических способов можно осуществлять с использованием иммуноконъюгата по изобретению вместо антитела к тау или в дополнение к антителу к тау.

H. Промышленные изделия

В другом аспекте по изобретению предлагается промышленное изделие, содержащее материалы, подходящие для лечения, профилактики и/или диагностики вышеописанных нарушений. Промышленное изделие содержит контейнер и этикетку, или вкладыш в упаковку на контейнере или связанный с контейнером. Подходящие контейнеры включают, например, бутылки, флаконы, шприцы, пакеты с раствором для внутривенного введения, и т.д. Контейнеры могут быть сформированы из ряда материалов, таких как стекло или пластик. Контейнер содержит композицию, которая сама по себе или в комбинации с другой композицией, эффективна для лечения, профилактики и/или диагностики заболевания и может иметь стерильное входное отверстие (например, контейнер может представлять собой пакет с раствором для внутривенного введения или флакон с пробкой, которая прокалывается иглой для подкожных инъекций). По меньшей мере одно активное средство в композиции представляет собой антитело по изобретению. Этикетка или вкладыш в упаковку указывает, что композицию применяют для лечения выбранного состояния. Кроме того, промышленное изделие может содержать (a) первый контейнер, содержащий композицию, где композиция содержит антитело по изобретению; и (b) второй контейнер, содержащий композицию, где композиция содержит дополнительное цитотоксическое или иное терапевтическое средство. Промышленное изделие в этом варианте осуществления изобретения может дополнительно содержать вкладыш в упаковку, указывающий, что композиции можно использовать для лечения конкретного заболевания. Альтернативно, или дополнительно, промышленное изделие может дополнительно содержать второй (или третий) контейнер, содержащий фармацевтически приемлемый буфер, такой как бактериостатическая вода для инъекций (BWFI), фосфатно-солевой буфер, раствор Рингера и раствор декстрозы. Он может дополнительно содержать другие материалы, необходимые с коммерческой и потребительской точек зрения, включая другие буферы, разбавители, фильтры, иглы и шприцы.

Следует понимать, что любое из вышеописанных промышленных изделий может содержать иммуноконъюгат по изобретению вместо антитела к тау или в дополнение к антителу к тау (например, к антителу к pTau).

III. ПРИМЕРЫ

Далее следуют примеры способов и композиций по изобретению. Следует понимать, что можно практиковать различные варианты осуществления, которые подходят под вышеприведенное общее описание.

Проводили аффинное созревание гуманизированных антител к pTau и анализировали, как описано ниже:

Описание созревания аффинности 5202.4

Гуманизированное 5202.4 было представлено на поверхности нитевидного бактериофага М13 в формате Fab с использованием фагмидных векторов (таблица 1 показывает аминокислотную последовательность 5202.4; вариабельная область 5202.4 идентична антителу hACI-36-2B6-Abl, описанному в PCT/US 13/32341, поданной 15 марта 2013 года). Конструировали четыре библиотеки на основании стоп-матрицы (вектор, в котором CDR для мутагенеза были удалены и вставлены стоп-кодоны с целью снижения экспрессии не мутированных последовательностей). Использовали мутагенез по Кункелю с вырожденными олигонуклеотидами для мутирования CDR в каждой из четырех библиотек. Мутации в тяжелую цепь и легкую цепь вносили раздельно, таким образом, каждая библиотека сожеожала или родительскую тяжелую цепь и мутированную легкую цепь, или наоборот. В двух библиотеках или в тяжелую цепь, или в легкую цепь были внесены мутации с использованием схемы, известной как «NNK-прогулка», при которой один остаток CDR за один раз (на CDR) мутируют с использованием вырожденного кодона NNK. NNK способен кодировать все двадцать природных аминокислот и стоп-кодон. Мутагенез всех трех CDR проводили одновременно. В двух других библиотеках проводили мутагенез трех CDR тяжелой цепи или легкой цепи одновременно с использованием "мягкого" мутагенеза. В этом случае, в процессе синтеза олигонуклеотидов каждый нуклеотид в области, выбранной для мутагенеза, был замещен смесью, содержащей 90% родительского нуклеотида и 3,3% каждого из неродительских нуклеотидов. Положения в кодоне 2 и 3 сохранялись как родительские для остатков CDR-L1 L27a, CDR-L1 L33 и CDR-H1 M34 (нумерация по Kabat). Мутированной ДНК трансформировали XL1 Blue E. Coli, и спасали библиотеку при помощи фага-помощника на основе M13. Количество трансформантов было оценено, как находящееся в пределах 2×108-1×109 для каждой библиотеки.

Каждую библиотеку подвергали трем или четырем раундам селекции с биотинилированным пептидом в растворе, с использованием пептида биотинил-18-амино-4,7,10,13,16-пентаоксаоктадеканоил-Gly-Asp-Thr-Ser[PO3H2]-Pro-Trp-His-Leu-Ser[PO3H2]-Asn-Val-Ser-Ser-Thr-Gly-Ser-Ile-Asp-NH2 (SEQ ID NO:93). Комплексы фаг/пептид захватывали на микропланшеты покрытые нейтравидином, промывали несколько раз и элюировали 100 мМ соляной кислотой. Элюированный фаг амплифицировали в XL1 Blue E. coli, спасали при помощи фага-помощника и очищали путем осаждения при помощи ПЭГ/NaCl. Использованные концентрации биотинилированного пептида составляли 250 нМ (раунд 1), 100 нМ (раунд 2), 40 нМ (роунд 3) и либо 4 нМ, либо 10 нм (раунд 4). В некоторых отборочных раундах 4 к смеси фаг/пептид добавляли родительский IgG (1 мкМ) за тридцать минут до захвата.

Индивидуальные клоны выделяли посредством серийных разведений и секвенировали с плазмидной ДНК. После раунда 3, и во втором эксперименте после раунда 4, наблюдали за консенсусными последовательностями, чтобы выявить их в пулах с мутагенизированными легкими цепями. Наиболее часто наблюдаемые мутации включали: H27dR, S27eR, S27eK, H28R, H28N, H28K, K30R, S52R, S52K, S56F, S56L, Q90S, A92R, H93R, H93Q, Y96R (все нумерации в соответствии с системой Kabat). Получали 23 аминокислотные последовательности, т.е. TAM1, TAM2, TAM3, TAM4, TAM5, TAM6, TAM7, TAM8, TAM9, TAM 10, TAM11, TAM12, TAM13, TAM14, TAM15, TAM16, TAM17, TAM18, TAM19, TAM20, TAM21, TAM22, TAM23 (обобщенно, "белки TAM"). Совокупность из 22 уникальных аминокислотных последовательностей выбирали для дальнейшего анализа и экспрессировали в виде рекомбинантных Fab-фрагментов и в виде IgG путем временной трансфекции клеток 293S (примечание: TAM20 и TAM22 представляют одинаковую аминокислотную последовательность).

На фигуре 1 представлены аминокислотные замены в CDR белков TAM относительно 5202.4; таблица 2A показывает аминокислотные последовательности CDR легкой цепи белков TAM и 52024; таблица 2B показывает аминокислотные последовательности CDR тяжелой цепи белков TAM и 5202.4; таблица 3 показывает положения по Kabat, по которым произошли мутации аминокислот, и тип мутаций в белках TAM; таблица 4 показывает аминокислотные последовательности вариабельной области легкой цепи и аминокислотные последовательности вариабельной области тяжелой цепи белков TAM; таблица 5 показывает аминокислотные последовательности полноразмерной легкой цепи белков TAM, таблица 7 показывает аминокислотные последовательности полноразмерной тяжелой цепи цепи (IgG1) белков TAM. Таблица 6 показывает аминокислотные последовательности полноразмерной тяжелой цепи изотипов IgG4 антител TAM. Таблица 8 показывает аминокислотные последовательности полноразмерной тяжелой цепи изотипов IgG1 N297G антител TAM.

Отбор и определение характеристик антител

Инструменты Biacore применяли для характеристики Fab и IgG с использованием анализов поверхностного плазмонного резонанса. Для этих экспериментов тау-белок, фосфорилированный протеинкиназой A (ПКА) был иммобилизован непосредственно сенсорный чип CM5 или CM5 серии S с использованием Biacore Амин Coupling Kit и буфер для иммобилизации с ацетатом натрия, pH5. Проточную ячейку 1 оставили необработанной для использования в качестве референсной ячейки, и данные от этой ячейки вычитали из всех сенсограмм перед началом анализа. Буфер для регенерации с 10 мМ глицином, pH 1,7, инъецировали в течение 0,5-1 минуты после каждого цикла ассоциации/диссоциации. Связывание антитела оценивали при скорости потока 30 мкл/мин. Кинетические константы определяли посредством нелинейной регрессии с использованием программного обеспечения BIAevaluation и модели связывания 1:1.

Скрининг 22 клонов TAM проводили на приборе Biacore T100 с использованием чипа CM5 серии S, четырех ненулевых концентраций каждого Fab (2, 4, 12, 60 и 300 нМ). Результаты упорядочены по KD и представлены в таблице 9. На основании расстановки по KD для дальнейшего определения характеристик выбрали TAM1, TAM2, TAM9, TAM 19 и TAM20. Проводили два эксперимента (таблица 10), оба с использованием семи ненулевых концентраций Fab, включая одну дублирующую концентрацию. Первый эксперимент проводили на приборе Biacore T100, сенсорном чипе CM5 серии S и с периодом регенерации 30 секунд. Второй эксперимент проводили на приборе Biacore 3000, сенсорном чипе CM5 сенсорный чип и с периодом регенерации 1 минута. Таблица 10 показывает кинетику связывания выбранных аффинно-зрелых вариантов 5202.4 (формат Fab) с ПКА-фосфорилированным тау-белком. Плотность лиганда: приблизительно 403 RA ПКА-фосфорилированного тау-белка было иммобилизовано в эксперименте 1 и приблизительно 356 РЕ в эксперименте 2.

Также анализировали клоны в формате IgG (IgG1) с использованием сенсорного чипа CM5 и прибора Biacore 2000. Время регенерации составляло 1 минуту. Тестировали шесть ненулевых концентраций, включая одну дублирующую концентрацию;. Из-за бивалентности IgG, можно было ожидать неоптимальной подгонки 1:1 в этом формате, и результаты могут зависеть от плотности иммобилизованного антигена. Две плотности оценивали одновременно с использованием соседних проточных ячеек, результаты представлены в таблице 11 (таблица 11 показывает кинетику связывания выбранных аффинно-зрелых вариантов 5202.4 (формат IgG) с ПКА-фосфорилированным тау-белком). Плотность лиганда: приблизительно 153 РЕ ПКА-фосфорилированного тау-белка было иммобилизовано в проточной ячейке 4 (плотность лиганда 1) и приблизительно 824 РЕ в проточной ячейке 3 (плотность лиганда 2). Эти данные показывают, что существует компонент авидности для связывания антител с лигандом, и указывают на то, что оба плеча антитела могут вносить вклад в связывание антитела с лигандом.

Специфичность пяти возглавляющих таблицу клонов оценивали ELISA. Микропланшеты, покрытые 0,1 или 1 мкг/мл нефосфорилированного полноразмерного тау, ПКА-фосфорилированного полноразмерного тау, гиперфосфорилированного полноразмерного тау или монофосфорилированного альфа-синуклеина блокировали PBS/0,5% BSA/0,1% Tween 20 (BBT) в течение нескольких часов при температуре окружающей среды и подвергали воздействию антитела к тау IgG в указанных концентрациях, в BBT, в течение двух часов. Аминокислотная последовательность полноразмерного тау (441 а/к), использованного в этом эксперименте, приведена в таблице 12 (SEQ ID NO:59). ПКА-фосфорилированный тау получали посредством инкубации полноразмерного тау in vitro с протеинкинаой A, которая фосфорилирует серин 409. Гиперфосфорилированный тау получали посредством инкубации полноразмерного тау in vitro с киназным коктейлем, включающим ПКА, GSK3, CDK5 и казеинкиназу 1 дельта. Связавшийся IgG выявляли при помощи конъюгированного с пероксидазой антитела к Fc человека и визуализировали при помощи ситемы детекции на основе 3,3',5,5'-тетраметилбензидина (TMB). После добавления равного объема 1M фосфорной кислоты количественно определяли оптическую плотность при 450 нм с использованием спектрофотометра для чтения планшетов SpectraMax M2 (Molecular Devices). TAM1, TAM2, TAM9, TAM 19 и TAM20 IgG связывались с планшетами, покрытыми ПКА-фосфорилированным тау, но связывались минимально, если вообще связывались, с планшетами, покрытыми нефосфорилированным тау-белком или монофосфорилированным альфа-синуклеином (фигура 2).

Специфичность пяти возглавляющих таблицу клонов для фосфосерина 404 и фосфосерина 409 также оценивали при помощи ELISA. В одном эксперименте (фигура 3), микропланшеты Nunc maxisorp покрывали 5 мкг/мл IgG в покрывающем буфере (карбонат натрия, pH 9,6) в течение 70 минут при температуре окружающей среды. Участки неспецифического связывания блокировали BBT в течение минимум 2 часов, затем планшеты промывали и добавляли 10 нМ биотинилированного пептида в BBT. Через 1,5 часа связавшийся пептид детектировали посредством 65-минутной инкубации со стрептавидином, конъюгированным с пероксидазой, детекции с TMB, как описано выше. На фигуре 3 представлено среднее и диапазон для дублированных ячеек; ось y представляет оптическую плотность при 450 нм. Пептиды, синтезированные и использованные в этом эксперименте (которые соответствовали аминокислотам 401-418 полноразмерного тау) имели следующие аминокислотные последовательности (таблица B):

ТАБЛИЦА B
Пептид Последовательность пептида
X = фосфосерин
pS404, pS409 Биотин-линкер-GDTXPRHLXNVSSTGSID SEQ ID NO:94
Нефосфорилированный Биотин-линкер-GDTSPRHLSNVSSTGSID SEQ ID NO:95
pS404 Биотин-линкер-GDTXPRHLSNVSSTGSID SEQ ID NO:96
pS409 Биотин-линкер-GDTSPRHLXNVSSTGSID SEQ ID NO:97

В другом эксперименте (фигура 4) микропланшеты Nunc maxisorp покрывали 5 мкг/мл нейтравидина в покрывающем буфере в течение ночи при 4°C и участки неспецифического связывания блокировали путем инкубации с BBT в течение минимум 2 часов. Затем проводили связывание биотинилированных пептидов (20 нМ) в течение 1,5 часа, перед тем как планшеты отмывали и подвергали воздействию IgG в установленных концентрациях в течение 1 часа. В этом эксперименте использовали такие же пептиды, что и в эксперименте, показанном на фигуре 3 и описанном выше (см. таблицу B). Связавшийся IgG выявляли при помощи конъюгированного с пероксидазой антитела к антителу человека и детекции с TMB, как описано выше. Использовали различные концентрации IgG (0,01 нМ, 0,1 нМ, 1 нМ, 10 нМ и 100 нМ). На фигуре 4 представлено среднее и диапазон для дублированных ячеек; ось y представляет оптическую плотность при 450 нм. "Фон" указывает на сигнал от ячеек, не покрытых нейтравидином; "Без пептида" указывает на сигнал от ячеек, покрытых нейтравидином, но подвергавшихся воздействию пептида.

Вывод

Данные показывают, что были созданы аффинно зрелые антитела, которые специфически распознают и связывают фосфорилированный эпитоп на тау. Некоторые из созданных антител демонстрируют высокую специфичность и/или высокую аффинность к pTau.

TAM1, TAM2 и TAM9 селективно выявляют фосфосерин 409 на тау, как показано путем ELISA и Biacore. Более того, все данные также демонстрируют селективность этих антитела (т.е. TAM1, TAM2 и TAM9) для фосфосерина 409 в отношении фосфорилированного полноразмерного тау по сравнению с нефосфорилированным полноразмерным тау.

ТАБЛИЦА 1
Аминокислотная последовательность 5202.4 (hlgGl)
Аминокислотная последователь ность: 5202.4 (антитело hlgGl)
Вариабельная область легкой цепи DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSHGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIK
(SEQ ID NO:60)
Легкая цепь DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSHGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:61)
Вариабельная область тяжелой цепи EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:62)
Тяжелая цепь EVQLVQSGAEVKKPGSSVKVSCbCASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNbCALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
(SEQ ID NO:63)

ТАБЛИЦА 2A
Аминокислотная последовательность CDR вариабельной области легкой цепи белков ТАМ и 5202.4
Антитело CDR LI (HVR-L1) CDR L2 (HVR-L2) CDR L3 (HVR-L3)
5202.4 RSSQSLVHSHGKTYLH
(SEQ ID NO:15)
KVSNRFS
(SEQ ID NO:16)
SQTAHFPYT
(SEQ ID NO:30)
TAM_1 RSSQSLVHRNGKTYLH
(SEQ ID NO:1)
KVSNRFS
(SEQ ID NO:16)
SQTARFPYT
(SEQ ID NO:27)
TAM_2 RSSQSLVHSRGKTYLH
(SEQ ID NO:2)
KVSNRFF
(SEQ ID NO:17)
SQTARFPYT
(SEQ ID NO:27)
TAM_3 RSSQSLVHSKGKTYLH
(SEQ ID NO:3)
KVKNRFS
(SEQ ID NO:18)
SQTAHFPRT
(SEQ ID NO:28)
TAM_4 RSSQSLVRSRGKTYLH
(SEQ ID NO:4)
KVSNRFS
(SEQ ID NO:16)
SQTAQFPYT
(SEQ ID NO:29)
TAM_5 RSSQSLVHKHGKTYLH
(SEQ ID NO:5)
KVRNRFS
(SEQ ID NO:19)
SQTAHFPYT
(SEQ ID NO:30)
TAM_6 RSSQSLVHSGGKTYLH
(SEQ ID NO:6)
KVSNRFG
(SEQ ID NO:20)
SQTRHFPYT
(SEQ ID NO:31)
TAM_7 RSSQRLIHRNGKTYLH
(SEQ ID NO:7)
KVSNRFF
(SEQ ID NO:17)
SQTAHFPYT
(SEQ ID NO:30)
TAM_8 RS SQSLVRSHGKTYLH
(SEQ ID NO:8)
KVSNRFF
(SEQ ID NO:17)
SQTAYFPYT
(SEQ ID NO:32)
TAM_9 RSSQSLVRSHGKTYLH
(SEQ ID NO:8)
KVSNRFK
(SEQ ID NO:21)
SQTAQFPYT
(SEQ ID NO:29)
TAM_10 RSSQSLVRSRGKTYLH
(SEQ ID NO:4)
KVSNRFS
(SEQ ID NO:16)
SQTAHFPYT
(SEQ ID NO:30)
TAM_11 RSSQSLVHSHGRTYLH
(SEQ ID NO:9)
KVSNRFR
(SEQ ID NO:22)
SQTAYFPYT
(SEQ ID NO:32)
TAM_12 TSSQVLVHSHGKTYLH (SEQ ID N0:1O) KVSNRFR
(SEQ ID NO:22)
SQTARFPYT
(SEQ ID NO:27)
TAM_13 RSSQSLVHRHGKTYLH
(SEQ ID NO:11)
KVSNRFS
(SEQ ID NO:16)
SQTAHFPRT
(SEQ ID NO:28)
TAM_14 RSSQSLVHRRGKTYVH
(SEQ ID NO:12)
KVSNRFS
(SEQ ID NO:16)
SQTAHFPYT
(SEQ ID NO:30)
TAM_15 RSSQSLVRSHGKTYLH
(SEQ ID NO:8)
KVSKRFY
(SEQ ID NO:23)
SQTAHFPYT
(SEQ ID NO:30)
TAM_16 RSSQSLVHRHGKTYLH
(SEQ ID NO:11)
KVSNRFS
(SEQ ID NO:16)
SQTAHFPYT
(SEQ ID NO:30)
TAM_17 RSSQSLVHGHGKTYLH
(SEQ ID NO:13)
KVRNRFS
(SEQ ID NO:24)
SQTAHFPYT
(SEQ ID NO:30)
TAM_18 RSSQSLVHGHGKTYLH
(SEQ ID NO:13)
KVSNRFS
(SEQ ID NO:16)
SQTARFPYT
(SEQ ID NO:27)
TAM_19 RSSQSLRHSHGKTYLH
(SEQ ID NO:14)
KVSHRFS
(SEQ ID NO:25)
SQTRHFPYT
(SEQ ID NO:31)
TAM_20 RSSQSLVHSHGRTYLH
(SEQ ID NO:9)
KVSNRFF
(SEQ ID NO:17)
SQTRHFPYT
(SEQ ID NO:31)
TAM_21 RSSQSLVRSHGKTYLH
(SEQ ID NO:8)
KVSNRFL
(SEQ ID NO:26)
SQTAHFPYT
(SEQ ID NO:30)
TAM_22 RSSQSLVHSHGRTYLH
(SEQ ID NO:9)
KVSNRFF
(SEQ ID NO:17)
SQTRHFPYT
(SEQ ID NO:31)
TAM_23 RSSQSLVRSHGKTYLH
(SEQ ID NO:8)
KVSNRFF
(SEQ ID NO:17)
SQTAHFPRT
(SEQ ID NO:28)

ТАБЛИЦА 2B
Аминокислотная последовательность CDR вариабельной области тяжелой цепи белков ТАМ и 5202.4 (они одинаковы для всех белков ТАМ и 5202.4)
CDR HI (HVR-H1) CDR H2 (HVR-H2) CDR H3 (HVR-H3)
GYTFTDYYMN (SEQ ID N0:33) DINPNRGGTTYNQKFKG (SEQ ID N0:34) YYAVGY (SEQ ID N0:35)

ТАБЛИЦА 3
Аминокислотные мутации в последовательности CDR легких цепей в белках ТАМ относительно 5202.4
Положение по Kabat 5202.4 Мутация
24 R T
27A S RV
V RI
27D H R
27E S RGK
28 H RKNG
30 К R
33 L V
52 S KR
53 N KH
56 S FGKRYL
92 A R
93 H RQY
96 Y R

ТАБЛИЦА 4
Аминокислотные последовательности вариабельной области легкой цепи и вариабельной области тяжелой цепи белков ТАМ
Название антитела Вариабельная область легкой цепи Вариабельная область тяжелой цепи
TAM_1 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHRNGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTARFPYTFGGGTKVEIK
(SEQ ID NO:36)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_2 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSRGKTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTARFPYTFGGGTKVEIK
(SEQ ID NO:37)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_3 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSKGKTYLHWYLQKPGQSPQLLIYKVKNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPRTFGGGTKVEIK
(SEQ ID NO:38)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_4 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSRGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAQFPYTFGGGTKVEIK (SEQ ID NО:39) EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_5 DIVMTQTPLSLPVTPGEPASISCRS SQSLVHKHGKTYLHWYLQKPGQSPQLLIYKVRNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIK
(SEQ ID NO:40)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_6 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSGGKTYLHWYLQKPGQSPQLLIYKVSNRFGGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTRHFPYTFGGGTKVEIK
(SEQ ID NO:41)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)

TAM_7 DIVMTQTPLSLPVTPGEPASISCRSSQRLIHRNGKTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIK
(SEQ ID NO:42)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_8 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAYFPYTFGGGTKVEIK
(SEQ ID NO:43)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_9 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSNRFKGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAQFPYTFGGGTKVEIK
(SEQ ID NO:44)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_10 DIVMTQTPLSLPVTPGEPASISCRS SQSLVRSRGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIK
(SEQ ID NO:45)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_11 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSHGRTYLHWYLQKPGQSPQLLIYKVSNRFRGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAYFPYTFGGGTKVEIK
(SEQ ID NO:46)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)

TAM_12 DIVMTQTPLSLPVTPGEPASISCTSSQVLVHSHGKTYLHWYLQKPGQSPQLLIYKVSNRFRGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTARFPYTFGGGTKVEIK
(SEQ ID NO:47)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_13 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHRHGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPRTFGGGTKVEIK
(SEQ ID NO:48)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_14 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHRRGKTYVHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFP YTFGGGTKVEIK
(SEQ ID NO:49)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_15 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSKRFYGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIK
(SEQ ID NO:50)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_16 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHRHGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFP YTFGGGTKVEIK
(SEQ ID NO:51)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)

ТАМ_17 DIVMTQTPLSLPVTPGEPASISCRS SQSLVHGHGKTYLHWYLQKPGQSPQLLIYKVRNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIK
(SEQ ID NO:52)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
ТАМ_18 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHGHGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTARFPYTFGGGTKVEIK
(SEQ ID NO:53)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_19 DIVMTQTPLSLPVTPGEPASISCRSSQSLRHSHGKTYLHWYLQKPGQSPQLLIYKVSHRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTRHFPYTFGGGTKVEIK
(SEQ ID NO:54)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_20 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSHGRTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTRHFPYTFGGGTKVEIK
(SEQ ID NO:55)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_21 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSNRFLGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIK
(SEQ ID NO:56)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)

TAM_22 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSHGRTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTRHFPYTFGGGTKVEIK
(SEQ ID NO:55)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)
TAM_23 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPRTFGGGTKVEIK
(SEQ ID NO:57)
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSS
(SEQ ID NO:58)

ТАБЛИЦА 5
Полноразмерные аминокислотные последовательности легких цепей белков ТАМ
Название антитела Последовательность легкой цепи
TAM_1 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHRNGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTARFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:64)
TAM_2 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSRGKTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTARFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:65)
TAM_3 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSKGKTYLHWYLQKPGQSPQLLIYKVKNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:66)
TAM_4 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSRGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAQFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:67)
TAM_5 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHKHGKTYLHWYLQKPGQSPQLLIYKVRNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:68)
TAM_6 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSGGKTYLHWYLQKPGQSPQLLIYKVSNRFGGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTRHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTFIQGLSSPVTKSFNRGEC
(SEQ ID NO:69)
TAM_7 DIVMTQTPLSLPVTPGEPASISCRSSQRLIHRNGKTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:70)
TAM_8 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAYFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:71)
TAM_9 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSNRFKGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAQFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:72)
TAM_10 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSRGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:73)
TAM_11 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSHGRTYLHWYLQKPGQSPQLLIYKVSNRFRGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAYFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:74)
TAM_12 DIVMTQTPLSLPVTPGEPASISCTSSQVLVHSHGKTYLHWYLQKPGQSPQLLIYKVSNRFRGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTARFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:75)
TAM_13 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHRHGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:76)
TAM_14 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHRRGKTYVHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:77)
TAM_15 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSKRFYGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:78)
TAM_16 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHRHGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:79)
ТАМ_17 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHGHGKTYLHWYLQKPGQSPQLLIYKVRNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:80)
ТАМ_18 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHGHGKTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTARFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:81)
TAM_19 DIVMTQTPLSLPVTPGEPASISCRSSQSLRHSHGKTYLHWYLQKPGQSPQLLIYKVSHRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTRHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:82)
TAM_20 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSHGRTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTRHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:83)
TAM_21 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSNRFLGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:84)
TAM_22 DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSHGRTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTRHFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:83)
TAM_23 DIVMTQTPLSLPVTPGEPASISCRSSQSLVRSHGKTYLHWYLQKPGQSPQLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQTAHFPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO:85)

ТАБЛИЦА 6
Полноразмерные аминокислотные последовательности тяжелых цепей (IgG4) ТАМ
Название антитела Последовательность тяжелой цепи
TAM_1 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_2 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_3 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_4 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDRNPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_5 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENiNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_6 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_7 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_8 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALFTNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_9 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVITNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKLAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_10 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVFTNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_11 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKA.KGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
(SEQ ID NO:86)
TAM_12 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALFINHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_13 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKLPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_14 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQICFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_15 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_16 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYIMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
ТАМ_17 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYIMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
ТАМ_18 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_19 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_20 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALFFNHYTQKSLSLSLGK
(SEQ ID NO:86)

TAM_21 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_22 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKLPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)
TAM_23 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(SEQ ID NO:86)

ТАБЛИЦА 7
Полноразмерные аминокислотные последовательности тяжелых цепей (IgG1) белков ТАМ
Название антитела Последовательность тяжелой цепи
TAM_1 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87
TAM_2 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGICEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_3 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYIMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)

TAM_4 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_5 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_6 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)

TAM_7 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYIMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGbCEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_8 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_9 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKJPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)

TAM_10 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDrNPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_11 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_12 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYIMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)

TAM_13 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYIMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_14 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKLPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNICALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_15 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHbCPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)

TAM_16 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVFiNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
ТАМ_17 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYIMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
ТАМ_18 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)

TAM_19 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_20 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKLPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_21 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)

TAM_22 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)
TAM_23 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:87)

ТАБЛИЦА 8
Полноразмерные аминокислотные последовательности тяжелых цепей (IgG1 N297G) ТАМ
Название антитела Последовательность тяжелой цепи
TAM_1 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_2 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_3 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)

TAM_4 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_5 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_6 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)

TAM_7 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_8 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_9 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)

TAM_10 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_11 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_12 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)

TAM_13 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_14 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_15 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)

TAM_16 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
ТАМ_17 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
ТАМ_18 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)

TAM_19 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_20 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_21 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)

TAM_22 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)
TAM_23 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGDINPNRGGTTYNQKFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCASYYAVGYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHiNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGК
(SEQ ID NO:88)

ТАБЛИЦА 9
Скрининг при помощи Biacore: Fab упорядочены по KD
Лиганд: ПКА-фосфорилированный тау-белок, иммобилизованный непосредственно при помощи аминовой связи
Аналит: Рекомбинантный Fab
ka (1/мс) kd (1/с) KD (нМ)
TAM1 5,3×105 1,5×10-3 2,9
TAM19 5,7×105 2,6×10-3 4,5
TAM22 7,3×105 3,5×10-3 4,8
TAM20 6,8×105 3,6×10-3 5,2
TAM9 3,3×105 1,9×10-3 5,7
TAM2 3,5×105 2,4×10-3 6,7
TAM3 3,0×105 2,1×10-3 7
TAM21 2,7×105 2,4×10-3 9
TAM6 2,8×105 2,7×10-3 10
TAM15 2,0×105 2,2×10-3 11
TAM11 2,2×105 2,5×10-3 11
TAM4 2,4×105 2,8×10-3 12
TAM13 1,9×105 2,3×10-3 12
TAM17 2,2×105 2,9×10-3 13
TAM10 6,6×105 10,3×10-3 16
TAM12 1,6×105 2,6×10-3 16
TAM16 1,5×105 2,4×10-3 17
TAM14 1,2×105 2,0×10-3 17
TAM5 1,9×105 3,3×10-3 17
TAM23 16,5×105 33,4×10-3 20
TAM18 1,3×105 2,9×10-3 23
TAM7 5,4×105 13,9×10-3 26
5202.4 1,4×105 9,0×10-3 62
TAM8 0,3×105 7,2×10-3 275

ТАБЛИЦА 10
Кинетика связывания выбранных аффинно-зрелых вариантов 5202.4 (формат Fab) с ПКА-фосфорилированным тау-белком в Biacore: моновалентное взаимодействие
Fab ka (M-1⋅c-1) kd (c-1) Rmax (RU) KD (нМ)
Экcп 1 Экcп 2 Экcп 1 Эксп 2 Экcп 1 Эксп 2 Экcп 1 Эксп 2
5202.4 2×105 1×105 10×10-3 10×10-3 113 77 50 74
TAM1 7×105 10×105 1×10-3 2×10-3 130 91 2 2
TAM2 4×105 6×l05 2×10-3 3×10-3 113 75 5 5
TAM9 5×105 5×105 2×10-3 3×10-3 119 85 4 5
ТАМ19 7×105 9×105 2×10-3 3×10-3 121 87 4 4
TAM20 9×105 10×105 4×10-3 5×10-3 118 85 4 5
TAM1 (повтор) 6×105 10×105 1×10-3 2×10-3 128 94 2 2

ТАБЛИЦА 11
Кинетика связывания выбранных аффинно-зрелых вариантов 5202.4 (формат IgG) с ПКА-фосфорилированным тау-белком
IgG ka (M-1⋅c-1) kd (c-1) Rmax (RU) KD (нМ)
Плотность лиганда 1 Плотность лиганда 2 Плотность лиганда 1 Плотность лиганда 2 Плотность лиганда 1 Плотность лиганда 2 Плотность лиганда 1 Плотность лиганда 2
5202.4 6×105 4×105 7×10-4 2×10-4 28 265 1,2 0,6
TAM1 56×105 17×105 11×10-4 4×10-4 52 367 0,2 0,2
TAM2 35×105 11×105 11×10-4 3×10-4 44 364 0,3 0,2
TAM9 28×105 14×105 20×10-4 6×10-4 50 304 0,7 0,4
ТАМ19 35×105 14×105 8×10-4 5×10-4 65 363 0,2 0,4*
TAM20 16×105 16×105 12×10-4 3×10-4 80 368 0,8 0,2
Протестированные концентрации: 25 нМ, 6,25 нМ, 1,56 нМ, 1,56 нМ, 0,4 нМ, 0,l нМ. Контроль качества: Данные от 25 нМ исключили, когда наблюдали фазу негативной ассоциации и/или неспецифическое связывание больше чем приблизительно 10% от Rmax (TAM1 и 2, обе плотности; ТАМ 19, плотность 1). Одна кривая (TAM20, 1,25 нМ) была исключена в связи с положительным наклоном в фазе диссоциации. Звездочка (*) указывает на χ2 приблизительно 21% Rmax. Примечание: можно ожидать неоптимальной подгонки 1:1 для связывания бивалентного IgG с иммобилизованным антигеном.

Таблица 12. Наиболее длинная изоформа тау человека (441 а/к), также называемая Tau40.

Наиболее длинная изоформа тау человека (441 а/к), также называемая Tau40
Тау-белок, ассоциированный с микротрубочками, изоформа 2
[Homo sapiens]
Эталонная последовательность NCBI: NP_005901.2
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
(SEQ ID NO:59)

Хотя вышеуказанное изобретение было описано довольно подробно в виде примеров для ясности понимания, описания и примеры не следует подразумевать как ограничивающие объем изобретения. Описания всех патентов и научной литературы, процитированных в настоящем документе, явным образом включены в полном объеме посредством ссылки.

1. Изолированные антитело или его антигенсвязывающий участок, которые связываются с фосфорилированным эпитопом тау-белка человека, где антитело или его антигенсвязывающий участок содержат HVR-L1, HVR-L2 и HVR-L3, где

i) (a) HVR-L1 содержит аминокислотную последовательность из SEQ ID NO:1; (b) HVR-L2 содержит аминокислотную последовательность из SEQ ID NO:16; и (c) HVR-L3 содержит аминокислотную последовательность из SEQ ID NO:27; или

ii) (a) HVR-L1 содержит аминокислотную последовательность из SEQ ID NO:2; (b) HVR-L2 содержит аминокислотную последовательность из SEQ ID NO:17; и (c) HVR-L3 содержит аминокислотную последовательность из SEQ ID NO:27; или

iii) (a) HVR-L1 содержит аминокислотную последовательность из SEQ ID NO:8; (b) HVR-L2 содержит аминокислотную последовательность из SEQ ID NO:21; и (c) HVR-L3 содержит аминокислотную последовательность из SEQ ID NO:29; или

iv) (a) HVR-L1 содержит аминокислотную последовательность из SEQ ID NO:14; (b) HVR-L2 содержит аминокислотную последовательность из SEQ ID NO:25; и (c) HVR-L3 содержит аминокислотную последовательность из SEQ ID NO:31; или

v) (a) HVR-L1 содержит аминокислотную последовательность из SEQ ID NO:9; (b) HVR-L2 содержит аминокислотную последовательность из SEQ ID NO:17; и (c) HVR-L3 содержит аминокислотную последовательность из SEQ ID NO:31,

и где антитело или его антигенсвязывающий участок содержат HVR-H1, HVR-H2 и HVR-H3, где HVR-H1 включает аминокислотную последовательность GYTFTDYYMN (SEQ ID NO:33); HVR-H2 включает аминокислотную последовательность DINPNRGGTTYNQKFKG (SEQ ID NO:34); и HVR-H3 включает аминокислотную последовательность YYAVGY (SEQ ID NO:35).

2. Антитело или его антигенсвязывающий участок по п.1, где фосфорилированный эпитоп включает фосфорилированный аминокислотный остаток, выбранный из группы, состоящей из серина в положении 409 тау человека (SEQ ID NO:59), серина в положении 404 тау человека (SEQ ID NO:59) и серина в положении 404 и 409 тау человека (SEQ ID NO:59).

3. Антитело или его антигенсвязывающий участок по п.1, которые содержат последовательность вариабельного домена легкой цепи (VL), выбранную из группы, состоящей из SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:44, SEQ ID NO:54 и SEQ ID NO:55, или VL, имеющий по меньшей мере 95% идентичности последовательности с аминокислотной последовательностью, выбранной из группы, состоящей из SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:44, SEQ ID NO:54 и SEQ ID NO:55.

4. Антитело или его антигенсвязывающий участок по п.1, содержащие последовательность вариабельного домена тяжелой цепи (VH) из SEQ ID NO:58 или последовательность VH, имеющую по меньшей мере 95% идентичности последовательности с аминокислотной последовательностью из SEQ ID NO:58.

5. Антитело или его антигенсвязывающий участок по п.4, содержащие последовательность вариабельного домена тяжелой цепи (VH) из SEQ ID NO:58 или последовательность VH, имеющую по меньшей мере 95% идентичности последовательности с аминокислотной последовательностью из SEQ ID NO:58.

6. Антитело по любому из пп.1-5, которое представляет собой моноклональное антитело.

7. Антитело по любому из пп.1-5, которое представляет собой гуманизированное или химерное антитело.

8. Антитело по п.7, которое представляет собой гуманизированное антитело.

9. Антитело по любому из пп.1-5, которое представляет собой полноразмерное антитело IgG1.

10. Антитело по любому из пп.1-5, которое представляет собой полноразмерное антитело IgG4.

11. Антитело по любому из пп.1-5, которое представляет собой полноразмерное антитело IgG1 N297G.

12. Антитело или его антигенсвязывающий участок по любому из пп.1-5, которые представляют собой фрагмент антитела, который связывается с фосфорилированным эпитопом на тау-белке человека.

13. Антитело или его антигенсвязывающий участок по любому из пп.1-5, которые не связываются с тем же самым эпитопом на тау-белке, который не фосфорилирован.

14. Антитело или его антигенсвязывающий участок по любому из пп.1-5, которые связываются с тем же самым эпитопом на тау-белке, который не фосфорилирован, по существу, со сниженной аффинностью.

15. Антитело или его антигенсвязывающий участок по любому из пп.1-5, где тау-белок содержит аминокислотную последовательность из SEQ ID NO:59.

16. Антитело или его антигенсвязывающий участок по любому из пп.1-5, где эпитоп на тау-белке человека содержит аминокислотные остатки 404-411.

17. Антитело или его антигенсвязывающий участок по любому из пп.1-5, которые связываются с фосфорилированным эпитопом с Kd приблизительно от 1 до 45 нМ.

18. Антитело или его антигенсвязывающий участок по любому из пп.1-5, которые связываются с фосфорилированным эпитопом с Kd≤1 нМ.

19. Антитело или его антигенсвязывающий участок по любому из пп.1-5, которые имеют константу скорости диссоциации ≤5×10-3 с-1.

20. Антитело или его антигенсвязывающий участок по любому из пп.1-5, которые имеют константу скорости ассоциации ≥3×105 М-1⋅с-1 или ≥7×105 М-1⋅с-1.

21. Антитело или его антигенсвязывающий участок по любому из пп.1-5, где тау-белок представляет собой агрегированный ассоциированный с микротрубочками и/или гиперфосфорилированный тау-белок, такой как тот, что присутствует в парных спиральных филаментах (PHF).

22. Изолированная нуклеиновая кислота, кодирующая антитело или его антигенсвязывающий участок по любому из пп.1-21.

23. Клетка-хозяин для получения антитела или его антигенсвязывающего участка по любому из пп.1-21, содержащая нуклеиновую кислоту по п.22.

24. Способ получения антитела или его антигенсвязывающего участка по любому из пп.1-21, включающий культивирование клетки-хозяина по п.23 таким образом, что вырабатываются указанные антитело или его антигенсвязывающий участок.

25. Иммуноконъюгат для лечения заболевания или нарушения, ассоциированного с тау-белком, содержащий антитело или его антигенсвязывающий участок по любому из пп.1-21 и цитотоксическое средство.

26. Фармацевтический состав для лечения заболевания или нарушения, ассоциированного с тау-белком, содержащий эффективное количество антитела или его антигенсвязывающего участка по любому из пп.1-21 и фармацевтически приемлемый носитель.

27. Антитело или его антигенсвязывающий участок по любому из пп.1-5 для применения в качестве лекарственного средства.

28. Антитело или его антигенсвязывающий участок по п.1 для применения в лечении заболевания или нарушения, ассоциированного с тау-белком, у индивидуума.

29. Антитело или его антигенсвязывающий участок по п.1 для применения в лечении таупатии у индивидуума.

30. Антитело или его антигенсвязывающий участок по п.1 для применения в лечении болезни Альцгеймера (БА) у индивидуума.

31. Антитело или его антигенсвязывающий участок по п.1 для применения в лечении лобно-височной деменции (ЛВД) у индивидуума.

32. Антитело или его антигенсвязывающий участок по п.1 для применения в лечении ухудшения или потери когнитивных функций у индивидуума.

33. Антитело или его антигенсвязывающий участок по п.1 для применения для снижения общих уровней тау-белка в головном мозге индивидуума.

34. Антитело или его антигенсвязывающий участок по п.1 для применения для снижения общих уровней фосфорилированного или гиперфосфорилированного тау-белка в головном мозге индивидуума.

35. Антитело или его антигенсвязывающий участок по любому из пп.28-34, где индивидуум представляет собой человека.

36. Применение антитела или его антигенсвязывающего участка по любому из пп.1-21 в производстве лекарственного средства для лечения заболевания или нарушения, ассоциированного с тау-белком, у индивидуума.

37. Применение по п.36, где заболевание или нарушение представляют собой БА.

38. Применение антитела или его антигенсвязывающего участка по любому из пп.1-21 в производстве лекарственного средства для снижения общих уровней тау-белка в головном мозге индивидуума или для снижения уровней фосфорилированного или гиперфосфорилированного тау-белка в головном мозге индивидуума.

39. Применение по любому из пп.36-38, где индивидуум представляет собой человека.

40. Антитело или его антигенсвязывающий участок по п.1 для применения для детекции нейрофибриллярных клубков, нитей нейропилей и дистрофического неврита.

41. Антитело или его антигенсвязывающий участок по п.1 для применения для детекции заболевания или нарушения, ассоциированного с тау-белком, таупатии, БА или ЛВД.

42. Антитело или его антигенсвязывающий участок по п.41 для применения для детекции БА.

43. Антитело или его антигенсвязывающий участок по п.1 для применения для модулирования общих уровней тау-белка в головном мозге индивидуума.

44. Антитело или его антигенсвязывающий участок по п.1 для применения для модулирования общих уровней фосфорилированного или гиперфосфорилированного тау-белка в головном мозге индивидуума.

45. Антитело или его антигенсвязывающий участок по п.43 или 44, где индивидуум представляет собой человека.

46. Применение антитела или его антигенсвязывающего участка по любому из пп.1-21 в производстве лекарственного средства для модулирования общих уровней тау-белка в головном мозге индивидуума или для модулирования уровней фосфорилированного или гиперфосфорилированного тау-белка в головном мозге индивидуума.

47. Применение по п.46, где индивидуум представляет собой человека.



 

Похожие патенты:

Настоящее изобретение относится к области биотехнологии и биомедицины, а именно к способу получения эритроцитов, а также способу получения препарата крови. К настоящему изобретению также относятся препараты клеток для получения эритроцитов, замороженные препараты популяций клеток для получения эритроцитов и набор для получения вышеуказанных препаратов клеток.

Изобретение относится к области биотехнологии, конкретно к антигенсвязывающему фрагменту (Fab) для сывороточного альбумина (СА), что может быть использовано в медицине.
Изобретения касаются модифицированной клетки СНО и способа размножения ортопоксвируса при ее использовании. Представленная клетка модифицирована таким образом, чтобы включать последовательность, кодирующую CP77 под контролем конститутивного промотора, и последовательность, кодирующую D13L и/или K1L также под контролем конститутивного промотора.

Настоящее изобретение относится к области иммунологии. Предложена молекула антитела, связывающегося с CD37 человека и имеющего константные области человеческого происхождения.

Изобретение относится к области биотехнологии, конкретно к получению анти-HER2 антитела и конъюгата анти-HER2 антитела и низкомолекулярного медицинского средства, и может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к получению антител против интерлейкина-6, и может быть использовано в медицине. Полученное антитело или его антигенсвязывающий фрагмент используют в составе фармацевтической композиции, а также для приготовления лекарственных средств для лечения или диагностики заболеваний или для облегчения симптомов, опосредованных интерлейкином-6.

Группа изобретений относится к области биотехнологии. Предложены рекомбинантная плазмидная ДНК pBiPr-ABIgA1FI6-ht, кодирующая человеческое антитело к гемагглютинину вируса гриппа А человека изотипа IgA1, и способ получения указанного человеческого антитела, а также линия эукариотических клеток, содержащая указанную рекомбинантную плазмидную ДНК, и способ получения указанной линии клеток.

Настоящее изобретение относится к области иммунологии. Предложены антитело и фрагмент антитела, способные к связыванию с фосфорилхолином и/или конъюгатом фосфорилхолина.

Настоящее изобретение относится к области биотехнологии, конкретно к генетически-модифицированным TCR-дефицитным Т-клеткам, и может быть использовано в медицине для лечения рака.

Изобретение относится к биотехнологии. Описаны трансляторы на основе нуклеиновых кислот, способные осуществлять логические операции с улучшенной эффективностью, максимизированным выходом и сниженным побочным действием, в частности в биологической системе.

Изобретение относится к биотехнологии. Предложен способ репликации человеческого митохондриального генома в клетках дрожжей Yarrowia lipolytica.

Предложенное изобретение относится к области биотехнологии. Предложен способ индукции иммунного ответа у индивидуума на чужеродный белковый антиген.

Изобретение относится к области биохимии, в частности к корму для животных, содержащему трансгенное растение или его часть для получения усвояемых сахаров с помощью фермента, деградирующего клеточную стенку, присутствующего в нем.

Группа изобретений относится к области биотехнологии. Предложена рекомбинантная бактерия для получения ацетона, которая содержит ген, кодирующий фосфокетолазу, в которой инактивирован путь Эмбдена-Мейерхофа-Парнаса путем удаления генов, кодирующих фосфофруктокиназу, и в которой инактивирована окислительная ветвь пентозафосфатного пути в результате удаления генов, кодирующих глюкозо-6-фосфатдегидрогеназу.

Изобретение относится к генной инженерии и биотехнологии и может быть использовано для получения химерного белка ангиогенина человека. Предложена рекомбинантная плазмида pPICZaA:ZZ_ANG, содержащая синтетический ген химерного белка ангиогенина человека (SEQ ID NO: 1), состоящего из аминокислотной последовательности двух IgG-связывающих доменов белка A (SEQ ID NO: 2) и ангиогенина человека (SEQ ID NO: 3), соединенных между собой пептидным линкером (SEQ ID NO: 4).

Настоящее изобретение относится к области иммунологии. Предложена молекула антитела, связывающегося с CD37 человека и имеющего константные области человеческого происхождения.

Изобретение относится к области биохимии, в частности к антителу или его антигенсвязывающему фрагменту, которое связывается с рецептором PD-1 человека. Также раскрыты: молекула нуклеиновой кислоты, кодирующая указанное антитело, экспрессионный вектор, содержащий указанную молекулу нуклеиновой кислоты, клетка-хозяин, экспрессирующая указанное антитело, фармацевтическая композиция, содержащая указанное антитело.

Изобретение относится к области биотехнологии, конкретно к получению анти-HER2 антитела и конъюгата анти-HER2 антитела и низкомолекулярного медицинского средства, и может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к получению антител против интерлейкина-6, и может быть использовано в медицине. Полученное антитело или его антигенсвязывающий фрагмент используют в составе фармацевтической композиции, а также для приготовления лекарственных средств для лечения или диагностики заболеваний или для облегчения симптомов, опосредованных интерлейкином-6.

Группа изобретений относится к области биотехнологии. Предложены рекомбинантная плазмидная ДНК pBiPr-ABIgA1FI6-ht, кодирующая человеческое антитело к гемагглютинину вируса гриппа А человека изотипа IgA1, и способ получения указанного человеческого антитела, а также линия эукариотических клеток, содержащая указанную рекомбинантную плазмидную ДНК, и способ получения указанной линии клеток.

Изобретение относится к области биотехнологии. Предложен селективный бифункциональный белковый комплекс, подавляющий рост и/или вызывающий апоптоз раковых стволовых клеток, состоящий из двух фрагментов вариабельных частей VHH-антител верблюжьих, способных распознавать и избирательно связываться с клеточными рецепторами CD47 и CD44, где фрагменты соединены в единую полипептидную цепь при помощи полипептидного линкера.

Настоящее изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий участок, способные к связыванию с фосфорилированным эпитопом на тау-белке человека с высокой специфичностью иили аффинностью. Также рассмотрен фармацевтический состав, иммуноконъюгат, нуклеиновая кислота, кодирующая такое антитело или его антигенсвязывающий участок, клетка-хозяин и способ получения антитела или его антигенсвязывающего участка. Кроме того, описано применение антитела или его антигенсвязывающего участка для производства лекарственного средства. Данное изобретение может найти дальнейшее применение при лечении различных состояний, ассоциированных с тау-белком, в частности таупатии, болезни Альцгеймера и лобно-височных деменций. 9 н. и 38 з.п. ф-лы, 15 ил., 12 табл.

Наверх