Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс



Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс
Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс
Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс
Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс
Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс
Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс
Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс
Способ получения рекомбинантного ферментативно-меченного антигена g2 хантавируса в клетках e.coli с целью его применения в иммуноферментном анализе при диагностике глпс

 


Владельцы патента RU 2539836:

Федеральное государственное бюджетное учреждение "Институт полиомиелита и вирусных энцефалитов им. М.П. Чумакова" РАМН (RU)

Изобретение относится к области биотехнологии, в частности к получению рекомбинантного ферментативно-меченного антигена G2 хантавируса Добрава. Сущность изобретения состоит в том, что предлагаемый способ получения антигена G2 хантавируса Добрава заключается в экспрессии антигена в клетках E.coli в виде ферментативно-меченного антигена G2 хантавирусов на основе белка-антигена НТ. Ферментативной меткой для белка-антигена служит бета-галактозидаза, являющаяся высокоактивным стабильным ферментом. Наличие коммерчески доступного хромогенного субстрата бета-галактозидазы (X-gal) дает возможность быстро оценивать результат иммунологической реакции визуально или по изменению оптической плотности раствора в видимой области. Изобретение может быть использовано для повышения специфичности и воспроизводимости иммуноферментного анализа при диагностике ГЛПС. 6 ил.

 

Область техники, к которой относится изобретение

Изобретение относится к области биотехнологии, в частности к получению рекомбинантного ферментативно-меченного антигена G2 хантавируса Добрава с целью его использования для повышения специфичности и воспроизводимости иммуноферментного анализа при диагностике ГЛПС методами иммуноферментного анализа.

Уровень техники: геморрагическая лихорадка с почечным синдромом (ГЛПС) - вирусный нетрансмиссивный зооноз, занимает в России ведущее место по числу заболевших среди природно-очаговых инфекций.

Наиболее эффективным методом борьбы с ГЛПС является специфическая профилактика, то есть вакцинация населения эндемичных регионов [1-3]. В настоящее время коммерческие вакцины против ГЛПС производятся только в Китае, однако ни одна из этих вакцин не может применяться в европейских регионах России, так как не обеспечивает защиты от вирусов Пуумала и Добрава - возбудителей ГЛПС в этих регионах [4-7].

Для изготовления и контроля вакцины против вирусов Пуумала и Добрава необходимо решить проблему разработки эффективных серологических методов на основе белков внешней оболочки - энвелопа хантавирусов. Однако до настоящего времени задача получения полноразмерных коммерческих препаратов белков энвелопа G1 и G2 хантавирусов не решена нигде в мире, что обусловлено их токсичностью по отношению к бактериальным клеткам.

В последнее время стала актуальной разработка иммунологических тестов четвертого поколения, которые позволяют диагностировать различные заболевания с высокой специфичностью на ранних стадиях.

Полученный ранее рекомбинантный антиген НТ-Δ12 (пат. заявка RU №2010141819 от 13.10.2010) представляет собой фрагмент белка G2 хантавируса Добрава, однако, хотя он и сохраняет иммуногенность полноразмерного продукта и не является токсичным по отношению к клетками продуцента, возможность его использования в качестве антигена в иммунологических тестах (особенно последнего поколения) затруднительна, так как данный белок накапливается в клетках продуцента в виде телец включения [8-10].

Целью нашей работы является получение рекомбинантного ферментативно-меченного антигена на основе белка-антигена НТ в клетках E.coli с целью повышения специфичности и воспроизводимости диагностического анализа за счет применения такого антигена в иммунологических тестах четвертого поколения. Ферментативной меткой для белка-антигена будет служить β-галактозидаза, являющаяся высокоактивным стабильным ферментом, что даст возможность быстро визуально оценивать результат иммунологической реакции.

Раскрытие изобретения:

Сущностью изобретения является способ получения пептида НТ (производного поверхностного антигена G2 хантавируса Добрава) в клетках E.coli в виде ферментативно-меченного антигена для его дальнейшего использования в иммуноферментном анализе. Ферментативной меткой для белка-антигена служит бета-галактозидаза, являющаяся высокоактивным стабильным ферментом в сочетании с хромогенным субстратом X-gal, что дает возможность визуальной (качественно) или спекторофотометрической (количественно) оценки результата иммунологической реакции.

Способ предусматривает следующие стадии:

1) получение плазмидной конструкции pQL-Ht,

2) экспрессия и анализ выхода белка,

3) хроматография белка Ht-LacZ на колонке Sepharose 6 FF,

4) проведение иммунохимических тестов.

Краткое описание графических изображений:

Фиг.1. Плазмидная конструкция pQL-Ht, принципиальная схема.

Фиг.2. Последовательность бифункционального слитого гена, кодирующего производное пептида НТ, в составе конструкции pQL-НТ.

- Последовательность пептида НТ из состава кДНК вируса Добрава закрашена серым;

- Последовательность гена бета-галактазидазы подчеркнута волнистой линией.

Фиг.3. Хроматография белка Ht-LacZ на колонке Sepharose 6 FF. На графике (1) представлена оптическая плотность при λ=280 нм. Пунктирными линиями обозначен диапазон фракций, отобранных для электрофоретического анализа и дальнейшей работы.

Фиг.4. Определение активности бета-галактозидазы во фракциях после хроматографии. На оси ординат указана величина А620.

Фиг.5. Электрофоретический анализ фракций белка Ht-LacZ после хроматографии. Белки разделены в денатурирующем 15% ПААГ и окрашены на общий белок Coomassie Blue R-250.

Фиг.6. Изучение антигенной активности белка Ht-LacZ методом твердофазного иммуноферментного анализа. Планшеты активированы белком-антигеном НК6. Смесь белка Ht-LacZ и сыворотки больных ГЛПС (вирусы Добрава) и здоровых доноров раститровывались в серии разведении от 3 до 192 раз с шагом 4 раза. На оси ординат указана величина А450(620) каждой точки. Черным цветом обозначена реакция с сыворотками крови людей, больных ГЛПС, серым - реакция с сыворотками крови здоровых людей. Результаты определялись спектрофотометрически при двух длинах волны: А) - при 620 нм (детекция ферментативной активности бета-галактозидазы). В) - при 450 нм (ферментативная активность пероксидазы хрена).

Осуществление изобретения:

Методология исследования:

1) получение плазмидной конструкции;

2) экспрессия и анализ выхода белка;

3) хроматография рекомбинантного белка;

4) проведение иммунохимических тестов.

1) Получение плазмидной конструкции

Получение конструкции pQL-Ht проводили по следующей схеме:

1) Ген бета-галоктазидазы (LacZ) в составе продукта ПЦР длиной 3080 п.н. клонировали из генома Е.coli C600 и вводили в состав вектора pQE30 по сайтам SalI-HindIII. Для проведения ПЦР с на матрице геномной ДНК Е. coli C600 использовали праймеры Lac-for1 (GGGTCGACACCATGATTACGGATTCACTG) и Lac-rev1 (GGAAGCTTATTTTTGACACCAGACCAACTG). Полученная конструкция была обозначена pQE-LacZ.

2) Ген пептида НТ из конструкции рЕТ-НТ-Δ12 был выщеплен по фланкирующим сайтам полилинкера KpnI и введен в плазмиду pQE-LacZ, также предварительно расщепленную по сайту KpnI. Таким образом, была получена конструкция pQL-HT (Фиг.1 и 2).

2) Экспрессия и анализ выхода белка

Конструкцию pQL-Ht вводили в клетки штамма Е.coli JM109. Селекцию колоний осуществляли по двум параметрам: по устойчивости к ампициллину и по наличию синей окраски колоний при росте на индикаторной среде с X-gal. Полученный продуцент культивировали при 30°С в жидкой среде (0,5% дрожжевой экстракт, 1% пептон, 0,5% NaCl) с добавлением 100 мкг/мл ампициллина в колбах Эрленмейера объемом 750 мл (30 мл среды на колбу) в течение 14-18 часов. Посевной материал представлял собой смыв с чашек культуры клеток, полученных высевом первичных трансформантов с агаризованной среды (0,5% дрожжевой экстракт, 1% пептон, 1,5% агар, 0,5% NaCl), содержащей X-gal и ампицилин. Возраст трансформантов - около 40 часов с момента окончания трансформации, температура культивирования - 30°С. Доза засева - 5×108 клеток на колбу. Индукцию промотора в клетках продуцента проводили IPTG.

Оценку выхода целевого продукта осуществляли с помощью электрофоретического анализа суммарных белков рекомбинантного продуцента по Лэммли. Для этого из грубого клеточного лизата каждой культуры отбирали по 100 мкл. Лизат подвергали центрифугированию при 14000 G. в течение 15 мин и разделяли растворимую и нерастворимую клеточную фракции. Белки солюбилизировали в 30 мкл буфере Лэммли и анализировали состав белков с помощью денатурирующего SDS-электрофореза в 15% ПААГ. После окрашивания геля Coomassie Blue R-250, в растворимой фракции клеточного лизата наблюдали полосу, соответствующую расчетной массе белка Ht-LacZ (около 120 кДа).

3) Хроматография рекомбинантного белка

Грубый клеточный лизат культуры JM109 (Ht-LacZ) подвергали центрифугированию при 8000 G в течение 1 часа и разделяли растворимую и нерастворимую клеточную фракции. Белок из растворимой фракции далее подвергали хроматографической очистке.

Основной целью хроматографии белка - производного пептида НТ в денатурирующих условиях являлось удаление примесей нуклеиновых кислот, формирующих коллоид с участием белков и препятствующих эффективному применению других методов хроматографии. При этом удаление из препарата примесей клеточных белков Е.coli рассматривалась лишь как побочная задача.

Полученный раствор белка Ht-LacZ наносили на колонку Sepharose 6 FF (GE Healthcare, США, высота 24 см, объем 48 мл), уравновешенную буфером А. Элюцию проводили линейным градиентом NaCl от 0 до 0,5 М в хроматографическом буфере В (Tris-HCl, 100 мМ) со скоростью 8 мл/мин (Фиг.3).

Полученные фракции, каждая по 10 мл, анализировались на наличие активности бета-галактозидазы. Реакционная смесь представляла собой трис-глициновый буфер, содержащий субстрат X-gal. Сигнал измеряли на планшетном сканере-спектрофотометре при λ=620 нм. Результаты определений представлены на Фиг.4.

Собранные фракции объемом 10 мл каждая анализировали с помощью денатурирующего SDS-электрофореза в 15% ПААГ. Для электрофореза отбиралось по 50-100 мкл от каждой фракции. Белки подвергали осаждению в 1 мл смеси (500 мкл 100% ацетона, 100 мкл 70% ТХУ на 1 мл). Полученные осадки солюбилизировали в денатурирующих условиях в 15 мкл буфера Лэммли (с добавлением мочевины). Гель прокрашивали на общий белок Coomassie Blue R-250 (Фиг.5).

Материал фракций белка Ht-LacZ, полученных в результате хроматографии в денатурирующих условиях, оказался электрофоретически гомогенным, что позволило непосредственно использовать его для проведения иммунохимических тестов.

5) Проведение иммунохимических тестов

В качестве формата проведения анализа был выбран непрямой вариант тИФА. На плашку сорбировали белок-антиген НК6. В процессе сорбции белковый препарат разводили в 20-50 раз карбонат-бикарбонатным буфером (КГБ), доводя концентрацию общего белка в растворе до 10 мкг/мл. Полученный раствор вносили в иммунологические планшеты на 1 сутки, после чего проводили блокирование неспецифического связывания на подложке с помощью 1% БСА в буфере КГБ. На следующей стадии проведения анализа в планшет вносили комплекс ферментативно-меченного белка-антигена Ht-LacZ с анализируемыми сыворотки крови больных ГЛПС и сыворотками крови здоровых доноров в группе сравнения. Смесь антиген-антитело разтитровывали от 3 до 192 раз с шагом 4 раза. В качестве контрольного образца использовали лунки планшета, в которые вместо разведенной сыворотки человека вносили буфер PBS («конъюгатный контроль»). Далее лунки планшета обрабатывали субстратом X-gal и производили замер сигнала на спектрофотометре при λ=620 нм. На следующем этапе анализа лунки планшета отмывали и обрабатывали антивидовым конъюгатом против IgG человека, меченным пероксидазой хрена, и субстратом ТМВ в присутствии пероксида водорода. Сигнал мерили на планшетном сканере-спектрофотометре при λ=450 нм. Результаты определений представлены на Фиг.6.

Результаты показывают, что использование белка-антигена с ферментативной меткой Ht-LacZ, позволяет отличать здоровых доноров от больных ГЛПС с высокой специфичностью, что делает возможным применение данного антигена в создании современных иммунологических тестов для диагностики ГЛПС.

Источники информации

1. Maes P., Clement J., Van Ranst M. Recent approaches in hantavirus vaccine development. - Expert Rev Vaccines. - 2009 - V.8, №1, P.67-76.

2. Cho H.W., Howard C.R., Lee H.W. Review of an inactivated vaccine against hantaviruses. - Intervirology. - 2002 - V.45, №4-6, P.328-333

3. Song G. Epidemiological progresses of hemorrhagic fever with renal syndrome in China. - Chin Med J (Engl). - 1999 - V.112, №5, P.472-477.

4. Oya A. Japanese encephalitis vaccine. - Acta Paediatr Jpn. - 1988 - V.30, №2, Р.175-184.

5. Choi Y. Ahn C.J., Seong K.M., Jung M.Y., Ahn B.Y. Inactivated Hantaan virus vaccine derived from suspension culture of Vero cells. - Vaccine. - 2003 - V.21, №17-18, P.1867-1873.

6. Lee H.W., Chu Y. K., Woo Y.D. Immune responses after two or three doses of Hantavax vaccination against Hantaan virus // Proc. fifth international conference on hemorrhagic fever with renal syndrome, hantavirus pulmonary syndrome and hantaviruses. Lion, Franch - 2001. - P.234-242.

7. Ruan Y., Xu X., Liu W., Deng X, Weng S, Zhou W, Wang Q, Chen L, Fang L, Xu Z, Yan Q, Liu W, Dong G, Gu H, Yu Y, Xu Z. A study on immunogenicity and safety of bivalent inactivated vaccine against hemorrhagic fever with renal syndrome. - Zhonghua Yu Fang Yi Xue Za Zhi. - 1999 - V.33, №6, P.340-342.

8. Hooper J.W., Kamrud K.I., Elgh F., Custer D., Schmaljohn C.S. DNA vaccination with hantavirus M segment elicits neutralizing antibodies and protects against seoul virus infection. - Virology. - 1999 - V.255, №2, P.269-278.

9. Kallio-Kokko H., Leveelahti R., Brummer-Korvenkontio M., Lundkvist A., Vaheri A., Vapalahti O. Human immune response to Puumala virus glycoproteins and nucleocapsid protein expressed in mammalian cells. - J Med Virol. - 2001 - V.65, №3, P.605-613

10. Huang H., Li X., Zehua Z. Genetic immunization with Hantavirus vaccine combining expression of G2 glycoprotein and fused interleukin-2. - Genetic Vaccines and Therapy. - 2008 - V.6. - P.15-21.

Способ получения рекомбинантного антигена G2 хантавируса Добрава в клетках Е. coli для использования при изготовлении диагностикумов геморрагической лихорадки с почечным синдромом, характеризующийся тем, что ДНК конструкции pQL-HT, кодирующей слитой белок из двух частей (N-концевое положение занимает пептид длиной 99 а.о. с последовательностью аминокислот RGSASGGAGGINSSRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSIN TSTMHFTDERIEWKDPDGMLRDHINILATKDIDFDTSGGAGGTRGSPGT, а C-концевое - ферментативная метка (ген бета-галактозидазы) (указ. Фиг.2)), вводят в клетки Е. coli, которые культивируют в жидкой ростовой среде, лизируют биомассу, отделяют растворимую фракцию лизата центрифугированием, проводят гель-хроматографию на колонке с сорбентом Sepharose-6FF и используют полученный продукт для выявления специфических антител в сыворотке больных геморрагической лихорадкой с почечным синдромом.



 

Похожие патенты:

Изобретение относится к биохимии и представляет собой новый бифункциональный белок PSH, включающий человеческий пероксиредоксин Prx6 и марганцевую супероксиддисмутазу MnSOD, обладающий антиоксидантной активностью супероксиддисмутазы и пероксидазы.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению G-CSF, и может быть использовано для продуцирования G-CSF в клетках Е.coli. Для эффективной продукции белка в клетках Е.coli оптимизируют последовательность ДНК, кодирующую G-CSF.

Изобретение относится к биотехнологии, в частности к генно-инженерному получению белков человека, и может быть использовано для получения эпидермального фактора роста человека (чЭФР) в клетках бактерий в виде гибридного белка с глутатион-3-трансферазой.

Группа изобретений относится к биотехнологии, генной и белковой инженерии, конкретно к рекомбинантной плазмидной ДНК pG1-Rm7, обеспечивающей в клетках Escherichia coli синтез гибридного белка G1-Rm7, способного связывать фактор некроза опухолей и обладающего биолюминесцентной активностью люциферазы Renilla muelleri, где указанная плазмидная ДНК включает нуклеотидную последовательность SEQ ID NO: 1, и может быть использована в медицине.

Изобретение относится к области биотехнологии и касается получения генетической конструкции, обеспечивающей синтез в клетках Escherichia coli рекомбинантного белка p35d. Представлены: рекомбинантная плазмидная ДНК pQE-p35d, обеспечивающая синтез рекомбинантного белка p35d вируса оспы коров и содержащая в соответствии с физической и генетической картой плазмиды, приведенной на фиг.

Изобретение относится к области биотехнологии и касается способа получения рекомбинантного антигена G2 хантавирусов. Представленный способ характеризуется тем, что ДНК конструкции pGHF, кодирующая слитый белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о.

Изобретение относится к области микробиологии и молекулярной генетики и касается рекомбинантного полипептида А2, ДНК, его колирующей, штамма продуцирующего полипептид А2 и способов использования такого рекомбинантного полипептида.

Изобретение относится к области биотехнологии, а именно к способу получения рекомбинантного антигена G2 хантавируса Добрава в клетках Е.coli. Способ характеризуется тем, что ДНК конструкции рНК6, указанной на фиг.1, кодирующая слитой белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о.
Изобретение относится к области ветеринарной микробиологии и биотехнологии. .

Изобретение относится к выделенному вирусу растений, названному вирус томата торрадо (ToTV), и его компонентам, а также к способам получения устойчивых к ToTV растений. .

Изобретение относится к области молекулярной биологии и иммунологии и может быть использовано в медицине, в частности, при диагностике гепатита С. .

Изобретение относится к области биотехнологии, вирусологии и иммунологии. В частности, настоящее изобретение относится к новому птичьему астровирусу; к антителам и их фрагментам, направленным против указанного нового вируса; к антигенным препаратам, белкам и ДНК-молекулам нового птичьего астровируса; к вакцинам на основе указанного нового вируса или к его антигенным препаратам, белку или ДНК; к способам получения таких вакцин и к диагностическим наборам. Настоящее изобретение может быть использовано в ветеринарии. 8 н. и 3 з.п. ф-лы, 5 ил., 4 табл., 12 пр.

Представленные изобретения касаются выделенного полинуклеотида, кодирующего полипептид, вовлеченный в биосинтез пирипиропена А, вектора и клетки-хозяина, включающих такой полипептид, и способов получения предшественников пирипиропена А, включающих культивирование клетки-хозяина. Представленный полинуклеотид кодирует полипептид, обладающий какой-либо одной или более из активностей - поликетидсинтазы, пренилтрансферазы, гидроксилазы, ацетилтрансферазы или аденилатсинтазы. Представленные изобретения позволяют синтезировать пирипиропен А, являющийся инсектицидным агентом, и могут быть использованы при формировании устойчивости растений к насекомым-вредителям. 5 н. и 11 з.п. ф-лы, 11 ил., 1 табл., 11 пр.

Экспрессионная плазмида, содержащая фрагмент днк, кодирующий мутеин [c245s] тканевого фактора человека с неотделяемым с-концевым тагом, бактерия e. coli - продуцент белка-предшественника мутеина [c245s] тканевого фактора человека с неотделяемым с-концевым тагом, способ получения рекомбинантного мутеина [c245s] тканевого фактора человека с неотделяемым с-концевым тагом, рекомбинантный мутеин [c245s] тканевого фактора человека с неотделяемым с-концевым тагом // 2550027
Изобретение относится к области биотехнологии и может быть использовано для рекомбинантного получения тканевого фактора человека (чТФ). Конструируют плазмиду pHYP-10ETFCS6 длиной 5912 п.о. с физической картой, представленной на Фиг. 2, для экспрессии в бактерии рода Escherichia предшественника мутеина [C245S] чТФ, содержащего отщепляемый N-концевой лидерный пептид, содержащий декагистидиновый кластер и последовательность узнавания энтерокиназы, слитую в рамке с последовательностью, кодирующей указанный мутеин, слитый в рамке с последовательностью, кодирующей дополнительный неотщепляемый C-концевой пептид, содержащий гексагистидиновый кластер. Способ получения предшественника мутеина [C245S] чТФ включает культивирование бактерии-продуцента в питательной среде, выделение телец включения, солюбилизацию белка-предшественника, металлохелатную хроматографию в денатурирующих условиях, рефолдинг и диафильтрацию раствора белка. Способ получения зрелого мутеина [C245S] чТФ, включает отделение N-концевого лидерного пептида от указанного предшественника мутеина с использованием энтерокиназы и выделение целевого белка. Изобретение позволяет повысить уровень биосинтеза и выход прокоагуляционно активного чТФ. 6 н. и 3 з.п.ф-лы, 5 ил., 1 табл., 7 пр.

Изобретения касаются рекомбинантной ДНК pA3, рекомбинантной плазмидной ДНК pQE 30-pA3, штамма Е.coli М 15-A3, рекомбинантного полипептида A3, тест-систем для качественного выявления и количественного определения микроальбуминурии. Охарактеризованная рекомбинантная ДНК pA3 получена методом полимеразной цепной реакции с использованием хромосомной ДНК штамма DG 13 стрептококков группы G и сконструированных праймеров. Амплификационный фрагмент клонировали посредством системы экспрессионных векторов pQE-pQE 30 в Е.coli М 15 с получением рекомбинантной ДНК pQE 30-pA3, которая кодирует аминокислотную последовательность рекомбинантного полипептида A3, обладающего способностью селективно связывать человеческий сывороточный альбумин (ЧСА). Представленные изобретения могут быть использованы в медицинской практике и промышленности для производства тест-систем по выявлению и количественному определению микроальбуминурии - одного из ранних признаков поражения почек у больных сахарным диабетом и эссенциальной артериальной гипертензией. 6 н.п. ф-лы, 9 ил., 1 табл., 8 пр.

Изобретение относится к биотехнологии и представляет собой модифицированный полипептид c гомосерин-O-ацетилтрансферазной активностью с аминокислотной последовательностью SEQ ID NO:17 или с по меньшей мере 95% гомологией с ней, в котором аминокислоту в положении 111 от начальной аминокислоты метионина последовательности заменяют глутаминовой кислотой. Изобретение относится также к способу получения о-ацетилгомосерина, который включает культивирование микроорганизма рода Escherichia, трансформированного полинуклеотидом, кодирующим заявленный полипептид. Изобретение позволяет получать о-ацетилгомосерин с высокой степенью эффективности. 6 н. и 12 з.п. ф-лы, 5 ил., 3 табл., 5 пр.
Наверх