Антимикробный гель для лечения инфицированных ран, ожогов и трофических язв



Владельцы патента RU 2655522:

Федеральное государственное бюджетное образовательное учреждение высшего образования "Ставропольский государственный медицинский университет" Министерства здравоохранения Российской Федерации (ФГБОУ ВО СтГМУ Минздрава России) (RU)

Изобретение относится к медицине и предназначено для лечения инфицированных ран, ожогов и трофических язв. Антимикробный гель для лечения инфицированных ран, ожогов и трофических язв содержит альфа-дефензин-1 (HNP-1), ПЭГ 12 диметикон, гелеобразователь, триэтаноламин и воду очищенную. При этом HNP-1 инкапсулирован в ниосомы, сформированные с помощью ПЭГ 12 диметикона. Компоненты используются в заявленном количестве. Гель позволяет не только уничтожать патогенные бактерии в ране, но и ускорять скорость заживления ран. Использование кремнийорганических наноконтейнеров-ниосом с активными субстанциями позволяет доставить их в глубокие слои кожи, снижать воспаление, улучшать микроциркуляцию, уничтожать бактерии и грибы. 1 пр.

 

Изобретение относится к медицине, а именно к лекарственным средствам, применяемым для лечения инфицированных ран, ожогов и трофических язв.

Стремительный рост устойчивости микроорганизмов к современным противомикробным препаратам является на сегодняшний день одной и ключевых проблем медицины. Высокая резистентность микроорганизмов приводит к снижению эффективности лечения, смертельным осложнениям и повышению финансовых затрат на лечение [Fair R.J., Tor Y. Antibiotics and bacterial resistance in the 21st century. // Perspect. Medicin. Chem. 2014. Vol.6. P. 25-64]. Проблема антибиотикорезистентности особенно ярко проявляется у пациентов, страдающих синдромом диабетической стопы. Рост заболеваемости сахарным диабетом приводит к росту заболеваемости синдромом диабетической стопы. Около 10% больных сахарным диабетом страдают синдромом диабетической стопы, а 50% входят в группу повышенного риска. В связи с ростом распространенности нозокомиальных инфекций, устойчивых к современным антибиотикам, возрастает частота случаев инфицирования язв, что приводит к увеличению количества ампутаций и увеличению затрат на лечение. Также следует учитывать, что нарушения микроциркуляции у больных сахарным диабетом снижают эффективность системных антибактериальных препаратов [Park Т.Н., Anand A. Management of diabetic foot: Brief synopsis for busy orthopedist // J. Clin. Orthop.trauma. Elsevier, 2015. Vol. 6, №1. P. 24-29].

Из 27 миллионов пациентов, подвергающихся хирургическим операциям ежегодно, как минимум у 5% наблюдается инфицирование на месте проведения хирургического вмешательства. В России послеоперационные инфекции занимают второе место в структуре внутрибольничных инфекций. Согласно официальным данным, частота внутрибольничных инфекций составляет 7,7-7,2 на 100 операций. Хирургические раневые инфекции увеличивают продолжительность госпитализации на 6-8 дней, требуют дополнительных затрат на диагностику и лечение, увеличивают заболеваемость и летальность [Кукош М.В., Колесников Д.Л., Цыбусова Т.Н., Трухалев В.А. Периоперационная антибиотикопрофилактика // Вестник экспериментальной и клинической хирургии. Воронеж, 2012. Т. 5. №2. С. 464-469; Plowman R., Graves N., Griffin M.A. The rate and cost of hospital-acquired infections occurring in patients admitted to selected specialties of a district general hospital in England and the national burden imposed. J. Hosp Infect. 2001. P. 198-209].

Уже только на основании вышеперечисленных фактов можно сделать вывод, что существует большая потребность в новых антибактериальных препаратах, способных эффективно бороться с инфекционными агентами, реализуя свое действие без неблагоприятных последствий. Отличными кандидатами на роль новых, безопасных и эффективных антибиотиков являются естественные антибактериальные пептиды - дефензины.

Дефензины представляют собой пептиды, которые синтезируются клетками, которые непосредственно контактируют с патогенными микроорганизмами. Существуют два класса дефензинов: альфа-дефензины и бета-дефензины [Wang G. Human Antimicrobial Peptides and Proteins // Pharmaceuticals. 2014. Vol. 7, №5. P. 545-594].

Альфа-дефензины экспрессируются в большей степени нейтрофилами, а также клетками Панета, NK-клетками, макрофагами/моноцитами, В-лимфоцитами и эпителиальными клетками. К альфа-дефензинам относятся HNP-1, HNP-2, HNP-3, HNP-4 (Human Neutrophils Peptide - человеческие нейтрофильные пептиды) и HD-5, HD-6 (Human Defensin - дефензин человека).

Бета-дефензины продуцируются эпителиальными клетками почек, урогенитального, респираторного, желудочно-кишечного трактов, кератиноцитами и т.д. К бета-дефензинами относят hBD-1, hBD-2, hBD-3, hBD-4, hBD-5, hBD-6 (Human Beta Defensin - человеческий бета-дефензин) [Wang G. Human Antimicrobial Peptides and Proteins // Pharmaceuticals. 2014. Vol. 7, №5. P. 545-594].

Дефензины обладают широким спектром действия на различные бактерии (как грамположительные, так и грамотрицательные) и грибы. Механизм действия дефензинов основан на порообразовании в клеточной стенке патогенов с их последующим лизисом, а также на антиметаболическом действии на микроорганизмы. Кроме того, дефензины ускоряют заживление ран и обладают иммуномодулирующим действием [Peters В.М., Shirtliff М.Е., Jabra-Rizk М.А. Antimicrobial Peptides: Primeval Molecules or Future Drugs? // PLoS Pathog. 2010. Vol. 6, №10. P. e1001067].

Наиболее близким по технической сущности к заявленному является альфа-дефензин-1 (HNP-1), обладающий бактерицидным действием в отношении большинства бактерий и грибов [Ericksen В. et al. Antibacterial Activity and Specificity of the Antibacterial Activity and Specificity of the Six Human α-Defensins // Antimicrob. Agents Chemother. 2005. Vol. 49, № 1. P. 8-15]. HNP-1 представляет собой полипептид, состоящий из 30 аминокислотных остатков. Аминокислотная последовательность: ACYCRIPACIAGERRYGTCIYQGRLWAFCC [данные из международной базы данных по антимикробным пептидам - The Antimicrobial Peptide Database - http://aps.unmc.edu/AP/database/query_output.php?ID=00176]. Механизм действия HNP-1 связан с непосредственным воздействием на мембрану микробной клетки - образование пор, утечка клеточного содержимого и последующий лизис бактерии. Считается, что специфическое разрушение микробной стенки обусловлено электростатическим притяжением положительно заряженного HNP-1 и отрицательно заряженной мембраны [Kagan B.L. et al. Antimicrobial defensin peptides form voltage-dependent ion-permeable channels in planar lipid bilayer membranes // Proc Natl Acad Sci USA. National Academy of Sciences, 1990. Vol. 87, № January. P. 210-214].

Однако применение нативных дефензинов in vivo приводит к их быстрой инактивации и, как следствие, короткому периоду действия.

Поставлена задача повышения эффективности лечения, сокращения сроков заживления инфицированных ран, ожогов, трофических язв.

Поставленная задача достигается использованием геля многонаправленного действия для лечения инфицированных ран, ожогов, трофических язв, в том числе и при синдроме диабетической стопы, содержащем ниосомы - кремнийорганические наноконтейнеры, доставляющие активные субстанции в глубокие слои кожи, способствующие снижению воспаления, улучшению микроциркуляции и уничтожению бактерий и грибов.

Способ осуществляется следующим образом.

В качестве поверхностно-активного соединения для формирования ниосом используют ПЭГ-12 диметикон. Предварительно точную навеску 50 мг, из расчета 0,05 мг HNP-1 в 1 мл фармацевтического геля, растворяют при перемешивании в воде для инъекций. В полученный раствор для формирования ниосом поэтапно добавляют 100 мл ПЭГ-12 диметикона и 400 мл воды. Начальный процесс образования ниосом и инкапсулирования в них HNP-1 проводят при комнатной температуре и интенсивном механическом встряхивании на шейкере в течение 5 минут. Стадия формирования ниосом более мелких размеров происходит при интенсивном механическом перемешивании смеси с использованием гомогенизатора APV.

Формирование ниосом с размерами 100-140 нм проводят следующим образом. Предварительно полученную дисперсию ниосом с инкапсулированным лекарственным веществом помещают в сосуд для ультразвуковой обработки. Режим озвучивания: частота - 20 кГц, мощность - 200 Вт. Для экспозиции используют временные интервалы в 15, 30 и 45 минут. В результате повышается эффективность включения HNP-1 в ниосомы. Для того, чтобы физико-химические характеристики ниосом были постоянными, используют 50 мл гелеобразователя Covacryl MV 60 в жидком виде, который образует трехмерную объемную «сетку» при добавлении 20 мл триэтаноламина. Общий объем геля доводят до 1000 мл очищенной водой.

Состав геля:

HNP-1 0.00005 г
ПЭГ 12 диметикон 100 мл
Гелеобразователь 50 мл
Триэтаноламин 20 мл
Вода очищенная до 1000,0 мл

Лечение полученным антимикробным гелем осуществляют следующим образом. Гель в количестве 2-3 см выдавливают на чистый шпатель и наносят на пораженный участок кожи. Показаниями к назначению препарата являются воспалительные, язвенно-некротические, инфекционные, ожоговые, трофические поражения кожи, в том числе при синдроме диабетической стопы, а также послеоперационные раны. Препарат быстро всасывается, а благодаря трансдермальной основе обеспечивает высокий процент доставки и длительную продолжительность действия альфа-дефензина-1. Гель наносят на пораженный участок 2 раза в сутки. Применение геля осуществляют до заживления поражения.

Примеры выполнения

Экспериментально было доказано, что полученный гель ускоряет скорость заживления инфицированных ран: для моделирования экспериментальной раны использовались лабораторные крысы Wistar, рану наносили с помощью инструментов для панч-биопсии (диаметр - 8 мм) на предварительно выбритую поверхность спины, рану инфицировали добавлением 2 мл суспензии клинических штаммов Staphylococcus aureus (стандарт мутности 0,5 по МакФарланду), площадь раны оценивали с помощью программного обеспечения Lesion Meter. Опытная группа (n=6) получала антимикробный гель по 1 мл 2 раза в сутки. Контрольная группа (n=6) получала плацебо - гель без HNP-1. Через 7 суток с момента начала лечения средняя площадь ран в опытной группе составила 0,66 квадратных сантиметров. Средняя площадь ран в контрольной группе составила 1,55 квадратных сантиметров.

Пациент К., возраст 58 лет, с диагнозом: Сахарный диабет 2 типа, синдром диабетической стопы, нейроишемическая форма, трофическая язва I пальца правой стопы. Для участия в эксперименте было получено добровольное информированное согласие. Площадь язвы при обследовании 4,7 квадратных сантиметров. В стационаре пациент системно получал стандартную терапию (противомикробные средства, сосудистые препараты) и антимикробный гель с HNP-1 - 2 раза в сутки по 2-3 см геля. После выписки продолжил использовать антимикробный гель с HNP-1 2 раза в сутки по 2-3 см. Общий курс лечения антимикробным гелем составил 30 дней. Через 17 суток после начала лечения площадь язвы уменьшилась и составила 2,8 квадратных сантиметров. Через 30 суток площадь язвы составила 1,3 квадратных сантиметров.

Пациентка З., возраст 64 года, с диагнозом: Сахарный диабет 2 типа, синдром диабетической стопы, нейроишемическая форма, трофическая язва правой пятки. Для участия в эксперименте было получено добровольное информированное согласие. Площадь язвы при обследовании 5,6 квадратных сантиметров. В стационаре пациентка системно получала стандартную терапию (противомикробные средства, сосудистые препараты) и антимикробный гель с HNP-1 - 2 раза в сутки по 2-3 см геля. После выписки продолжила использовать антимикробный гель с HNP-1 2 раза в сутки по 2-3 см. Общий курс лечения антимикробным гелем составил 30 дней. Через 20 суток после начала лечения площадь язвы уменьшилась и составила 3,8 квадратных сантиметров. Через 30 суток площадь язвы составила 2,9 квадратных сантиметров.

Предлагаемый антимикробный гель позволяет не только уничтожать патогенные бактерии в ране, но и ускорять скорость заживления ран. Ниосомы, полученные из ПЭГ-12 диметикона с включенным во внутренний объем HNP-1, представляют собой полноценные мультиламеллярные везикулы стандартного размера от 100 до 140 нм, включающие высокий процент иммобилизованных активных субстанций, стабильные при хранении. Использование кремнийорганических наноконтейнеров - ниосом позволяет доставить активные субстанции в глубокие слои кожи, снижать воспаление, улучшать микроциркуляцию, уничтожать бактерии и грибы.

Антимикробный гель для лечения инфицированных ран, ожогов и трофических язв составом:

HNP-1 0.00005 г
ПЭГ-12 диметикон 100 мл
Гелеобразователь 50 мл
Триэтаноламин 20 мл
Вода очищенная до 1000,0 мл

содержит альфа-дефензин-1 (HNP-1), инкапсулированный в ниосомы, сформированные с помощью ПЭГ-12 диметикона.



 

Похожие патенты:

Изобретение относится к области ветеринарии и представляет собой препарат для лечения пальцевого дерматита и язвы подошвы крупного рогатого скота в виде мази, состоящий из мазевой основы и действующего вещества - медного купороса, цинка оксида, отличающийся тем, что действующее вещество дополнительно содержит салициловую кислоту, морскую соль и микрочастицы серебра при следующем соотношении компонентов, мас.%: медный купорос 35-45; цинка оксид 7-9; салициловая кислота 2-2,5; морская соль 1-1,5; микрочастицы серебра 0,0001; мазевая основа - остальное.

Изобретение относится к области медицины, в частности, к технологии получения углеродных сорбентов и раскрывает способ получения углеродного сорбента, обладающего антибактериальной и антимикотической активностью.

Изобретение относится к борсодержащему соединению формулы (I) или его фармацевтически приемлемой соли или стереоизомеру: В формуле (I) L представляет собой связь, -CR1R2-, >С=O, или =CR1-; М представляет собой связь или -N(R4)-; m равно 0 или 1; n равно 0 или 1; при условии, что, когда n равно 0, то М представляет собой связь; p равно 1 или 2; X1 представляет собой -OH; Z представляет собой >С=O; СусА представляет собой циклобутан, циклопентан или циклогексан; Ra, Rb и Rc представляют собой атом водорода; каждый R1 и R2 независимо выбраны из группы, состоящей из атома водорода, C1-С6-алкила и -NR4R5, R3 представляет собой атом водорода; Rd выбран из группы, состоящей из атома водорода и C1-C6 алкила; каждый R4 и R5 независимо выбран из группы, состоящей из атома водорода, C1-С6-алкила, 3-6-членного циклоалкила, 3-6-членного гетероциклила, 5-6-членного гетероарила, C1-С6 алкил(3-6-членного циклоалкила) и C1-С6 алкил(5-6-членного гетероарила); или R4 и R5, взятые вместе, образуют 3-6-членный гетероцикл с атомом азота, к которому они присоединены; каждый R6 и R7 независимо выбраны из группы, состоящей из атома водорода, C1-С6 алкила, -ОН, -SR10, -NR4R5, -NR4C(O)OR5, -C(O)OR5 и -NR4SO2R5; каждый R10 независимо представляет собой C1-С6-алкил; и каждый Y независимо выбран из группы, состоящей из -ОН, -NR4R5, -(CR6R7)vNR4R5, -NR4(CR6R7)vNR4R5, -N(R4)C(O)(CR6R7)vNR4R5, -(CR6R7)vN(R4)C(O)(CR6R7)vNR4R5, -NR5C(O)NR4(CR6R7)vNR4R5, -N(R4)C(=NR5)R6, -(CR6R7)vN(R4)C(=NR5)NR4R5, -NR4(CR6R7)vN(R4)C(=NR5)NR4R5, -NR4C(=NR5)NR4R5, -(CR6R7)vNR4(CR6R7)vNR4R5, -NR4(CR6R7)vR6, -NR4(CR6R7)vNR4(CR6R7)vNR4R5, --(3-6-членный гетероциклил)NR4R5, -(3-6-членный гетероциклил)N(R4)C(=NR5)NR4R5, -NR4(CR6R7)v(5-6-членный гетероарил), -NR4(CR6R7)v-(3-6-членный гетероциклил), -NR4(CR6R7)vNR5-(5-6-членный гетероарил) и -NR4(CR6R7)v-(3-6-членный гетероциклил)-C(=NR5)NR4R5; и v равно 1, 2 или 3.

Изобретение относится к области медицины, а именно к фармацевтике, и предназначено для производства из растительного сырья композитных лекарственных средств комплексного антибактериального и детоксикационного действия.

Группа изобретений относится к области медицины и фармацевтической промышленности, а именно к применению катионного стероидного антимикробного (CSA) соединения или его фармацевтически приемлемой соли для ускорения заживления раны ткани или к его применению для производства медикамента для ускорения заживления раны ткани, при этом указанное CSA соединение имеет формулу (Ia) где R3, R7 и R12 независимо представляют собой незамещенный (С1-С5)-аминоалкилокси или незамещенный (C1-C5)-аминоалкилкарбоксил, а R18 является незамещенным (С1-С16)-алкиламино-(С1-С5)-алкилом, незамещенным ди(С1-С5алкил)амино-(С1-С5)-алкилом, С6-алкоксикарбонил-С4-алкилом, С8-алкоксикарбонил-С4-алкилом, незамещенным (C1-C16)-алкилкарбокси-(С1-С5)-алкилом или незамещенным С-карбокси-С4-алкилом.
Изобретение относится к медицине, а именно к инфекционным болезням, и может быть использовано для лечения стертых форм дизентерии. Для этого вводят нифуроксазид в дозе 200 мг 4 раза в день в течение 7 дней, полиоксидоний 6 мг в/м в течение 5 дней и бифиформ по 2 капсулы 3 раза в день в течение 10 дней.

Изобретение относится к фармацевтической промышленности, а именно к способу получения экстракта из коры дуба, подавляющего зоопатогенные бактерии. Способ получения экстракта из коры дуба, подавляющего зоопатогенные бактерии, включающий обработку предварительно измельченной коры дуба электрохимически активированным катодным водным раствором с рН 7-8 Eh=-300…-450 мВ, при оптимальном соотношении сырье-раствор 1:8-1:15, при постоянном перемешивании в течение не менее 600 сек, и последующую обработку подготовленной суспензии ультразвуком с частотой 22 кГц и интенсивностью ультразвукового воздействия в течение 50-70 Вт/см2 в течение 420-600 сек.

Группа изобретений относится к области фармацевтики и медицины, а именно к лекарственному препарату для внутривенного введения или водорастворимому твердому препарату, содержащим 7-диметиламинотетрациклин и катион магния при молярном соотношении катиона магния к тетрациклину более 3:1, а также к способам их приготовления, наборам для приготовления водного раствора для внутривенного введения и использованию препаратов для лечения или предотвращения бактериальной инфекции.

Группа изобретений относится к медицине, конкретно к активной биологической или фармацевтической субстанции. Субстанция характеризуется наличием: экстракта эвкалипта, бензалкония хлорида и эфирных масел эвкалипта, мяты, пихты, сосны, лаванды, чайного дерева, розмарина, кориандра, розы и полыни при следующем соотношении компонентов, мас.%: экстракт эвкалипта - 18,86-55,63, бензалкония хлорид - 18,86-44,47, эфирное эвкалиптовое масло - 3,70-22,24, эфирное масло мяты - 3,70-22,24, эфирное масло пихты - 0,1-4,42, эфирное масло сосны - 0,1-4,42, эфирное масло лаванды - 0,1-4,42, эфирное масло чайного дерева - 0,1-4,42, эфирное масло розмарина - 0,1-4,42, эфирное масло кориандра - 0,1-4,42, эфирное масло розы - 1,34-2,24, эфирное масло полыни - 1,34-2,24.

Изобретение относится к кристаллическому левоизовалерилспирамицину III формулы (I), его применению в медицине и способу его получения . (1),характеризующемуся температурой плавления 116-118°С и дифракцией рентгеновских лучей, измеренной излучением Cu-Kα с пиками при 2θ=8,0°, 10,0°, 1 1,2°, 11,7°, 16,4°, 19,1°, 19,6°, 20,0°, 21,4°, 22,9°, 23,6° и 29,4°; причем при растворении указанного соединения в хлороформе при 25°С и концентрации 0,02 г/мл угол оптического вращения [α]D составляет (-49)-(-51)°.

Изобретение относится к области ветеринарии и представляет собой препарат для лечения пальцевого дерматита и язвы подошвы крупного рогатого скота в виде мази, состоящий из мазевой основы и действующего вещества - медного купороса, цинка оксида, отличающийся тем, что действующее вещество дополнительно содержит салициловую кислоту, морскую соль и микрочастицы серебра при следующем соотношении компонентов, мас.%: медный купорос 35-45; цинка оксид 7-9; салициловая кислота 2-2,5; морская соль 1-1,5; микрочастицы серебра 0,0001; мазевая основа - остальное.

Предлагаемое изобретение относится к медицине, а именно к пластической хирургии и комбустиологии. Способ пластики полнослойным кожным аутотрансплантатом, включающий аутотрансплантацию после 17-22-го дня после травмы цельным полнослойным свободным кожным аутотрансплантатом на гранулирующую рану с предварительным иссечением на глубину 1-2 мм верхних слоев грануляций и краев раны отступя на 0,5-2,0 см.

Изобретение относится к фармацевтической промышленности и представляет собой композицию, состоящую из полигексаметиленбигуанида, очищенной воды и по меньшей мере одного полоксамера для применения в местном и/или оромукозном лечении ран.
Изобретение относится к области медицины, а именно к фармакологии, хирургии и травматологии, и предназначено для безболезненного и бескровного удаления высохших окровавленных бинтов, прилипших к ранам, а также для отбеливания раны и кожи вокруг нее.

Группа изобретений относится к области медицины и фармацевтической промышленности, а именно к применению катионного стероидного антимикробного (CSA) соединения или его фармацевтически приемлемой соли для ускорения заживления раны ткани или к его применению для производства медикамента для ускорения заживления раны ткани, при этом указанное CSA соединение имеет формулу (Ia) где R3, R7 и R12 независимо представляют собой незамещенный (С1-С5)-аминоалкилокси или незамещенный (C1-C5)-аминоалкилкарбоксил, а R18 является незамещенным (С1-С16)-алкиламино-(С1-С5)-алкилом, незамещенным ди(С1-С5алкил)амино-(С1-С5)-алкилом, С6-алкоксикарбонил-С4-алкилом, С8-алкоксикарбонил-С4-алкилом, незамещенным (C1-C16)-алкилкарбокси-(С1-С5)-алкилом или незамещенным С-карбокси-С4-алкилом.

Группа изобретений относится к медицине и касается применения лигнана, представленного формулой (I), для получения стимулятора клеточной чувствительности к CGRP. Также предложено применение лигнана для получения стимулятора кожного кровообращения, тока крови и кожного метаболизма.
Изобретение относится к медицине и касается способа обезболивания при биопсии кожи, включающего подкожное введение анестетика в очаг поражения, где перед инъекцией анестетика в шприц набирают от 1 до 2 мл адреналина, затем опорожняют шприц и набирают в него анестетик.

Изобретение относится к медицине, а именно травматологии и ортопедии, и может быть использовано для лечения незаживающих ран области ахиллова сухожилия у больных, страдающих системной склеродермией.
Изобретение относится к медицине, а именно к хирургии, и может быть использовано для местного лечения гнойных ран локальным потоком озоно-кислородной газовой смеси при сахарном диабете II типа.

Изобретение относится к области биотехнологии, конкретно к способу восстановления нормальной ткани из фиброзной ткани, что может быть использовано в медицине. Субъекту вводят эффективное количество фармацевтической композиции, содержащей (а) вещество, уменьшающее коллаген, (b) вещество для специфической доставки уменьшающего коллаген вещества к коллаген-продуцирующим клеткам фиброзной ткани и трансплантируют стволовые клетки в пространство для роста и дифференцировки стволовых клеток.

Изобретение относится к системе носителя, включающей соединение формулы I, и включает этер-липиды, конъюгированные с одним или более биоактивными лигандами, которые размещаются на поверхности системы носителя, для применения в нацеленной доставке и/или системах антигенного дисплея.

Изобретение относится к медицине и предназначено для лечения инфицированных ран, ожогов и трофических язв. Антимикробный гель для лечения инфицированных ран, ожогов и трофических язв содержит альфа-дефензин-1, ПЭГ 12 диметикон, гелеобразователь, триэтаноламин и воду очищенную. При этом HNP-1 инкапсулирован в ниосомы, сформированные с помощью ПЭГ 12 диметикона. Компоненты используются в заявленном количестве. Гель позволяет не только уничтожать патогенные бактерии в ране, но и ускорять скорость заживления ран. Использование кремнийорганических наноконтейнеров-ниосом с активными субстанциями позволяет доставить их в глубокие слои кожи, снижать воспаление, улучшать микроциркуляцию, уничтожать бактерии и грибы. 1 пр.

Наверх