5-замещенные индазолы в качестве ингибиторов киназы

Авторы патента:


5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы
5-замещенные индазолы в качестве ингибиторов киназы

 


Владельцы патента RU 2487873:

ЭББОТТ ЛЭБОРЕТРИЗ (US)
ЭББОТТ ГМБХ УНД КО. КГ (DE)

Изобретение относится к соединениям формулы (I) или их фармацевтически приемлемым солям, где A, R1 R2, R3 и m определены в формуле изобретения. Изобретение также относится к ряду конкретных соединений и фармацевтической композиции, содержащей указанные соединения, которые являются полезными для ингибирования киназ, таких как гликогенсинтаза-киназа 3 (GSK-3), Rho киназа (ROCK), Janus Киназы (JAK), AKT, PAK4, PLK, CK2, KDR, MK2, JNK1, aurora, pim 1 и nek 2. 3 н. и 15 з.п. ф-лы, 393 пр.

 

Область изобретения

Настоящее изобретение относится к 5-замещенным индазол- содержащим соединениям, способам получения таких соединений, композициям, содержащим такие соединения, которые являются полезными для ингибирования киназ, таких как гликогенсинтаза-киназа 3 (GSK-3), Rho киназа (ROCK), Janus киназы (JAK), AKT, PAK4, PLK, CK2, KDR, MK2, JNKl, aurora, pim 1 и nek 2.

Предпосылки изобретения

Протеинкиназы представляют собой класс ферментов, которые катализируют перенос фосфатной группы от АТФ к тирозиновому, сериновому, треониновому или гистидиновому остаткам, расположенным на белковом субстрате. Очевидно, что протеинкиназы играют определенную роль в нормальном клеточном росте. Многие белки рецепторов факторов роста содержат внутриклеточные домены, которые функционируют как протеинкиназы, и именно через эту функцию они осуществляют передачу сигнала. Взаимодействие факторов роста с их рецепторами является необходимым событием в нормальной регуляции клеточного роста, и состояние фосфорилирования белков субстрата часто связано с модуляцией клеточного роста.

Хорошо известно, что аномальное фосфорилирование белка может быть непосредственно связано с некоторыми болезненными состояниями или может быть фактором, способствующим началу развития таких заболеваний. Как результат, протеинкиназы являются целями, на которые направлены новые фармацевтические исследования (Cohen, P. Nature Reviews Drug Discovery, 1:309-315, 2002). Различные ингибиторы протеинкиназы имеют клиническое применение для лечения широкого ряда различных заболеваний, таких как рак, хронические воспалительные заболевания, диабет и удар.

Протеинкиназы представляют собой большое и разнообразное семейство ферментов, которые катализируют фосфорилирование белка и играют ключевую роль в клеточной передаче сигнала. Протеинкиназы могут проявлять положительное или отрицательное регуляторное действие, в зависимости от их белков-мишеней. Протеинкиназы участвуют в специфических сигнальных путях, которые регулируют клеточные функции, такие как, но не ограничиваясь этим, метаболизм, развитие клеточного цикла, клеточную адгезию, функцию сосудов, апоптоз и ангиогенез. Как результат, нарушение клеточной сигнальной активности связывают со многими заболеваниями, наиболее характерные из которых включают рак и диабет. Регуляция сигнальной трансдукции цитокинами и связь сигнальных молекул с прото-онкогенами и опухоль-супрессорными генами были в достаточной степени документально подтверждены. Подобным образом, связь между диабетом, вирусными инфекциями и связанными с этим состояниями также относят за счет регуляции протеинкиназ.

Поскольку протеинкиназы регулируют почти каждый клеточный процесс, включая метаболизм, клеточную пролиферацию, клеточную дифференциацию и клеточное выживание, они являются привлекательными мишенями для терапевтического вмешательства при различных болезненных состояниях. Например, контроль клеточного цикла и ангиогенез, где протеинкиназы играют важную роль, представляют собой клеточные процессы, связанные с различными болезненными состояниями, такими как, но не ограничиваясь этим, рак, воспалительные заболевания, аномальный ангиогенез и связанные с этим заболевания, атеросклероз, дегенерация желтого пятна, диабет, ожирение и боль.

Выяснение запутанных путей протеинкиназ и сложности взаимосвязей и взаимодействия между различными протеинкиназами и киназными путями подчеркивает важность разработки фармацевтических средств, способных действовать как модуляторы, регуляторы или ингибиторы протеинкиназ, обладающие благоприятной активностью на различные киназы или различные киназные пути.

Поэтому предполагается, что из-за сложности внутриклеточных сигнальных каскадов протеинкиназных путей, средства, которые влияют на различные пути одновременно, могут быть необходимыми для существенной клинической активности. Хотя считается, что отдельно взятое средство, которое обеспечивает комбинированные эффекты, является привлекательным, существует необходимость в идентификации и применении отдельных средств, которые прицельно действуют на нужные комбинации и различные пути, которые являются клинически эффективными в условиях конкретного заболевания.

Гликогенсинтаза-киназа-3 (GSK-3) представляет собой сериновую/треониновую киназу, кодируемую двумя изоформами, GSK-3α и GSK-3β, с молекулярной массой 51 и 47 кДа, соответственно. Они имеют 97% сходства последовательностей в их киназных каталитических доменах. GSK-3α изоформа имеет вытянутый глицин-обогащенный N-концевой хвост. Был идентифицирован минорный вариант сплайсинга GSK-3β (экспрессируемый на уровне ~15% от общего количества) с вставкой из 13 аминокислот в киназном домене. Этот вариант имел пониженную активность в отношении tau. GSK-3 сохранилась во многих видах в процессе эволюции, и до сих пор присутствует у всех млекопитающих с высокой гомологией в киназном домене. Обе изоформы экспрессируются во многих тканях млекопитающих, включая головной мозг. Фармакологические ингибиторы GSK-3 не могут селективно ингибировать одну из изоформ.

GSK-3β играет важную роль в контроле метаболизма, дифференциации и выживания. Первоначально она была идентифицирована как фермент, способный фосфорилировать и, следовательно, ингибировать гликогенсинтазу. В последствии, было установлено, что GSK-3β является идентичной tau протеинкиназе 1 (TPK1), ферменту, который фосфорилирует tau белок в эпитопах, которые, как было обнаружено, также гиперфосфорилируются при болезни Альцгеймера и некоторых таупатиях.

Интересно, что фосфорилирование GSK-3β протеинкиназой B (AKT) приводит к потере киназной активности, и было сделано предположение, что это ингибирование может опосредовать некоторые эффекты нейротрофических факторов. Более того, фосфорилирование β-катенина (белка, участвующего в клеточном выживании), осуществляемое GSK-3β, приводит к его разрушению зависимым от убихитинилирования протеасомальным путем.

Поэтому оказалось, что ингибирование GSK-3β активности может привести к нейротрофической активности. Существуют доказательства, что литий, неконкурентный ингибитор GSK-3β, усиливает нейритогенез в некоторых моделях и может также повышать выживание нервных клеток через индукцию факторов выживания, таких как Bcl-2, и ингибирование экспрессии проапоптических факторов, таких как P53 и Bax.

Дальнейшие исследования показали, что β-амилоид повышает активность GSK-3β и фосфорилирование белка tau. Более того, это гиперфосфорилирование, а также нейротоксические эффекты β-амилоида блокируются хлоридом лития и антисмысловой мРНК GSK-3β. Взятые вместе, эти наблюдения говорят о том, что GSK-3β может быть звеном между двумя основными патологическим процессами при болезни Альцгеймера: аномальный процессинг APP (амилоидный белок-предшественник) и гиперфосфорилирование белка tau.

Эти экспериментальные наблюдения показывают, что GSK-3β может найти применение в профилактике и лечении нейропатологических последствий и дефицита познавательной способности и внимания, связанных с болезнью Альцгеймера, а также других острых и хронических нейродегенеративных заболеваний. Они включают, но не ограничиваются этим: болезнь Паркинсона, таупатии (например, лобно-височно-теменная деменция, кортикобазальная дегенерация, болезнь Пика, прогрессирующий супрануклеарный паралич) и другие деменции, включая сосудистую деменцию; острый удар и другие травматические поражения; цереброваскулярные расстройства (например, возрастная дегенерация желтого пятна); травму головного и спинного мозга; периферические невропатии; ретинопатии и глаукому.

GSK-3β также может найти применение для лечения других заболеваний, таких как: инсулин-независимый диабет и ожирение; маниакально-депрессивное заболевание; шизофрения; алопеция; воспаления; раковые заболевания, такие как рак молочной железы, немелкоклеточная карцинома легкого, рак щитовидной железы, T или B-клеточный лейкоз и некоторые вирус-индуцированные опухоли.

Rho киназы (ROCK), первые Rho эффекторы, которые были описаны, представляют собой сериновые/треониновые киназы, которые играют важную роль в фундаментальных процессах клеточной миграции, клеточной пролиферации и клеточного выживания. Аномальную активацию Rho/ROCK пути наблюдали при различных расстройствах. Примеры болезненных состояний, где соединения по настоящему изобретению имеют потенциально полезные терапевтические эффекты, благодаря их анти-вазоспазматической активности, включают сердечно-сосудистые заболевания, такие как гипертензия, хроническая и застойная сердечная недостаточность, сердечная гипертрофия, рестеноз, хроническая почечная недостаточность, спазм сосудов головного мозга после субарахноидального кровоизлияния, легочная гипертензия и атеросклероз. Свойство мышечной релаксации также является полезным для лечения астмы, мужских эректильных дисфункций, женских сексуальных дисфункций и синдрома гиперреактивного мочевого пузыря. Повреждение головного и спинного мозга у взрослого позвоночного животного активирует ROCK, ингибируя посредством этого рост и распространение невритов. Ингибирование ROCK приводит к индукции роста новых аксонов, распространению аксонов через поражения в ЦНС, ускоренной регенерации и усиленному функциональному восстановлению после острого нейронного поражения у млекопитающих (повреждение спинного мозга, травматическое повреждение головного мозга). Также было подтверждено, что ингибирование Rho/ROCK пути является эффективным в других животных моделях нейродегенерации, например, удара, воспалительных и демиелинизирующих заболеваний, болезни Альцгеймера, а также для лечения боли. Ингибиторы Rho/ROCK пути поэтому обладают потенциалом для профилактики нейродегенерации и стимуляции нейрорегенерации при различных неврологических расстройствах, включая повреждение спинного мозга, болезнь Альцгеймера, удар, рассеянный склероз, амиотрофический боковой склероз, а также для лечения боли. Было показано, что ингибиторы ROCK обладают противовоспалительными свойствами. Таким образом, соединения по настоящему изобретению можно использовать для лечения нейровоспалительных заболеваний, таких как удар, рассеянный склероз, болезнь Альцгеймера, болезнь Гентингтона, болезнь Паркинсона, амиотрофический боковой склероз и воспалительная боль, а также других воспалительных заболеваний, таких как ревматоидный артрит, остеоартрит, астма, синдром раздраженного кишечника, болезнь Крона, псориаз, язвенный колит, обыкновенная волчанка и воспалительное заболевание кишечника. Поскольку ингибиторы ROCK уменьшают клеточную пролиферацию и клеточную миграцию, они могли бы быть полезными для лечения рака и метастазов опухоли. Более того, если свидетельства, говорящие о том, что ингибиторы ROCK подавляют цитоскелетную реаранжировку при вирусной инвазии, таким образом, они также имеют потенциальную терапевтическую ценность для применения в качестве противовирусных и антибактериальных средств. Ингибиторы ROCK также являются полезными для лечения резистентности к инсулину и диабета. Кроме того, было показано, что ингибиторы ROCK уменьшают прогрессирование кистозного фиброза (Abstract S02.3, 8th World Congress on Inflammation, Copenhagen, Denmark, June 16-20, 2007).

Кроме того, было показано, что Rho-ассоциированные закрученные в спираль-образующие спираль протеинкиназы (ROCK)-1 и -2 усиливают фосфорилирование легкой цепи миозина (MLC) путем ингибирования MLC фосфатазы, а также фосфорилирования MLC. Это приводит к регулированию сокращения актина-миозина. Последние сообщения показали, что ингибирование ROCK приводит к прерыванию воспалительного клеточного хемотаксиса, а также ингибированию сокращения гладких мышц в моделях легочного воспаления, связанного с астмой. Поэтому ингибиторы Rho/ROCK пути должны быть полезными для лечения астмы.

Киназы Janus (JAK) представляют собой важное семейство внутриклеточных тирозиновых протеинкиназ (PTK) с 4 членами, присутствующими у млекопитающих, JAK1, JAK2, JAK3 и TYK2, также гомологами у цыпленка, рыб и Drosophila. JAK играют критическую роль в некоторых важных внутриклеточных сигнальных путях, включая основной путь JAK/STAT, центральный для опосредования передачи сигнала цитокинов. Именно эта центральная роль в передаче сигнала цитокинов подкрепляет мнение, что специфические ингибиторы JAK могут найти широкое терапевтическое применение в ситуациях, где активность цитокинов приводит к заболеванию. Важные примеры включают аутоиммунные заболевания, такие как ревматоидный артрит и псориаз, миелопролиферативные синдромы, такие как, лейкозы, лимфомы и сердечно-сосудистые заболевания.

JAK2, член семейства киназ Janus (JAK) тирозиновых протеикиназ (PTK), является важным внутриклеточным медиатором передачи сигнала цитокинов. Мутации JAK2 гена связаны с гематологическими раковыми заболеваниями, и аберрантная JAK активность также связана с различными иммунными заболеваниями, включая ревматоидный артрит.

Киназы Aurora представляют собой семейство мультигенных митотических сериновых-треониновых киназ, которые действуют как класс новых онкогенов. Эти киназы включают в качестве членов aurora-A, aurora-B и aurora-B. Они гиперактивируются и/или сверх-экспрессируются в некоторых солидных опухолях, включая, но, не ограничиваясь этим, рак молочной железы, яичников, предстательной железы, поджелудочной железы и колоректальный рак. В частности, aurora-A представляет собой центросомальную киназу, и ее локализация зависит от клеточного цикла и играет важную роль в развитии клеточного цикла и клеточной пролиферации. Aurora-A расположена в области 20ql3 хромосомы, которая часто амплифицируется в некоторых различных типах злокачественных опухолей, таких как колоректальный рак, рак молочной железы и мочевого пузыря. Ингибирование aurora киназной активности может помочь в уменьшении клеточной пролиферации, роста опухоли и потенциально онкогенеза.

Следовательно, остается потребность в разработке способов, включающих применение лекарственного средства на основе одного активного вещества, способного прицельно действовать на несколько специфических типов киназ или киназных путей. В частности, такие способы воздействуют на нужную комбинацию нескольких мишеней с достижением, таким образом, клинической эффективности.

Краткое описание изобретения

В основном варианте воплощения, настоящее изобретение обеспечивает соединения формулы (I)

или их фармацевтически приемлемые соли, где

A представляет собой

R1 представляет собой водород, алкил, арил, гетероцикл, гетероарил, RaRbN-, RcRdN-C(O)- или RcRdN-S(O)2-;

R2 представляет собой водород, алкоксикарбонил, алкил, алкилкарбонил, арилкарбонил, гетероциклкарбонил или ReRfN-алкил-C(O)-;

R3 представляет собой алкил, алкокси, арил, циано, циклоалкил, галоген, галогеналкил, гетероарил, нитро или RgRhN-;

R4 представляет собой алкил, алкоксиалкил, арил, циклоалкил, гетероарил, гетероцикл, гетероциклалкил, RjRkN- или RjRkN-алкил-;

R5 представляет собой алкил, арил или гетероарил;

R6 представляет собой алкил, алкоксиалкил, RjRkN-алкил-, арил, циклоалкил или гетероарил;

R7 представляет собой алкил, арил или гетероарил;

Ra и Rb, каждый независимо, представляют собой водород, алкил, арилалкил, циклоалкил, циклоалкилалкил, гетероарилалкил, R4-C(O)- или R5-S(O)2-;

Rc и Rd, каждый независимо, представляют собой водород, алкил или гетероарил;

Re и Rf, каждый независимо, представляют собой водород, алкил, арилалкил, гетероарилалкил, R6-C(O)- или R7-S(O)2-;

Rg и Rh, каждый независимо, представляют собой водород, алкил или алкилкарбонил;

Rj и Rk, каждый независимо, представляют собой водород, алкил, арил, арилалкил, циклоалкил, гетероарил или гетероцикл;

Ri, Rii, Riii, Riv, Rv, Rvi, Rvii, Rviii, Rix, Rx, Rxi, Rxii, Rxiii, Rxiv, Rxv, Rxvi, Rxvii, Rxviii, Rxix, Rxx, Rxxi, Rxxii и Rxxiii, каждый независимо, представляют собой алкил, алкокси, алкоксиалкил, алкоксикарбонил, алкоксикарбонилалкил, арил, арилалкил, арил(гидрокси)алкил, арилоксиалкил, арилкарбонил, арилтиоалкил, карбокси, карбоксиалкил, цианоалкил, циклоалкил, циклоалкилалкил, циклоалкилкарбонил, галоген, гетероарил, гетероарилалкил, гетероцикл, гетероциклалкил, гетероциклкарбонил, гидроксиалкил, триалкилсилилалкил, H2NC(O)-алкил, ZaZbN-, ZaZbNалкил, ZcZdNC(O)- или ZcZdNS(O)2-, где RXiV, Rxv, RXVi и RXVii могут присутствовать по любой открытой валентности в соединениях (xiv), (xv), (xvi) или (xvii);

Za и Zb, каждый независимо, представляют собой водород, алкил, алкоксикарбонилалкил, арил, арилалкил, циклоалкил, H2NC(O)-, H2NалкилC(O)-, H2NC(O)-алкил, диалкилNC(O)- или диалкилNC(O)-алкил-;

Zc и Zd, каждый независимо, представляют собой водород, алкил, алкоксиалкил, арил, арилалкил, арил(гидрокси)алкил, циклоалкил, циклоалкилалкил, гетероарилалкил, гетероцикл, гетероциклалкил, гидроксиалкил, H2NC(O)-алкил-, диалкилNC(O)-алкил-, диалкилN-алкил- или CHZeZf;

Ze представляет собой арил или гетероарил;

Zf представляет собой гетероарилалкил, гетероциклалкил или Z1Z2N-алкил-;

m имеет значение 0, 1 или 2;

a имеет значение 0 или 1;

b имеет значение 0, 1 или 2;

c имеет значение 0, 1, 2 или 3; и

d имеет значение 0, 1, 2, 3 или 4.

Также обеспечиваются фармацевтически приемлемые композиции, включающие терапевтически эффективное количество соединения формулы (I) в сочетании с фармацевтически приемлемым носителем.

Целью настоящего изобретения является обеспечение соединений, которые являются полезными для профилактики или лечения заболеваний, вызванных аномальной активностью протеинкиназы. Кроме того, изобретение также обеспечивает фармацевтически эффективные композиции соединений по настоящему изобретению, которые являются полезными для профилактики или лечения указанных заболеваний.

Настоящее изобретение также относится к фармацевтической композиции, которая включает, по меньшей мере, одно 5-замещенное индазольное соединение формулы (I), которое может существовать в виде его фармацевтически приемлемой соли или пролекарства, в присутствии или в отсутствие фармацевтически приемлемых носителей, драже, адъювантов или других вспомогательных веществ.

Соединения по настоящему изобретению обладают ингибируещей активностью в отношении GSK-3, ROCK-1, ROCK-2, JAK2, а также других киназ и являются полезными для ингибирования таких киназ. Некоторые соединения по настоящему изобретению являются селективными в отношении одной или нескольких киназ и могут быть полезными для селективного ингибирования таких киназ. Следовательно, соединения по настоящему изобретению являются полезными в качестве активного ингредиента для получения композиции, которая обеспечивает возможность профилактического и/или терапевтического лечения заболевания, вызванного аномальной активностью GSK-3, и, более конкретно, нейродегенеративных заболеваний, таких как болезнь Альцгеймера. Кроме того, соединения по настоящему изобретению также являются полезными в качестве активного ингредиента для получения композиции для профилактического и/или терапевтического лечения нейродегенеративных заболеваний, таких как болезнь Паркинсона, таупатии (например, лобно-височно-теменная деменция, кортикобазальная дегенерация, болезнь Пика, прогрессирующей супрануклеарный паралич) и других деменций, включая сосудистую деменцию; острый удар и другие травматические поражения; цереброваскулярные расстройства (например, возрастная дегенерация желтого пятна); травма головного и спинного мозга; периферические невропатии; ретинопатия и глаукома; и других заболеваний, таких как инсулин-независимый диабет (такой как диабет типа II) и ожирение; маниакально-депрессивное заболевание; шизофрения; алопеция; раковые заболевания, такие как рак молочной железы, немелкоклеточная карцинома легкого, рак щитовидной железы, T или B-клеточный лейкоз и некоторые вирус-индуцированные опухоли.

Подробное описание изобретения

Соединения по настоящему изобретению имеют формулу (I), описанную выше. Более конкретно, соединения формулы (I) могут включать, но не ограничиваются этим, соединения, где A представляет собой (ii), (iii), (iv), (vii), (x), (xiv), (xv), (xvi), (xvii), (xviii), (xix), (xx), (xxi), (xxii) или (xxiii).

В другом варианте воплощения настоящего изобретения раскрывается соединение формулы (I), где A представляет собой (ii),

R1 представляет собой водород, арил, гетероарил, гетероцикл, RaRbN- или RcRdN-C(O)-; R2 представляет собой водород, алкоксикарбонил, гетероциклкарбонил, алкилкарбонил или ReRfN-алкил-C(O)-; R4 представляет собой алкил, алкоксиалкил, арил, циклоалкил, гетероцикл, гетероциклалкил, RjRkN- или RjRkN-алкил-; R5 представляет собой алкил, арил или гетероарил; Ra и Rb, каждый независимо, представляют собой водород, арилалкил, циклоалкилалкил, R4-C(О)- или R5-S(O)2-; Rc и Rd, каждый независимо, представляют собой водород или гетероарил, Re и Rf, каждый независимо, представляют собой водород или алкил, Rj и Rk, каждый независимо, представляют собой водород, алкил, арил, циклоалкил или гетероцикл; Rii представляет собой алкил, алкоксиалкил, алкоксикарбонил, арил, арилалкил, арил(гидрокси)алкил, арилоксиалкил, арилкарбонил, алкоксикарбонилалкил, арилтиоалкил, карбокси, карбоксиалкил, циклоалкил, циклоалкилалкил, циклоалкилкарбонил, галоген, гетероарил, гетероарилалкил, гетероцикл, гетероциклалкил, гетероциклкарбонил, гидроксиалкил, триалкилсилилалкил, ZaZbN-, ZaZbNалкил- или ZcZdNC(О)-; Za и Zb, каждый независимо, представляют собой водород, алкил или H2NалкилC(O)-; Zc и Zd, каждый независимо, представляют собой водород, алкил, алкоксиалкил, арил, арилалкил, циклоалкил, циклоалкилалкил, гетероарилалкил, гетероциклалкил, гидроксиалкил или диалкилN-алкил-; m имеет значение 0; и b имеет значение 0, 1 или 2.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (iii),

R1 представляет собой водород или RaRbN-; R2 представляет собой водород; R4 представляет собой RjRkN-алкил-; Ra и Rb, каждый независимо, представляют собой водород или R4-C(O)-; Rj и Rk, каждый, представляют собой алкил; Riii представляет собой алкоксикарбонилалкил, алкил, арилалкил, цианоалкил, гетероциклалкил или H2NC(O)-алкил-; c имеет значение 0, 1 или 2; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (iv),

R1 представляет собой водород или R3RbN-; R2 представляет собой водород; R3 и Rb, каждый, представляют собой водород; RiV представляет собой арил, арилалкил, гетероцикл, гетероциклалкил, ZaZbNалкил или ZcZdNS(O)2-; Za и Zb, каждый независимо, представляют собой водород или алкил; Zc и Zd, каждый, представляют собой алкил; c имеет значение 0, 1 или 2; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (vii),

R1 представляет собой водород, алкил или RaRbN; R2 представляет собой водород; Ra и Rb, каждый, представляют собой водород; RVii представляет собой алкил, алкоксикарбонил, арил, арилалкил, циклоалкил, гетероциклалкил, гетероциклкарбонил, гидроксиалкил или ZcZdNC(O)-; Zc и Zd, каждый независимо, представляют собой водород, алкил, алкоксиалкил, арил, арилалкил, арил(гидрокси)алкил, циклоалкил, циклоалкилалкил, гетероарилалкил, гетероцикл, гетероциклалкил, гидроксиалкил или CHZeZf, Ze представляет собой арил или гетероарил, Zf представляет собой гетероарилалкил, гетероциклалкил или Z1Z2N-алкил-; b имеет значение 1; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (x),

R1 представляет собой водород; R2 представляет собой водород; Rx представляет собой алкил, арил или ZaZbN-; Za и Zb, каждый независимо, представляют собой водород, алкил, арил или арилалкил; b имеет значение 1 или 2; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xiv),

R1 представляет собой водород; R2 представляет собой водород; RXiV представляет собой ZaZbN-; Za и Zb, каждый независимо, представляют собой водород или циклоалкил; c имеет значение 1; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xv),

(xv)

R1 представляет собой водород или R3RbN-; R2 представляет собой водород; R3 и Rb, каждый, представляют собой водород; Rxv представляет собой ZaZbN-; Za и Zb, каждый независимо, представляют собой водород, алкоксикарбонилалкил, арил, арилалкил или циклоалкил; d имеет значение 0 или 1; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xvi)

R1 представляет собой водород; R2 представляет собой водород; RXVi представляет собой ZaZbN-; Za и Zb, каждый независимо, представляют собой водород или циклоалкил; d имеет значение 1; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xvii)

R1 представляет собой водород; R2 представляет собой водород; RXVii представляет собой арил или ZaZbN-; Za и Zb, каждый независимо, представляют собой водород, алкил, алкоксикарбонилалкил, арил, арилалкил, циклоалкил или H2NC(O)-алкил-; d имеет значение 0 или 1; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xviii)

R1 представляет собой RaRbN-; R2 представляет собой водород; Ra и Rb, каждый, представляют собой водород; c имеет значение 0; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xix)

R1 представляет собой RaRbN-; R2 представляет собой водород; Ra и Rb, каждый независимо, представляют собой водород; c имеет значение 0; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xx)

R1 представляет собой RaRbN-; R2 представляет собой водород; R4 представляет собой RjRkN-алкил-; Ra и Rb, каждый, представляют собой водород или R4-C(O)-; Rj и Rk независимо представляют собой алкил; Rxx представляет собой ZaZbN- или гетероцикл; Za и Zb независимо представляют собой водород или алкил; c имеет значение 0 или 1; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xxi)

R1 представляет собой RaRbN-; R2 представляет собой водород; Ra и Rb, каждый, представляют собой водород; RXXi представляет собой алкокси; d имеет значение 1; и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xxii)

R1 представляет собой RaRbN-; R2 представляет собой водород; R4 представляет собой RjRkN-алкил-; Ra и Rb, каждый независимо, представляют собой водород или R4-C(O)-; Rj и Rk, каждый, представляют собой алкил; c имеет значение 0 и m имеет значение 0.

В другом варианте воплощения настоящего изобретения, раскрывается соединение формулы (I), где A представляет собой (xxiii)

R1 представляет собой RaRbN-; R2 представляет собой водород; Ra и Rb, каждый, представляют собой водород; c имеет значение 0; и m имеет значение 0.

Конкретные варианты воплощения, рассматриваемые как часть настоящего изобретения, включают, но не ограничиваются этим, соединения формулы (I), например:

5-(1-бензил-1H-1,2,3-триазол-5-ил)-1H-индазольное соединение с 5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазолом;

5-(1H-1,2,3-триазол-5-ил)-1H-индазол;

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол;

5-[1-(2-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(3-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(4-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(3-метоксибензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(2-фторбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(3-фторбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(4-фторбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(2-хлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(3-хлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(4-хлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(2-бромбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(2-нитробензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(3-нитробензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(4-нитробензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

2-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил}бензонитрил;

3-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил}бензонитрил;

4-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил}бензонитрил;

5-{1-[2-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

5-{1-[3-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

5-{1-[4-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

5-{1-[3-(трифторметокси)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

5-{1-[4-(трифторметокси)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

5-[1-(4-трет-бутилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

метил 3-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил} бензоат;

метил 4-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил}бензоат;

5-[1-(2,4-диметилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(3,5-диметилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(2,3-дихлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(2,4-дихлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(2,5-дихлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-(3,5-дихлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-{1-[2,4-бис(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

N-циклогексил-6-(1H-индазол-5-ил)имидазо[2,1-b][1,3]тиазол-5-амин;

N-циклогексил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиридин-3-амин;

N-циклогексил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиразин-3-амин;

5-[1-бензил-4-(4-фторфенил)-1H-индазол-5-ил]-1H-индазол;

N-{3-[4-(4-фторфенил)-5-(1H-индазол-5-ил)-1H-индазол-1-ил]пропил}-N,N-диметиламин;

N-циклогексил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-амин;

5-[4-(4-фторфенил)-1-(1-фенилэтил)-1H-индазол-5-ил]-1H-индазол;

2-(1H-индазол-5-ил)-N-изопропилимидазо[1,2-a]пиримидин-3-амин;

4-(1H-индазол-5-ил)-N-фенил-1,3-тиазол-2-амин;

5-(2-метил-1,3-тиазол-4-ил)-1H-индазол;

N-этил-4-(1H-индазол-5-ил)-1,3-тиазол-2-амин;

N-бензил-4-(1H-индазол-5-ил)-1,3-тиазол-2-амин;

4-(1H-индазол-5-ил)-1,3-тиазол-2-амин;

4-(1H-индазол-5-ил)-N-(2-фенилэтил)-1,3-тиазол-2-амин;

N-бензил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-амин;

N-бутил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-амин;

N-(4-хлорфенил)-2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-амин;

2-(1H-индазол-5-ил)-N-(4-метоксифенил)имидазо[1,2-a]пиримидин-3-амин;

2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин;

метил N-[2-(1H-индазол-5-ил)имидазо[1,2-a]пиридин-3-ил]глицинат;

N-бензил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиридин-3-амин;

N-(4-хлорфенил)-2-(1H-индазол-5-ил)имидазо[1,2-a]пиридин-3-амин;

2-(1H-индазол-5-ил)-N-(4-метоксифенил)имидазо[1,2-a]пиридин-3-амин;

трет-бутил 4-[4-(4-фторфенил)-5-(1H-индазол-5-ил)-1H-индазол-1-ил}пиперидин-1-карбоксилат;

3,5-бис(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол;

5-(1-бензил-1H-1,2,3-триазол-4-ил)-3-фенил-1H-индазол;

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин;

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1-[(1-метилпиперидин-4-ил)карбонил]-1H-индазол-3-амин;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-метоксиацетамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид;

Ν-[5-(1-бензил-lΗ-1,2,3-триазол-4-ил)-lΗ-индазол-3-ил]бутанамид;

5-[4-(4-фторфенил)-1-пиперидин-4-ил-1H-индазол-5-ил]-1H-индазол;

5-{4-(4-фторфенил)-1-[2-(1-метилпирролидин-2-ил)этил]-1H-индазол-5-ил}-1H-индазол;

5-{4-(4-фторфенил)-1-[3-(4-метилпиперазин-1-ил)пропил]-1H-индазол-5-ил}-1H-индазол;

этил 5-(1H-индазол-5-ил)изоксазол-3-карбоксилат;

5-(1H-индазол-5-ил)-N-метилизоксазол-3-карбоксамид;

5-(3-бензилизоксазол-5-ил)-1H-индазол;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид;

5-(3-пропилизоксазол-5-ил)-1H-индазол;

N-бензил-4-(1H-индазол-5-ил)-5-фенил-1,3-тиазол-2-амин;

4-(1H-индазол-5-ил)-N,5-дифенил-1,3-тиазол-2-амин;

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол;

5-(1-бензил-4-циклопропил-1H-1,2,3-триазол-5-ил)-1H-индазол;

2-(1H-индазол-5-ил)-3-фенилимидазо[1,2-a]пиримидин;

5-[1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[3-(пиперидин-1-илкарбонил)изоксазол-5-ил]-1H-индазол;

5-(1H-индазол-5-ил)-N-фенилизоксазол-3-карбоксамид;

N-циклогексил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-[3-(пиперидин-1-илметил)изоксазол-5-ил]-1H-индазол;

[5-(1H-индазол-5-ил)изоксазол-3-ил]метанол;

5-(1H-индазол-5-ил)-N-(2-метоксиэтил)изоксазол-3-карбоксамид;

5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол;

5-(4-бензил-1H-1,2,3-триазол-1-ил)-1H-индазол;

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин;

5-(1-бензил-4-циклопропил-1H-1,2,3-триазол-5-ил)-1H-индазол-3-амин;

5-(3-изобутилизоксазол-5-ил)-1H-индазол-3-амин;

5-(3-бензилизоксазол-5-ил)-1H-индазол-3-амин;

N-{2-[4-(4-фторфенил)-5-(1H-индазол-5-ил)-1H-имидазол-1-ил]этил}-N,N-диметиламин;

5-[4-(4-фторфенил)-1-(3-морфолин-4-илпропил)-1H-индазол-5-ил]-1H-индазол;

5-[4-(4-фторфенил)-1-(3-пирролидин-1-илпропил)-1H-индазол-5-ил]-1H-индазол;

5-{4-(4-фторфенил)-1-[2-(4-метилпиперидин-1-ил)этил]-1H-имидазол-5-ил}-1H-индазол;

5-[1-(1-бензилпиперидин-4-ил)-4-(4-фторфенил)-1H-имидазол-5-ил]-1H-индазол;

5-[4-(4-фторфенил)-1-(2-морфолин-4-илэтил)-1H-имидазол-5-ил]-1H-индазол;

5-[1-(1-бензилпирролидин-3-ил)-4-(4-фторфенил)-1H-имидазол-5-ил]-1H-индазол;

2-{4-[4-(4-фторфенил)-5-(1H-индазол-5-ил)-1H-имидазол-1-ил]пиперидин-1-ил}-2-оксоэтанол;

5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин;

2-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]пропан-2-ол;

5-[4-(метоксиметил)-1H-1,2,3-триазол-1-ил]-1H-индазол;

1-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]-1-фенилэтанол;

5-(4-пропил-1H-1,2,3-триазол-1-ил)-1H-индазол;

1-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]пропан-2-ол;

3-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]пропан-1-ол;

1-{[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]метил}-1H-1,2,3-бензотриазол;

5-{4-[(фенилтио)метил]-1H-1,2,3-триазол-1-ил}-1H-индазол;

5-(4-циклопропил-1H-1,2,3-триазол-1-ил)-1H-индазол;

5-[4-(2-фенилэтил)-1H-1,2,3-триазол-1-ил]-1H-индазол;

5-[4-(циклогексилметил)-1H-1,2,3-триазол-1-ил]-1H-индазол;

5-(4-циклопентил-1H-1,2,3-триазол-1-ил)-1H-индазол;

1-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]циклогексанол;

5-[4-(феноксиметил)-1H-1,2,3-триазол-1-ил]-1H-индазол;

5-{4-[(1,1-диоксидотиоморфолин-4-ил)метил]-1H-1,2,3-триазол-1-ил}-1H-индазол;

5-[4-(3-фенилпропил)-1H-1,2,3-триазол-1-ил]-1H-индазол;

[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил](фенил)метанон;

N,N-диэтил-N-{[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]метил}амин;

этил N-[2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-ил]-бета-аланинат;

5-(1-бензил-5-метил-1H-1,2,3-триазол-4-ил)-1H-индазол;

5-(1-бензил-5-метил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин;

N3-[2-(1H-индазол-5-ил)имидазо[1,2-α]пиримидин-3-ил]-β-аланинамид;

5-(1-бензил-5-иод-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин;

N-{3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенил}-N'-(3-метилфенил)мочевина;

5-(1H-индазол-5-ил)-N-(2-изопропоксиэтил)изоксазол-3-карбоксамид;

5-[3-(морфолин-4-илкарбонил)изоксазол-5-ил]-1H-индазол;

5-(1H-индазол-5-ил)-N-(3-морфолин-4-илпропил)изоксазол-3-карбоксамид;

N-[2-(1H-индазол-4-ил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

(3R)-1-{[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил}пиперидин-3-ол;

1-{[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил}пиперидин-3-карбоксамид;

2-[2-(4-{[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил}пиперазин-1-ил)этокси]этанол;

5-{3-[(4-метил-1,4-диазепан-1-ил)карбонил]изоксазол-5-ил}-1H-индазол;

N-(3-гидроксипропил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[(1R)-2-гидрокси-1-фенилэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[3-(1H-индазол-1-ил)пропил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[3-(2-оксопирролидин-1-ил)пропил]изоксазол-3-карбоксамид;

N-{2-[4-(аминосульфонил)фенил]этил}-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил](3-хлорфенил)метанон;

[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил](циклопропил)метанон;

5-[5-циклопропил-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

N1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]метил}глицинамид;

(4-фторфенил)[4-(lΗ-индазол-5-ил)-1-(тетрагидро-2Η-пиран-4-илметил)-lΗ-1,2,3-триазол-5-ил]метанон;

(4-хлорфенил)[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил]метанон;

(3-хлорфенил)[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил]метанон;

(2-хлорфенил) [4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил}метанон;

циклопентил[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил}метанон;

1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоновую кислоту;

5-{5-(4-фторфенил)-1-[4-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин;

5-[1-бензил-5-(4-фторфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин;

[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил](тетрагидро-2H-пиран-4-ил)метанон;

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-{1-бензил-5-[(4-метилпиперазин-1-ил)карбонил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]карбонил}пиперидин-4-ол;

1-ацетил-5-[5-(4-фторфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

1-бензил-4-(1H-индазол-5-ил)-N,N-диметил-1H-1,2,3-триазол-5-карбоксамид;

N,1-дибензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

N-(2-гидрокси-2-фенилэтил)-5-(1H-индазол-5-ил)-N-метилизоксазол-3-карбоксамид;

N-[(1S)-2-гидрокси-1-фенилэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-бензил-N-(2-гидроксиэтил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-3-метил-1H-индазол;

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин;

2-{2-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]этил}-1H-изоиндол-1,3(2H)-дион;

5-{4-[(2,4-дихлорфенокси)метил]-1H-1,2,3-триазол-1-ил}-1H-индазол;

5-{4-[(2,6-дихлорфенокси)метил]-1H-1,2,3-триазол-1-ил}-1H-индазол;

5-[5-(4-фторфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

1-{[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]метил}-1H-индазол;

5-[1-бензил-5-(пиперидин-1-илкарбонил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[5-(2-метилфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[5-(2-метилфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин;

5-[1-бензил-5-(морфолин-4-илкарбонил)-1H-1,2,3-триазол-4-ил]-1H-индазол;

5-[1-бензил-5-(4-метоксифенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин;

N-[(1S)-1-бензил-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[(1S,2R)-2-гидрокси-2,3-дигидро-1H-инден-1-ил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-{3-[(3-фенилморфолин-4-ил)карбонил]изоксазол-5-ил}-1H-индазол;

N-бензил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

((1S)-2-{[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил}-6,7-диметокси-1,2,3,4-тетрагидроизохинолин-1-ил)метанол;

N-[(1R)-3-гидрокси-1-фенилпропил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[(1S)-3-гидрокси-1-фенилпропил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-2,3-дигидро-1H-инден-1-ил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-2,3-дигидро-1H-инден-2-ил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(1-фенилпропил)изоксазол-3-карбоксамид;

5-{1-бензил-5-[3-(диметиламино)фенил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин;

5-{1-бензил-5-[4-(диметиламино)фенил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин;

N-{3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенил}ацетамид;

N-{4-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенил}ацетамид;

5-{1-бензил-5-[3-(1H-пиразол-1-ил)фенил]-lH-1,2,3-триазол-4-ил}-1H-индазол-3-амин;

5-[1-бензил-5-(1-метил-1H-пиразол-4-ил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин;

3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]-N-фенилбензамид;

3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]-N-бензилбензамид;

5-[1-бензил-5-(1-метил-1H-индол-5-ил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин;

5-[1-бензил-5-(3-метоксифенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин;

5-[1-бензил-5-(3-морфолин-4-илфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин;

5-[3-(1,3-дигидро-2H-изоиндол-2-илкарбонил)изоксазол-5-ил]-1H-индазол;

5-{3-[(4-метил-2-фенилпиперазин-1-ил)карбонил]изоксазол-5-ил}-1H-индазол;

1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]карбонил}пиперидин-4-амин;

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид;

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензолсульфонамид;

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-(4-метоксифенил)мочевина;

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бутанамид;

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-метилпропанамид;

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]циклопропанкарбоксамид;

N-[1-бензоил-5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил}бензамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-фторбензамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид;

N-бензил-5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин;

N-[(1R)-1-бензил-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1-бензил-1H-пиразол-4-ил)-1H-индазол;

N-[(1R)-3-гидрокси-1-фенилпропил]-5-(3-метил-1H-индазол-5-ил)изоксазол-3-карбоксамид;

3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенол;

3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]бензамид;

5-{1-бензил-5-[4-(метилсульфонил)фенил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-хлорбензамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-4-хлорбензамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]этансульфонамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензолсульфонамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-хлорбензолсульфонамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-хлорбензолсульфонамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-4-хлорбензолсульфонамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2,5-диметилфуран-3-сульфонамид;

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-(2-хлорбензил)-1H-индазол-3-амин;

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-(3-хлорбензил)-1H-индазол-3-амин;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-хлорбензамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-фурамид;

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-этил-1H-индазол-3-амин;

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-(4-хлорбензил)-1H-индазол-3-амин;

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-(3-фурилметил)-1H-индазол-3-амин;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-[5-метил-2-(трифторметил)-3-фурил]мочевину;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-фурамид;

5-(1H-индазол-5-ил)-N-[(1S)-1-фенилпропил]изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1R)-1-фенилпропил]изоксазол-3-карбоксамид;

5-(1-бензил-1H-пиразол-4-ил)-1H-индазол-3-амин;

1-бензил-4-(1H-индазол-5-ил)-N-[(2S)-тетрагидрофуран-2-илметил]-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-4-(1H-индазол-5-ил)-N-(2-изопропоксиэтил)-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-4-(1H-индазол-5-ил)-N-[(2R)-тетрагидрофуран-2-илметил]-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-4-(1H-индазол-5-ил)-N-(тетрагидрофуран-3-илметил)-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-циклопентил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-(циклопентилметил)-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-этил-4-(1H-индазол-5-ил)-N-метил-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-4-(1H-индазол-5-ил)-N-изопропил-N-метил-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-4-(1H-индазол-5-ил)-N-(2-метоксиэтил)-N-метил-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-4-(1H-индазол-5-ил)-N-фенил-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-(4-хлорфенил)-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-4-(1H-индазол-5-ил)-N-(2-морфолин-4-илэтил)-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-[2-(диметиламино)этил]-4-(1H-индазол-5-ил)-N-метил-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-(2-гидроксиэтил)-4-(1H-индазол-5-ил)-N-пропил-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-[3-(диметиламино)пропил]-4-(1H-индазол-5-ил)-N-метил-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-[2-(диэтиламино)этил]-4-(1H-индазол-5-ил)-N-метил-1H-1,2,3-триазол-5-карбоксамид;

N,1-дибензил-N-этил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

N,1-дибензил-N-(2-гидроксиэтил)-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

(3R)-1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]карбонил}пиперидин-3-ол;

1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]карбонил}пиперидин-4-карбоксамид;

5-{1-бензил-5-[(2,6-диметилморфолин-4-ил)карбонил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

5-{5-[(4-ацетилпиперазин-1-ил)карбонил]-1-бензил-1H-1,2,3-триазол-4-ил}-1H-индазол;

5-{1-бензил-5-[(4-фенилпиперазин-1-ил)карбонил]-1H-1,2,3-триазол-4-ил}-1H-индазол;

1-бензил-N-[(1R)-1-(гидроксиметил)-2-метилпропил]-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-[(1S)-1-(гидроксиметил)-2-метилпропил]-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

1-бензил-N-[3-(1H-индазол-1-ил)пропил]-4(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-этилмочевину;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-фенилмочевину;

N-бензил-N'-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]мочевину;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-(2-хлорфенил)мочевину;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-(3-хлорфенил)мочевину;

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-(4-хлорфенил)мочевину;

N-[5-(1-бензил-5-иод-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид;

3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]пропаннитрил;

2-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]ацетамид;

метил 3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]пропаноат;

3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]пропанамид;

[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]ацетонитрил;

4-(3-амино-1H-индазол-5-ил)-N,N-диметил-1H-индазол-1-сульфонамид;

5-пиразин-2-ил-1H-индазол-3-амин;

5-тиен-2-ил-1H-индазол-3-амин;

5-(2-аминопиримидин-4-ил)-1H-индазол-3-амин;

5-(2-метоксипиридин-3-ил)-1H-индазол-3-амин;

5-имидазо[1,2-a]пиридин-3-ил-1H-индазол-3-амин;

N2,N2-диметил-N1-[5-(1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]глицинамид;

5-(1H-пиразол-5-ил)-1H-индазол-3-амин;

5-(4-метил-1H-индазол-5-ил)-1H-индазол-3-амин;

5-(1H-индазол-4-ил)-1H-индазол-3-амин;

N2,N2-диметил-N1-{5-[1-(3-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}глицинамид;

5-(1-бензил-1H-индазол-4-ил)-1H-индазол-3-амин;

N1-{5-[1-(4-трет-бутилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}-N2,N2-диметилглицинамид;

N2,N2-диметил-N1-{5-[1-(2-пиперидин-1-илэтил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}глицинамид;

N2,N2-диметил-N1-{5-[1-(2-морфолин-4-илэтил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}глицинамид;

N1-(5-{1-[2-(3,5-диметилизоксазол-4-ил)этил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-ил)-N2,N2-диметилглицинамид;

N1-(5-{1-[2-(3,5-диметил-1H-пиразол-4-ил)этил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-ил)-N2,N2-диметилглицинамид;

2-(4-{3-[(N,N-диметилглицил)амино]-1H-индазол-5-ил}-1H-1,2,3-триазол-1-ил)-2-метилпропановую кислоту;

этил (4-{3-[(N,N-диметилглицил)амино]-1H-индазол-5-ил}-1H-1,2,3-триазол-1-ил)ацетат;

N2,N2-диметил-N1-(5-{1-[(триметилсилил)метил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-ил)глицинамид;

N1-[5-(3-фурил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид;

N2,N2-диметил-N1-[5-(1H-пиразол-5-ил)-1H-индазол-3-ил]глицинамид;

N2,N2-диметил-N1-(5-пиримидин-5-ил-1H-индазол-3-ил)глицинамид;

N1-[5-(2,1,3-бензоксадиазол-5-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид;

N2,N2-диметил-N1-[5-(1H-пиразол-4-ил)-1H-индазол-3-ил]глицинамид;

N2,N2-диметил-N1-[5-(1-метил-1H-пиразол-4-ил)-1H-индазол-3-ил]глицинамид;

N1-[5-(3,5-диметил-1H-пиразол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид;

N1-{5-[2-(диметиламино)пиримидин-5-ил]-1H-индазол-3-ил}-N2,N2-диметилглицинамид;

N2,N2-диметил-N1-[5-(2-морфолин-4-илпиримидин-5-ил)-1H-индазол-3-ил]глицинамид;

N2,N2-диметил-N1-{5-[1-(2-морфолин-4-илэтил)-1H-пиразол-4-ил]-1H-индазол-3-ил}глицинамид;

N1-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид;

N1-[5-(1-бензил-1H-пиразол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-метилглицинамид;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-пирролидин-1-илацетамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-циклопентилглицинамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-циклопропилглицинамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-тетрагидро-2H-пиран-4-илглицинамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-(3-гидроксипирролидин-1-ил)ацетамид;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-(3-гидроксипиперидин-1-ил)ацетамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N3,N3-диметил-бета-аланинамид;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-морфолин-4-илацетамид;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-(4-метилпиперазин-1-ил)ацетамид;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-(3-оксопиперазин-1-ил)ацетамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-изопропилглицинамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-циклогексилглицинамид;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]ацетамид;

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-циклобутилглицинамид;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-пропилмочевину;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]этансульфонамид;

5-(1-бензил-1H-1,2,3-триазол-4-ил)-N-(циклопропилметил)-1H-индазол-3-амин;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-этилмочевина;

1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]пирролидин-2-он;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-4-(диметиламино)бутанамид;

N-3,4-дигидро-1H-изохромен-4-ил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-(циклогексилметил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-(3-хлорбензил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(2-метоксибензил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[2-(трифторметил)бензил]изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[3-(трифторметил)бензил]изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[4-(трифторметил)бензил]изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(пиридин-2-илметил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(пиридин-3-илметил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(пиридин-4-илметил)изоксазол-3-карбоксамид;

N-(2-хлорбензил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-(4-хлорбензил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(1-фенил-2-пиперидин-1-илэтил)изоксазол-3-карбоксамид;

N-[2-(1H-индазол-1-ил)-1-фенилэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(2-морфолин-4-ил-1-фенилэтил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[2-(4-метилпиперазин-1-ил)-1-фенилэтил]изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(1-фенил-2-пирролидин-1-илэтил)изоксазол-3-карбоксамид;

трет-бутил 2-({[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил}амино)-2-фенилэтилкарбамат;

5-(1H-индазол-5-ил)-N-(1-нафтилметил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(2-фенилэтил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(2-пиридин-2-илэтил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(2-пиридин-3-илэтил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-(2-пиридин-4-илэтил)изоксазол-3-карбоксамид;

N-[2-(2-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[2-(3-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[2-(4-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-бензил-N-этил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-метил-N-(1-нафтилметил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-метил-N-(2-фенилэтил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-метил-N-(2-пиридин-2-илэтил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1R)-1-фенилэтил]изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-1,2,3,4-тетрагидронафталин-1- илизоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1S)-1-(1-нафтил)этил]изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1R)-1-(1-нафтил)этил]изоксазол-3-карбоксамид;

N-[3-(диметиламино)-1-фенилпропил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-(2,3-дигидро-1,4-бензодиоксин-5-илметил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-(3,4-дигидро-2H-1,5-бензодиоксепин-6-илметил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1-метил-1H-индол-4-ил)метил]изоксазол-3-карбоксамид;

5-{3-[(3-фенилпирролидин-1-ил)карбонил]изоксазол-5-ил}-1H-индазол;

5-{3-[(2-фенилпирролидин-1-ил)карбонил]изоксазол-5-ил}-1H-индазол;

5-{3-[(2-фенилпиперидин-1-ил)карбонил]изоксазол-5-ил}-1H-индазол;

5-(1H-индазол-5-ил)-N-[(1S)-1-фенилэтил]изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1R)-1-(4-метилфенил)этил]-изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1S)-1-(4-метилфенил)этил]-изоксазол-3-карбоксамид;

N-[(1R,2S)-2-гидрокси-2,3-дигидро-1H-инден-1-ил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[(1R,2R)-2-гидрокси-2,3-дигидро-1H-инден-1-ил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[(1R)-1-(4-бромфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[(1S)-1-(4-бромфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[(1R)-1-(4-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[(1S)-1-(4-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1S)-1-(2-нафтил)этил]изоксазол-3-карбоксамид;

N-[1-(4-этоксифенил)-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[2-гидрокси-1-(4-изопропилфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[1-(3,4-диметилфенил)-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[2-гидрокси-1-(2-метоксифенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[2-гидрокси-1-(4-метилфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1R)-1-(2-метоксифенил)этил]-изоксазол-3-карбоксамид;

N-[(1S)-1-(3,4-дифторфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-[(1R)-1-(3-метоксифенил)этил]-изоксазол-3-карбоксамид;

5-(1H-индазол-5-ил)-N-{(1R)-1-[3-(трифторметил)-фенил]этил}изоксазол-3-карбоксамид;

N-[1-(2,3-дигидро-1,4-бензодиоксин-6-ил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

N-[1-(3,5-дихлорфенил)-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид;

трет-бутил 5-(1-бензил-1H-1,2,3-триазол-4-ил)-3-[({[6-(трифторметил)пиридин-2-ил]амино}карбонил)амино]-1H-индазол-1-карбоксилат;

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1-[(1-метилпиперидин-2-ил)карбонил]-1H-индазол-3-амин;

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1-[(диметиламино)-ацетил]-1H-индазол-3-амин;

трет-бутил 3-амино-5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-карбоксилат;

N-[5-(1-бензил-1Η-1,2,3-триазол-4-ил)-1Η-индазол-3-ил]-2-пиперидин-1-илацетамид;

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-морфолин-4-илацетамид; и

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-1-метилпиперидин-2-карбоксамид.

Все патенты, патентные заявки и ссылочные документы, известные из литературы, на которые имеются ссылки в настоящем описании, включены в настоящую заявку посредством ссылки во всей их полноте. В случае несоответствий, настоящее раскрытие, включая определения, будет иметь преимущество.

Как они использованы в тексте настоящего описания и прилагаемой формулы изобретения, представленные ниже термины имеют следующие значения:

Термин "алкенил", как он используется в настоящей заявке, означает углеводород с линейной или разветвленной цепью, содержащий от 2 до 10 атомов углерода и содержащий, по меньшей мере, одну углерод-углеродную двойную связь, образованную путем удаления двух атомов водорода. Репрезентативные примеры алкенила включают, но не ограничиваются этим, этенил, 2-пропенил, 2-метил-2-пропенил, 3-бутенил, 4-пентенил, 5-гексенил, 2-гептенил, 2-метил-1-гептенил и 3-деценил.

Термин "алкокси", как он используется в настоящей заявке, означает алкильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через атом кислорода. Репрезентативные примеры алкокси включают, но не ограничиваются этим, метокси, этокси, пропокси, 2-пропокси, бутокси, трет-бутокси, пентилокси и гексилокси.

Термин "алкоксиалкокси", как он используется в настоящей заявке, означает алкоксигруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через другую алкоксигруппу, определенную в настоящей заявке. Репрезентативные примеры алкоксиалкокси включают, но не ограничиваются этим, трет-бутоксиметокси, 2-этоксиэтокси, 2-метоксиэтокси и метоксиметокси.

Термин "алкоксиалкоксиалкил", как он используется в настоящей заявке, означает алкоксиалкоксигруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры алкоксиалкоксиалкила включают, но не ограничиваются этим, трет-бутоксиметоксиметил, этоксиметоксиметил, (2-метоксиэтокси)метил и 2-(2-метоксиэтокси)этил.

Термин "алкоксиалкил", как он используется в настоящей заявке, означает алкоксигруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры алкоксиалкила включают, но не ограничиваются этим, трет-бутоксиметил, 2-этоксиэтил, 2-метоксиэтил и метоксиметил.

Термин "алкоксикарбонил", как он используется в настоящей заявке, означает алкоксигруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через карбонильную группу, определенную в настоящей заявке. Репрезентативные примеры алкоксикарбонила включают, но не ограничиваются этим, метоксикарбонил, этоксикарбонил и трет-бутоксикарбонил.

Термин "алкоксикарбонилалкил", как он используется в настоящей заявке, означает алкоксикарбонильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры алкоксикарбонилалкила включают, но не ограничиваются этим, 3-метоксикарбонилпропил, 4-этоксикарбонилбутил и 2-трет-бутоксикарбонилэтил.

Термин "алкил", как он используется в настоящей заявке, означает углеводород с линейной или разветвленной цепью, содержащий от 1 до 10 атомов углерода. Репрезентативные примеры алкила включают, но не ограничиваются этим, метил, этил, н-пропил, изопропил, н-бутил, втор-бутил, изобутил, трет-бутил, н-пентил, изопентил, неопентил, н-гексил, 3-метилгексил, 2,2-диметилпентил, 2,3-диметилпентил, н-гептил, н-октил, н-нонил и н-децил.

Термин "алкилкарбонил", как он используется в настоящей заявке, означает алкильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через карбонильную группу, определенную в настоящей заявке. Репрезентативные примеры алкилкарбонила включают, но не ограничиваются этим, ацетил, 1-оксопропил, 2,2-диметил-1-оксопропил, 1-оксобутил и 1-оксопентил.

Термин "алкилкарбонилалкил", как он используется в настоящей заявке, означает алкилкарбонильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры алкилкарбонилалкила включают, но не ограничиваются этим, 2-оксопропил, 3,3-диметил-2-оксопропил, 3-оксобутил и 3-оксопентил.

Термин "алкилкарбонилокси", как он используется в настоящей заявке, означает алкилкарбонильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через атом кислорода. Репрезентативные примеры алкилкарбонилоксиа включают, но не ограничиваются этим, ацетилокси, этилкарбонилокси и трет-бутилкарбонилокси.

Термин "алкилен" означает двухвалентную группу, образованную из углеводорода с линейной или разветвленной цепью, состоящую из от 1 до 10 атомов углерода. Репрезентативные примеры алкилена включают, но не ограничиваются этим, -CH2-, -CH(CH3)-, -C(CH3)2-, -CH2CH2-, -CH2CH2CH2-, -CH2CH2CH2CH2- и -CH2CH(CH3)CH2-.

Термин "алкилен-NRg-", как он используется в настоящей заявке, означает алкиленовую группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через -NRg-группу, определенную в настоящей заявке.

Термин "алкилсульфинил", как он используется в настоящей заявке, означает алкильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через сульфинильную группу, определенную в настоящей заявке. Репрезентативные примеры алкилсульфинила включают, но не ограничиваются этим, метилсульфинил и этилсульфинил.

Термин "алкилсульфинилалкил", как он используется в настоящей заявке, означает алкилсульфинильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры алкилсульфинилалкила включают, но не ограничиваются этим, метилсульфинилметил и этилсульфинилметил.

Термин "алкилсульфонил", как он используется в настоящей заявке, означает алкильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через сульфонильную группу, определенную в настоящей заявке. Репрезентативные примеры алкилсульфонила включают, но не ограничиваются этим, метилсульфонил и этилсульфонил.

Термин "алкилсульфонилалкил", как он используется в настоящей заявке, означает алкилсульфонильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры алкилсульфонилалкила включают, но не ограничиваются этим, метилсульфонилметил и этилсульфонилметил.

Термин "алкилтио", как он используется в настоящей заявке, означает алкильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через атом серы. Репрезентативные примеры алкилтио включают, но не ограничиваются этим, метилтио, этилтио, трет-бутилтио и гексилтио.

Термин "алкилтиоалкил", как он используется в настоящей заявке, означает алкилтиогруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры алкилтиоалкила включают, но не ограничиваются этим, метилтиометил и 2-(этилтио)этил.

Термин "алкинил", как он используется в настоящей заявке, означает линейную или разветвленную углеводородную группу, содержащую от 2 до 10 атомов углерода и содержащую, по меньшей мере, одну углерод-углеродную тройную связь. Репрезентативные примеры алкинила включают, но не ограничиваются этим, ацетиленил, 1-пропинил, 2-пропинил, 3-бутинил, 2-пентинил и 1-бутинил.

Термин "арил", как он используется в настоящей заявке, означает фенил, бициклический арил или трициклический арил. Бициклический арил представляет собой нафтил или фенил, конденсированный с циклоалкилом, или фенил, конденсированный с циклоалкенилом, или фенил, конденсированный с моноциклическим гетероарильным кольцом, определенным в настоящей заявке, или фенил, конденсированный с моноциклическим гетероциклом, определенным в настоящей заявке. Бициклический арил по настоящему изобретению должен быть присоединен к исходной молекулярной группе через любой доступный углеродный атом, содержащийся в фенильном кольце. Репрезентативные примеры бициклического арила включают, но не ограничиваются этим, 2,3-дигидро-1,4-бензодиоксин-5-ил, 2,3-дигидро-1,4-бензодиоксин-6-ил, 3,4-дигидро-2H-1,5-бензодиоксепин-6-ил, дигидроинденил, инденил, индол-4-ил, нафтил, дигидронафталинил и тетрагидронафталинил. Трициклический арил представляет собой антрацен или фенантрен, или бициклический арил, конденсированный с циклоалкилом, или бициклический арил, конденсированный с циклоалкенилом, или бициклический арил, конденсированный с фенилом. Трициклический арил присоединен к исходной молекулярной группе через любой атом углерода, содержащийся в трициклическом ариле. Репрезентативные примеры трициклического арильного кольца включают, но не ограничиваются этим, азуленил, дигидроантраценил, флуоренил и тетрагидрофенантренил.

Арильные группы по настоящему изобретению, необязательно, являются замещенными 1, 2, 3, 4 или 5 заместителями, независимо выбранными из алкенила, алкокси, алкоксиалкокси, алкоксиалкоксиалкила, алкоксиалкила, алкоксикарбонила, алкоксикарбонилалкила, алкила, алкилкарбонила, алкилкарбонилалкила, алкилкарбонилокси, алкилсульфинила, алкилсульфинилалкил, алкилсульфонил, алкилсульфонилалкил, алкилтио, алкилтиоалкила, алкинила, арил*NC(O)-, арил*NHC(O)NH-, карбокси, карбоксиалкила, циано, цианоалкила, формила, формилалкила, галогена, галогеналкила, гетероарила, гидрокси, гидроксиалкил, меркапто, морфолино, нитро, Z1Z2N- или (Z3Z4N)карбонила. Арил*, необязательно, является замещенным 1, 2 или 3 заместителями, независимо выбранными из алкила, галогена, циано или нитро. Z1 и Z2, каждый независимо, выбран из водорода, алкила или алкилкарбонила.

Термин "арилокси", как он используется в настоящей заявке, означает арильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через атом кислорода. Репрезентативные примеры арилокси включают, но не ограничиваются этим, фенокси, нафтилокси, 3-бромфенокси, 4-хлорфенокси, 4-метилфенокси и 3,5-диметоксифенокси.

Термин "арилоксиалкил", как он используется в настоящей заявке, означает арилоксигруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкильную группу, определенную в настоящей заявке. Репрезентативные примеры арилоксиалкила включают, но не ограничиваются этим, 2-феноксиэтил, 3-нафт-2-илоксипропил и 3-бромфеноксиметил.

Термин "арилалкил", как он используется в настоящей заявке, означает арильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры арилалкила включают, но не ограничиваются этим, бензил, 2-фенилэтил, 3-фенилпропил и 2-нафт-2-илэтил.

Термин "арил(гидрокси)алкил", как он используется в настоящей заявке, означает арильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, содержащую одну гидроксигруппу, определенную в настоящей заявке. Репрезентативные примеры арил(гидрокси)алкила включают, но не ограничиваются этим, 2-фенилэтанол-2-ил и 2-гидрокси-2-фенилэтанил.

Термин "арилкарбонил", как он используется в настоящей заявке, означает арильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через карбонильную группу, определенную в настоящей заявке. Репрезентативные примеры арилкарбонила включают, но не ограничиваются этим, бензоил и нафтоил.

Термин "арилтио", как он используется в настоящей заявке, означает арильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через атом серы. Репрезентативные примеры арилтио включают, но не ограничиваются этим, фенилтио и 2-нафтилтио.

Термин "арилтиоалкил", как он используется в настоящей заявке, означает арилтиогруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры арилтиоалкила включают, но не ограничиваются этим, фенилтиометил, 2-нафт-2-илтиоэтил и 5-фенилтиометил.

Термин "азидо", как он используется в настоящей заявке, означает -N3 группу.

Термин "азидоалкил", как он используется в настоящей заявке, означает азидогруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке.

Термин "карбонил", как он используется в настоящей заявке, означает -C(O)-группу.

Термин "карбокси", как он используется в настоящей заявке, означает -CO2H группу.

Термин "карбоксиалкил", как он используется в настоящей заявке, означает карбоксигруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры карбоксиалкила включают, но не ограничиваются этим, карбоксиметил, 2-карбоксиэтил и 3-карбоксипропил.

Термин "циано", как он используется в настоящей заявке, означает -CN группу.

Термин "цианоалкил", как он используется в настоящей заявке, означает цианогруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры цианоалкила включают, но не ограничиваются этим, цианометил, 2-цианоэтил и 3-цианопропил.

Термин "циклоалкенил", как он используется в настоящей заявке, означает моноциклическую или бициклическую кольцевую систему, содержащую от 3 до 10 атомов углерода и содержащую, по меньшей мере, одну углерод-углеродную двойную связь, образованную путем удаления двух атомов водорода. Репрезентативные примеры моноциклических кольцевых систем включают, но не ограничиваются этим, 2-циклогексен-1-ил, 3-циклогексен-1-ил, 2,4-циклогексадиен-1-ил и 3-циклопентен-1-ил. Бициклические кольцевые системы представлены, в качестве примера, моноциклической циклоалкенильной кольцевой системой, которая является конденсированной с другим моноциклическим циклоалкильным кольцом, определенным в настоящей заявке, моноциклическим арильным кольцом, определенным в настоящей заявке, моноциклическим гетероциклом, определенным в настоящей заявке, или моноциклическим гетероарилом, определенным в настоящей заявке. Бициклические кольцевые системы по настоящему изобретению должны быть присоединены к исходной молекулярной группе через доступный атом углерода в циклоалкенильном кольце. Репрезентативные примеры бициклических кольцевых систем включают, но не ограничиваются этим, 4,5-дигидро-бензо[1,2,5]оксадиазол, 3a,4,5,6,7,7a-гексагидро-1H-инденил, 1,2,3,4,5,6-гексагидро-пенталенил, 1,2, 3,4,4a,5,6,8a-октагидро-пенталенил.

Термин "циклоалкил", как он используется в настоящей заявке, означает моноциклическую, бициклическую или спироциклическую кольцевую систему. Моноциклические кольцевые системы представлены, в качестве примера, насыщенной циклической углеводородной группой, содержащей от 3 до 8 атомов углерода. Примеры моноциклических кольцевых систем включают циклопропил, циклобутил, циклопентил, циклогексил, циклогептил и циклооктил. Бициклические циклоалкильные группы по настоящему изобретению представлены, в качестве примера, моноциклическим циклоалкильным кольцом, конденсированным с другим моноциклическим циклоалкильным кольцом, или моноциклическим циклоалкильным кольцом, конденсированным с циклоалкенилом, или моноциклическим циклоалкильным кольцом, конденсированным с фенильным кольцом, или моноциклическим циклоалкильным кольцом, конденсированным с моноциклическим гетероарильным кольцом, определенным в настоящей заявке, или моноциклическим циклоалкильным кольцом, конденсированным с моноциклическим гетероциклом, определенным в настоящей заявке. Бициклические циклоалкильные кольцевые системы по настоящему изобретению должны быть присоединены к исходной молекулярной группе через доступный атом углерода в моноциклоалкильном кольце.

Циклоалкильные группы по настоящему изобретению, необязательно, являются замещенными 1, 2, 3 или 4 заместителями, выбраными из алкенила, алкокси, алкоксиалкокси, алкоксиалкила, алкоксикарбонила, алкоксисульфонила, алкила, алкилкарбонила, алкилкарбонилокси, алкилсульфонила, алкилтио, алкилтиоалкила, алкинила, карбокси, циано, формила, галогеналкокси, галогеналкила, галогена, гидрокси, гидроксиалкила, меркапто, оксо, Z1Z2N- или (Z3Z4N)карбонила.

Термин "циклоалкилалкил", как он используется в настоящей заявке, означает циклоалкильную группу, присоединенную к исходной молекулярной группе через алкильную группу, определенную в настоящей заявке.

Термин "циклоалкилкарбонил", как он используется в настоящей заявке, означает циклоалкильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через карбонильную группу, определенную в настоящей заявке. Репрезентативные примеры циклоалкилкарбонила включают, но не ограничиваются этим, циклопропилкарбонил, 2-циклобутилкарбонил и циклогексилкарбонил.

Термин "формил", как он используется в настоящей заявке, означает -C(O)H группу.

Термин "формилалкил", как он используется в настоящей заявке, означает формильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры формилалкила включают, но не ограничиваются этим, формилметил и 2-формилэтил.

Термин "гало" или "галоген", как он используется в настоящей заявке, означает -Cl, -Br, -I или -F.

Термин "галогеналкокси", как он используется в настоящей заявке, означает, по меньшей мере, один атом галогена, определенный в настоящей заявке, присоединенный к исходной молекулярной группе через алкоксигруппу, определенную в настоящей заявке. Репрезентативные примеры галогеналкокси включают, но не ограничиваются этим, хлорметокси, 2-фторэтокси, трифторметокси и пентафторэтокси.

Термин "галогеналкил", как он используется в настоящей заявке, означает, по меньшей мере, один атом галогена, определенный в настоящей заявке, присоединенный к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры галогеналкила включают, но не ограничиваются этим, хлорметил, 2-фторэтил, трифторметил, пентафторэтил и 2-хлор-3-фторпентил.

Термин "гетероарил", как он используется в настоящей заявке, означает моноциклический гетероарил или бициклический гетероарил. Моноциклический гетероарил представляет собой 5 или 6-членное кольцо, содержащее, по меньшей мере, один гетероатом, независимо выбранный из O, N или S. 5-членное кольцо содержит две двойные связи и может содержать один, два, три или четыре гетероатома. 6-членное кольцо содержит три двойные связи и может содержать один, два, три или четыре гетероатома. 5- или 6-членный гетероарил связан с исходной молекулярной группой через любой атом углерода или любой атом азота, содержащийся в гетероариле. Репрезентативные примеры моноциклического гетероарила включают, но не ограничиваются этим, фурил, индазолил, изоксазолил, изотиазолил, оксадиазолил, оксазолил, пиридинил, пиридазинил, пиримидинил, пиразинил, пиразолил, пирролил, тетразолил, тиадиазолил, тиазолил, тиенил, триазолил и триазинил. Бициклический гетероарил состоит из моноциклического гетероарила, конденсированного с моноциклическим арильным кольцом, определенным в настоящей заявке, моноциклическим циклоалкильным кольцом, определенным в настоящей заявке, моноциклическим циклоалкенильным кольцом, определенным в настоящей заявке, другим моноциклическим гетероарильным или моноциклическим гетероциклильным кольцом, определенным в настоящей заявке. Бициклические гетероарильные кольцевые системы по настоящему изобретению должны быть присоединены к исходной молекулярной группе через доступный атом углерода в гетероарильном кольце. Бициклический гетероарил связан с исходной молекулярной группой через любой атом углерода или любой атом азота, содержащийся в бициклическом гетероариле. Репрезентативные примеры бициклического гетероарила включают, но не ограничиваются этим, бензофуранил, бензоксадиазолил, 1,3-бензотиазолил, бензимидазолил, бензодиоксолил, бензотиофенил, хроменил, циннолинил, фуропиридин, индолил, индазолил, изоиндолил, изохинолинил, нафтиридинил, оксазолопиридин, хинолинил, тиенопиридин и тиенопиридинил.

Гетероарильные группы по настоящему изобретению, необязательно, являются замещенными 1, 2, 3 или 4 заместителями, независимо выбранными из алкенила, алкокси, алкоксиалкокси, алкоксиалкила, алкоксикарбонила, алкоксикарбонилалкила, алкоксисульфонила, алкила, алкилкарбонила, алкилкарбонилалкила, алкилкарбонилокси, алкилтио, алкилтиоалкила, алкинила, бензила, карбокси, карбоксиалкила, циано, цианоалкила, формила, галогеналкокси, галогеналкила, галогена, гидрокси, гидроксиалкила, меркапто, нитро, Z1Z2N- или (Z3Z4N)карбонила. Гетероарильные группы по настоящему изобретению, которые являются замещенными, могут присутствовать в виде таутомеров. Настоящее изобретение охватывает все таутомеры, включая неароматические таутомеры.

Термин "гетероарилалкил", как он используется в настоящей заявке, означает гетероарильную группу, присоединенную к исходной молекулярной группе через алкильную группу, определенную в настоящей заявке.

Термин "гетероцикл" или "гетероциклический", как он используется в настоящей заявке, относится к моноциклической, бициклической, трициклической или спироциклической кольцевой системе, которая содержит, по меньшей мере, один гетероатом. Моноциклический гетероцикл представляет собой 3, 4, 5, 6 или 7-членное кольцо, содержащее, по меньшей мере, один гетероатом, независимо выбранный из группы, состоящей из O, N и S. 3 или 4-членное кольцо содержит 1 гетероатом, выбранный из группы, состоящей из O, N и S. 5-членное кольцо не содержит совсем или содержит одну двойную связь и один, два или три гетероатома, выбранных из группы, состоящей из O, N и S. 6 или 7-членное кольцо не содержит совсем или содержит одну или две двойные связи и один, два или три гетероатома, выбранных из группы, состоящей из O, N и S. Моноциклический гетероцикл связан с исходной молекулярной группой через любой атом углерода или любой атом азота, содержащийся в моноциклическом гетероцикле. Репрезентативные примеры моноциклического гетероцикла включают, но не ограничиваются этим, азетидинил, азепанил, азиридинил, диазепанил, 1,3-диоксанил, 1,3-диоксоланил, 1,3-дитиоланил, 1,3-дитианил, имидазолинил, имидазолидинил, изотиазолинил, изотиазолидинил, изоксазолинил, изоксазолидинил, изоиндолин-1,3-дион, морфолинил, оксадиазолинил, оксадиазолидинил, оксазолинил, оксазолидинил, пиперазинил, пиперидинил, пиранил, пиразолинил, пиразолидинил, пирролинил, пирролидинил, тетрагидрофуранил, тетрагидротиенил, тиадиазолинил, тиадиазолидинил, тиазолинил, тиазолидинил, тиоморфолинил, 1,1-диоксидотиоморфолинил (тиоморфолинсульфон), тиопиранил и тритианил. Бициклический гетероцикл по настоящему изобретению определяется как моноциклический гетероцикл, конденсированный с фенильной группой, циклоалкильной группой, определенной в настоящей заявке, циклоалкенильной группой, определенной в настоящей заявке, другой моноциклической гетероциклильной группой, определенной в настоящей заявке, или спироциклическим кольцом, где один атом углерода моноциклического гетероцикла связан образующими мостик двумя концами алкиленовой цепи. Бициклический гетероцикл по настоящему изобретению связан с исходной молекулярной группой через любой атом углерода или любой атом азота, содержащийся в гетероциклическом кольце. Репрезентативные примеры бициклического гетероцикла включают, но не ограничиваются этим, 1,3-бензодиоксолил, 1,3-бензодитиолил, 2,3-дигидро-1,4-бензодиоксинил, 2,3-дигидро-1-бензофуранил, 2,3-дигидро-1-бензотиенил, 3,4-дигидро-1H-изохромен-4-ил, 2,3-дигидро-1H-индолил, сукцинмимидил и 1,2,3,4-тетрагидрохинолинил. Трициклический гетероцикл представляет собой бициклический гетероцикл, конденсированный с фенилом, или бициклический гетероцикл, конденсированный с циклоалкилом, или бициклический гетероцикл, конденсированный с циклоалкенилом, или бициклический гетероцикл, конденсированный с моноциклическим гетероциклом. Трициклический гетероцикл связан с исходной молекулярной группой через любой атом углерода или любой атом азота, содержащийся в трициклическом гетероцикле. Репрезентативные примеры трициклического гетероцикла включают, но не ограничиваются этим, 2,3,4,4a,9,9a-гексагидро-1H-карбазолил, 5a,6,7,8,9,9a-гексагидродибензо[b,d]фуранил и 5a,6,7,8,9,9a-гексагидродибензо[b,d]тиенил.

Гетероциклы по настоящему изобретению, необязательно, являются замещенными 1, 2 или 3 заместителями, независимо выбранными из алкенила, алкокси, алкоксиалкокси, алкоксиалкила, алкоксикарбонила, алкоксикарбонилалкила, алкоксисульфонила, алкила, алкилкарбонила, алкилкарбонилалкила, алкилкарбонилокси, алкилтио, алкилтиоалкила, алкинила, арила, бензила, карбокси, карбоксиалкила, циано, цианоалкила, формила, галогеналкокси, галогеналкила, галогена, гидрокси, гидроксиалкила, гидроксиалкилкарбонила, гидроксиалкоксиалкила, меркапто, оксо, Z1Z2N- или (Z3Z4N)карбонила.

Термин "гетероциклалкил", как он используется в настоящей заявке, означает гетероциклильную группу, присоединенную к исходной молекулярной группе через алкильную группу, определенную в настоящей заявке.

Термин "гетероциклкарбонил", как он используется в настоящей заявке, означает гетероцикл, определенный в настоящей заявке, присоединенный к исходной молекулярной группе через карбонильную группу, определенную в настоящей заявке.

Термин "гидрокси", как он используется в настоящей заявке, означает -OH группу.

Термин "гидроксиалкил", как он используется в настоящей заявке, означает, по меньшей мере, одну гидроксигруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры гидроксиалкила включают, но не ограничиваются этим, гидроксиметил, 2-гидроксиэтил, 3-гидроксипропил, 2,3-дигидроксипентил и 2-этил-4-гидроксигептил.

Термин "гидроксиалкилкарбонил", как он используется в настоящей заявке, означает гидроксиалкильную группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через карбонильную группу, определенную в настоящей заявке. Репрезентативные примеры включают, но не ограничиваются этим, 2-гидроксиацетил и 4-гидроксибутаноил.

Термин "гидроксиалкоксиалкил", как он используется в настоящей заявке, означает гидроксиалкоксигруппу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры гидроксиалкоксиалкила включают, но не ограничиваются этим, (2-гидрокси-этокси)-этил и (3-гидрокси-пропокси)-этил.

Термин "гидрокси-защитная группа" или "O-защитная группа" означает заместитель, который защищает гидроксильные группы от нежелательных реакций в ходе синтетических процедур. Примеры гидрокси-защитных групп включают, но не ограничиваются этим, замещенные простые метиловые эфиры, например, метоксиметил, бензилоксиметил, 2-метоксиэтоксиметил, 2-(триметилсилил)-этоксиметил, бензил и трифенилметил; тетрагидропираниловые эфиры; замещенные простые этиловые эфиры, например, 2,2,2-трихлорэтил и трет-бутил; силиловые эфиры, например, триметилсилил, трет-бутилдиметилсилил и трет-бутилдифенилсилил; циклические ацетали и кетали, например, метиленацеталь, ацетонид и бензилиденацеталь; циклические сложные орто-эфиры, например, метоксиметилен; циклические карбонаты; и циклические боронаты. Традиционно используемые гидрокси-защитные группы раскрыты в T.W. Greene and P.G.M. Wuts, Protective Groups in Organic Synthesis, 3rd edition, John Wiley & Sons, New York (1999).

Термин "меркапто", как он используется в настоящей заявке, означает -SH группу.

Термин "азот-защитная группа", как он используется в настоящей заявке, означает группы, которые предназначены для защиты аминогруппы от нежелательных реакций в ходе синтетических процедур. Предпочтительными азот-защитными группами являются ацетил, бензоил, бензил, бензилоксикарбонил (Cbz), формил, фенилсульфонил, трет-бутоксикарбонил (Boc), трет-бутилацетил, трифторацетил и трифенилметил (тритил).

Термин "нитро", как он используется в настоящей заявке, означает -NO2 группу.

Термин "триалкилсилил", как он используется в настоящей заявке, означает три независимо выбранные алкильные группы, определенные в настоящей заявке, присоединенные к исходной молекулярной группе через атом кремния. Репрезентативные примеры триалкилсилила включают, но не ограничиваются этим, триметилсилил, триэтилсилил, трет-бутилдиметилсилил и триизопропилсилил.

Термин "триалкилсилилалкил", как он используется в настоящей заявке, означает триалкилсилильную группу, определенную в настоящей заявке, присоединенные к исходной молекулярной группе через алкиленовую группу, определенную в настоящей заявке. Репрезентативные примеры триалкилсилилалкила включают, но не ограничиваются этим, триметилсилилметил, 2-триметилсилилэтил и 2-трет-бутилдиметилсилилэтил.

Термин "Z1Z2N", как он используется в настоящей заявке, означает две группы, Z1 и Z2, которые присоединены к исходной молекулярной группе через атом азота. Z1 и Z2, каждый независимо, представляют собой водород, алкоксикарбонил, алкил, алкилкарбонил, арил, арилалкил и формил. В некоторых случаях в настоящем изобретении, Z1 и Z2, взятые вместе с атомом азота, с которым они связаны, образуют гетероциклическое кольцо. Репрезентативные примеры Z1Z2N включают, но не ограничиваются этим, амино, метиламино, ацетиламино, ацетилметиламино, фениламино, бензиламино, азетидинил, пирролидинил и пиперидинил.

Термин " Z3Z4N", как он используется в настоящей заявке, означает две группы, Z3 и Z4, которые присоединены к исходной молекулярной группе через атом азота. Z3 и Z4, каждый независимо, представляют собой водород, алкил, арил и арилалкил. Репрезентативные примеры Z3Z4N включают, но не ограничиваются этим, амино, метиламино, фениламино и бензиламино.

Термин "(Z3Z4N)карбонил", как он используется в настоящей заявке, означает NZ3Z4 группу, определенную в настоящей заявке, присоединенную к исходной молекулярной группе через карбонильную группу, определенную в настоящей заявке. Репрезентативные примеры (Z3Z4N)карбонила включают, но не ограничиваются этим, аминокарбонил, (метиламино)карбонил, (диметиламино)карбонил и (этилметиламино)карбонил.

Термин "оксо", как он используется в настоящей заявке, означает =О группу.

Термин "сульфинил", как он используется в настоящей заявке, означает -S(O)- группу.

Термин "сульфонил", как он используется в настоящей заявке, означает -SO2- группу.

Термин "сульфонамид", как он используется в настоящей заявке, означает -SO2NH2 группу.

Термин "таутомер", как он используется в настоящей заявке, означает сдвиг протона от одного атома в соединении к другому атому в этом же соединении, где два или более структурно отличных соединения находятся в равновесии друг с другом.

Соединения по настоящему изобретению могут существовать в виде стереоизомеров, где присутствуют асимметрические или хиральные центры. Эти стереоизомеры представляют собой "R" или "S" в зависимости от конфигурации заместителей вокруг хирального атома углерода. Термины "R" и "S", используемые в настоящей заявке, означают конфигурации, определенные в IUPAC 1974 Recommendations for Section E, Fundamental Stereochemistry, Pure Appl. Chem., 1976, 45:13-30. Настоящее изобретение предусматривает различные стереоизомеры и их смеси, и они специально включены в объем настоящего изобретения. Стереоизомеры включают энантиомеры и диастереомеры и смеси энантиомеров или диастереомеров. Индивидуальные стереоизомеры соединений по настоящему изобретению можно получить синтетическим способом из коммерчески доступных исходных веществ, которые содержат асимметрические или хиральные центры, или путем получения рацемических смесей с последующим разделением, что хорошо известно специалистам в данной области. Такие способы разделения представляют собой, в качестве примера, (1) присоединение смеси энантиомеров к хиральному вспомогательному веществу, разделение полученной смеси диастереомеров при помощи перекристаллизации или хроматографии и выделение оптически чистого продукта из вспомогательного вещества; или (2) непосредственное разделение смеси оптических энантиомеров на хиральных хроматографических колонках.

Соединения и способы по настоящему изобретению будут более понятны посредством ссылки на представленные ниже Примеры, которые предназначены в качестве иллюстрации, а не для ограничения объема настоящего изобретения. Кроме того, все ссылки, имеющиеся в настоящей заявке, включены посредством ссылки.

Названия соединений указаны с использованием программы наименования Name Pro, поставщиком которой является ACD/Labs. Альтернативно, названия соединений указаны с использованием программы наименования AUTONOM, поставщиком которой является компания MDL Information Systems GmbH (ранее известная как Beilstein Informationssysteme), Frankfurt, Germany, и она является частью набора программ CHEMDRA W® ULTRA v. 6.0.2 и ISIS Draw v. 2.5. Также, названия соединений указаны с использованием алгоритма наименования Struct=Name, который является частью набора программ CHEMDRA W® ULTRA v. 9.0.7.

Аббревиатуры

Аббревиатуры, которые использованы в описаниях Схем и в Примерах, которые представлены ниже, следующие: ДМФА для N,N-диметилформамида, DMSO для диметилсульфоксида, EtOAc для этилацетата, CHCl3 для хлороформа, CH2Cl2 для дихлорметана, CH3CN для ацетонитрила, ТГФ для тетрагидрофурана, HATU для гексафторфосфата O-(7-азабензотриазол-1-ил)-N,N,N',N'-тетраметилурония, EDC или EDCI для гидрохлорида 1-(3-диметиламинопропил)-3-этилкарбодиимида, ЖХ/МС для жидкостной хроматографии/масс-спектроскопии, NH4OAc для ацетата аммония, NaBH(OAc)3 для триацетоксиборогидрида натрия, PBS для бычьего сывороточного альбумина, PBS для фосфатно-буферного солевого раствора, TMS для триметилсилила, MW для микроволнового облучения, DMAP для 4-(диметиламино)пиридина, dppf для 1,1'-бис(дифенилфосфино)ферроцена, ТФУ для трифторуксусной кислоты, BINAP для 2,2'-бис(дифенилфосфино)-1,1'-бинафила, TBAF для тетрабутиламмонийфторида, Tween для полиоксоэтиленсорбитанмонолаурата, ВЭЖХ для высоко-эффективной жидкостной хроматографии, DME для 1,2-диметоксиэтана, Boc для трет-бутоксикарбонила, BSA для бычьего сывороточного альбумина, DTT для дитиотреитола, АТФ для аденозинтрифосфата, EDTA для этилендиаминтетрауксусной кислоты, HPMC для гидроксипропилметилцеллюлозы, TMB для 3,3',5,5'-тетраметилбензидина и HEPES для 4-(2-гидроксиэтил)-1-пиперазинэтансульфоновой кислоты.

Получение соединений по настоящему изобретению

Соединения и способы по настоящему изобретению будут более понятны в связи с представленными ниже Схемами синтеза и Примерами, которые иллюстрируют средства, при помощи которых можно получить соединения по настоящему изобретению.

Схема 1

Как показано на Схеме 1, соединения формулы 2, которые являются типичными представителями соединений формулы (I), могут быть получены следующим образом. Соединения формулы 1, где R1 и R2 определены в формуле (I) и X1 представляет собой иод, бром или хлор, и которые могут быть получены из коммерческих источников или могут быть синтезированы в соответствии со способами, известными из литературы, при обработке реагентом А-M1, где A имеет значение, определенное в формуле (I), и M1 представляет собой -Sn(Rz)3 или -B(ORy)2, где Rz представляет собой алкил или арил и Ry представляет собой водород, алкил, арил, или две группы Ry вместе с атомом бора, с которым они связаны, образуют 1,3-диоксоборолан, в присутствии палладиевого катализатора будут обеспечивать соединения формулы 2. В таких реакциях между соединениями формулы 1 и соединениями формулы -Sn(Rz)3, широко известных как сочетания по методу Стилле, используют палладиевый катализатор, такой как, но не ограничиваясь этим, тетракис(трифенилфосфин)палладий(0), дихлорбис(трифенилфосфин)палладий(II), трис(дибензиллиденацетон)дипалладий или диацетат палладия, в присутствии или в отсутствие лиганда, такого как три(2-фурил)фосфин или трифениларсин, в растворителе, таком как толуол или ДМФА, при температуре от около 25°C до около 150°C. Кроме того, могут быть добавлены соли Li(I), Cu(I) или Mn(II) для улучшения реакционной способности или специфичности. В реакциях между соединениями формулы 1 и соединениями формулы -B(ORy)2, широко известных как связывания по методу Сузуки, используют палладиевые катализаторы, такие как, но не ограничиваясь этим, тетракис(трифенилфосфин)палладий(0), дихлорбис(трифенилфосфин)палладий(II), трис(дибензилидинацетон)дипалладий или диацетат палладия. Можно добавить лиганд палладия, такой как 2-(дициклогексилфосфино)бифенил, три-трет-бутилфосфин или трис(2-фурил)фосфин, и основание, такое как, но не ограничиваясь этим, водный K3PO4, карбонат цезия, карбонат калия или Na2CO3, в растворителях, таких как толуол, диметоксиэтан, диоксан, вода или ДМФА, при температуре от около 25°C до около 150°C. Реакцию также можно осуществлять при нагревании в реакторе, представляющем собой микроволновую печь.

Хотя многие органостаннаны являются коммерчески доступными или описаны в литературе, можно также получить дополнительные станнаны из А-галогенидов или А-трифлатов путем обработки гекса-алкилдистаннаном формулы ((Rz)3Sn)2 в присутствии Pd(Ph3P)4. Подобным образом, в отсутствие коммерчески доступных борорганических реагентов, -B(ORy)2 можно получить из соответствующих галогенидов или трифлатов (A-галоген или А-трифлат) через металлообмен с литийорганическим соединением с последующим добавлением алкилбората.

Схема 2

Соединения формулы 2, где R1 и R2 определены в формуле (I), и A представляет собой гетероарильное кольцо, связанное с исходной группой через атом азота, можно получить как проиллюстрировано на Схеме 2. Обработка соединений формулы I реагентом формулы А-Н, где H представляет собой водород по атому азота, содержащемуся в гетероарильном кольце A, в присутствии основания, такого как, но не ограничиваясь этим, трет-бутоксид натрия или карбонат цезия, и металлического катализатора, такого как, но не ограничиваясь этим, металлическая медь, CuI или диацетат палладия, и необязательно с лигандом, таким как, но не ограничиваясь этим, BINAP или три-трет-бутилфосфин, будет обеспечивать соединения формулы 2.

Схема 3

Как указано выше для Схемы 1, соединения формулы (I) могут быть синтезированы с использованием сочетания по методу Стилле, как описано на Схеме 3. Соединения формулы 3, где Rii имеет значение, определенное в формуле (I), при их обработке соединениями формулы 4, где R1 имеет значение, определенное в формуле (I), и P1 представляет собой азот-защитную группу, такую как, но не ограничиваясь этим, трет-бутилоксикарбонил или ацетил, в присутствии дихлорбис(трифенилфосфин)палладия(II) и (тиофен-2-карбонилокси)меди, в толуоле, в условиях нагревания, будут обеспечивать соединения формулы 5. Соединения формулы 5, при их обработке в условиях, известных как используемых для удаления защитной группы, таких как хлористоводородная кислота или трифторуксусная кислота в растворителе, таком как уксусная кислота или диоксан, когда защитная группа представляет собой трет-бутилоксикарбонил, или гидроксид натрия, гидроксид лития или гидроксид калия в водной смеси ТГФ, изопропанола или диоксана, когда защитная группа представляет собой ацетил, будут обеспечивать соединения формулы 6, которые являются типичными представителями соединений формулы (I) где A представляет собой (ii).

Схема 4

Соединения формулы 3, используемые в Схеме 3 для получения соединений формулы (I), можно получить, как показано на Схеме 4. Соединения формулы 7, которые получают из коммерческих источников или которые можно получить в соответствии со способами, известными специалистам в данной области, при обработке их либо 1,1,1-трибутил-N,N-диметилстаннамином или метил этил(трибутилстаннил)карбаматом, будут обеспечивать соединения формулы 8. Алкины формулы 8, при нагревании в присутствии соединений формулы 9, где Rii имеет значение, определенное в формуле (I), и N3 представляет собой азид, будут обеспечивать соединения формулы 3.

Схема 5

Как показано на Схеме 5, соединения формулы 12, которые являются типичными представителями соединений формулы (I), где A представляет собой (ii), могут быть получены следующим образом. Соединения формулы 10, где R1 имеет значение, определенное в формуле (I), и X1 представляет собой иод, бром, хлор или трифлат, при их обработке TMS ацетиленом в присутствии иодида меди, дихлорбис(трифенилфосфин)палладия(II) и триэтиламина, с последующей обработкой тетрабутиламмонийфторидом или гидроксидом калия, будут обеспечивать соединения формулы 11. Реакцию можно осуществлять в растворителе, таком как, но не ограничиваясь этим, ДМФА, при температуре окружающей среды или в условиях нагревания. Соединения формулы 11, при их обработке Rii-Cl, азидом натрия, сульфат меди и металлической медью, в условиях нагревания, в растворителе, таком как диоксан, будут обеспечивать соединения формулы 12, которые являются типичными представителями соединений формулы (I), где A представляет собой (ii).

Схема 6

Альтернативно, соединения формулы 13, при их обработке TMS-ацетиленом в присутствии иодида меди, дихлорбис(трифенилфосфин)палладия(II) и триэтиламина, с последующей обработкой тетрабутиламмонийфторидом или гидроксидом калия, будут обеспечивать соединения формулы 14. Реакцию можно осуществлять в растворителе, таком как, но не ограничиваясь этим, ДМФА, при температуре окружающей среды или в условиях нагревания. Соединения формулы 14, при их обработке соединениями формулы 9, где Rii имеет значение, определенное в формуле (I), или азидом натрия, сульфатом меди и металлической медью в условиях нагревания будут обеспечивать соединения формулы 15. Соединения формулы 15, при нагревании в присутствии гидразина в этаноле, будут обеспечивать соединения формулы 16. Соединения формулы 16, при их обработке ди-трет-бутилдикарбонатом и каталитическим количеством DMAP в растворителе, таком как ТГФ или ацетонитрил, будут обеспечивать соединения формулы 17. Соединения формулы 17, при их обработке соединениями формулы 18 в присутствии основания, такого как, но не ограничиваясь этим, пиридин, в растворителе, таком как дихлорметан, с последующей обработкой трифторуксусной кислотой будут обеспечивать соединения формулы 19. Соединения формулы 16, при обработке карбоновой кислотой с использованием условий связывания карбоновой кислоты-амина, известных специалистам в данной области, будут обеспечивать соединения формулы 19A. Стандартные условия связывания карбоновой кислоты-амина включают добавление связывающего реагента, такого как, но не ограничиваясь этим, гидрохлорид 1-(3-диметиламинопропил)-3-этилкарбодиимида (EDCI), 1,3-дициклогексилкарбодиимид (DCC), хлорангидрид бис(2-оксо-3-оксазолидинил)фосфиновой кислоты (BOPCl), гексафторфосфат O-(7-азабензотриазол-1-ил)-N,N,N',N'-тетраметилурония (HATU) или тетрафторборат O-бензотриазол-1-ил-N,N,N',N'-тетраметилурония (TBTU), с использованием или без вспомогательного вещества, такого как, но не ограничиваясь этим, 1-гидрокси-7-азабензотриазол (HOAT) или гидрат 1-гидроксибензотриазола (HOBT), в растворителе, таком как, но не ограничиваясь этим, дихлорметан.

Схема 7

Соединения формулы 24, которые являются типичными представителями соединений формулы (I), могут быть получены следующим образом. Соединения формулы 20, где X1 представляет собой галоген или трифлат, при их обработке соединением формулы 21, уксусным ангидридом и основанием, таким как, но не ограничиваясь этим, ацетат калия, в условиях нагревания будут обеспечивать соединения формулы 22. Соединения формулы 22, при их обработке азидом натрия, сульфатом меди, основанием, таким как карбонат натрия, и соединения формулы 23, где Rii имеет значение, определенное в формуле (I), и которые либо являются доступными из коммерческих источников, либо могут быть получены специалистами в данной области, будут обеспечивать соединения формулы 24.

Схема 8

Как показано на Схеме 8, соединения формулы 29 и 30, которые являются типичными представителями соединений формулы (I), могут быть получены следующим образом. Соединения формулы 25, где R1 имеет значение, определенное в формуле (I), и X1 представляет собой галоген или трифлат, при их обработке соединениями формулы 23, иодидом меди, дихлорбис(трифенилфосфин)палладием(II) и триэтиламином в ДМФА, при температуре окружающей среды или в условиях нагревания будут обеспечивать соединения формулы 27. Соединения формулы 27, при их обработке соединениями формулы 9 в условиях нагревания и либо без растворителя, либо в растворителе, таком как, но не ограничиваясь этим, диоксан, будут обеспечивать соединения формулы 29 и 30.

Схема 9

Соединения формулы 32, которые являются типичными представителями соединений формулы (I), где A представляет собой (vii) и R1 и RVii определены в формуле (I), могут быть получены следующим образом. Альдегиды формулы 31, где Rvii имеет значение, определенное в формуле (I), которые могут быть получены из коммерческих источников, при их обработке гидрохлоридом гидроксиламина и водным раствором гидроксида натрия, будут обеспечивать промежуточное соединение оксима, которое, при его окислении Хлорамином T тригидратом, с последующей обработкой сульфатом меди и медной проволокой и соединениями формулы 11, будут обеспечивать соединения формулы 32.

Схема 10

Соединения формулы 38, которые являются типичными представителями соединений формулы (I), где A представляет собой (x), получают следующим образом. Соединения формулы 33, где R1 имеет значение, определенное в формуле (I), которые могут быть получены из коммерческих источников или могут быть получены специалистами в данной области, при их обработке N,O-диметилгидроксиламином с использованием кислотных условий связывания, известных специалистам в данной области, будут обеспечивать соединения формулы 34. Стандартные условия связывания карбоновой кислоты-амина включают добавление связывающего реагента, такого как, но не ограничиваясь этим, гидрохлорид 1-(3-диметиламинопропил)-3-этилкарбодиимида (EDCI), 1,3-дициклогексилкарбодиимид (DCC), хлорангидрид бис(2-оксо-3-оксазолидинил)фосфиновой кислоты (BOPCl), гексафторфосфат O-(7-азабензотриазол-1-ил)-N,N,N',N'-тетраметилурония (HATU) или тетрафторборат O-бензотриазол-1-ил-N,N,N',N'-тетраметилурония (TBTU), с использованием или без вспомогательного вещества, такого как, но не ограничиваясь этим, 1-гидрокси-7-азабензотриазол (HOAT) или гидрат 1-гидроксибензотриазола (HOBT), в растворителе, таком как, но не ограничиваясь этим, дихлорметан. Соединения формулы 34, при их обработке реагентом Гриньяра, таким как бензилмагнийбромид, в растворителе, таком как тетрагидрофуран, при температуре ниже температуры окружающей среды будут обеспечивать соединения формулы 35. Соединения формулы 35, при их обработке реагентом, представляющим собой защитную группу, таким как, но не ограничиваясь этим, ди-трет-бутилдикарбонат, и каталитическим количеством DMAP в растворителе, таком как ТГФ или ацетонитрил, будут обеспечивать соединения формулы 36. Соединения формулы 36, при их обработке трибромидом пиридиния в растворителе, таком как, но не ограничиваясь этим, ТГФ, с нагреванием или без нагревания будут обеспечивать соединения формулы 36 A. Соединения формулы 36 A, при их обработке соединениями формулы 37 с нагреванием или без нагревания, с последующей обработкой продукта, подвергая его условиям, которые удаляют азот-защитную группу, будут обеспечивать соединения формулы 38. Традиционно используемые азот-защитные группы, а также способы их удаления раскрыты в T.W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 3rd edition, John Wiley & Sons, New York (1999).

Схема 11

Соединения формулы 36, где R1 имеет значение, определенное в формуле (I), и P1 представляет собой азот-защитную группу, при их обработке соединениями формулы 39 в условиях нагревания, с последующей обработкой продукта, подвергая его условиям, которые, как это известно специалистам в данной области, удаляют азот-защитную группу, или как показано в литературе, будут обеспечивать соединения формулы 40, которые являются типичными представителями соединений формулы (I), где A представляет собой (xvii).

Схема 12

Как показано на Схеме 12, соединения формулы 47, которые являются типичными представителями соединений формулы (I), где A представляет собой (x), могут быть получены следующим образом. Соединения формулы 41, где R1 имеет значение, определенное в формуле (I), при их обработке ди-трет-бутилдикарбонатом и каталитическим количеством DMAP в растворителе, таком как ТГФ или ацетонитрил, будут обеспечивать соединения формулы 42. Обработка соединений формулы 42 трибутил(1-этоксивинил)станнаном и дихлорбис(трифенилфосфин)палладием(II) будет обеспечивать соединения формулы 44. Соединения формулы 44, при их обработке трибромидом пиридиния в ТГФ будут обеспечивать соединения формулы 45. Соединения формулы 45, при их обработке соединениями формулы 46 в растворителе, таком как, но не ограничиваясь этим, этанол, где Rx имеет значение, определенное в формуле (I), будут обеспечивать соединения формулы 47.

Схема 13

Как показано на Схеме 13, соединения формулы 51, которые являются типичными представителями соединений формулы (I), где A представляет собой (iv), могут быть получены следующим образом. Соединения формулы 48, где R1 имеет значение, определенное в формуле (I), и которые являются либо доступными через коммерческие источники, либо их можно получить в соответствии с процедурами, описанными в литературе, или как показано в настоящей заявке, при нагревании в присутствии соединений формулы 49, а также соединений формулы 50, которые либо являются коммерчески доступными, либо могут быть получены специалистами в данной области с использованием процедур, описанных в литературе, будут обеспечивать соединения формулы 51.

Схема 14

Как показано на Схеме 14, соединения формулы 55, которые являются типичными представителями соединений формулы (I), где A представляет собой (xiv), (xv), (xvi) или (xvii), могут быть получены следующим образом. Соединения формулы (52), где R1 имеет значение, определенное в формуле (I), при их обработке бутиллитием с последующей обработкой ДМФА, а затем кислотной обработкой, будут обеспечивать соединения формулы 48. Соединения формулы 48, при их обработке соединениями формулы 51, где X представляет собой -CH-, -N- или -S-, Y представляет собой -CH-, -N- или связь, и три(трифлат)ом скандия, с последующей обработкой соединениями формулы 54, где Za определен в формуле (I), будут обеспечивать соединения формулы 55.

Схема 15

Как показано на Схеме 15, соединения формулы 56, которые являются типичными представителями соединений формулы (I), где A представляет собой (vii), могут быть получены следующим образом. Соединения формулы (11), где R1 имеет значение, определенное в формуле (I), при их обработке реагентом, таким как, но не ограничиваясь этим, этил 2-хлор-2-(гидроксиимино)ацетат, с основанием, таким как, но не ограничиваясь этим, триэтиламин, будут обеспечивать соединения формулы 56. Реакцию можно осуществить в растворителе, таком как, но ограничиваясь этим, толуол, и может потребоваться применение нагревания.

Схема 16

Как показано на Схеме 16, соединения формулы 29, которые являются типичными представителями соединений формулы (I), где A представляет собой (ii), могут быть получены следующим образом. Соединения формулы (27), где R1 имеет значение, определенное в формуле (I), при их обработке соединением формулы 9, RiiC(O)Cl или ICl, CuI и триэтиламином в растворителе, таком как, но не ограничиваясь этим, тетрагидрофуран, будут обеспечивать соединения формулы 29. Реакцию можно осуществить при температуре окружающей среды или с применением нагревания.

Схема 17

Как показано на Схеме 17, соединения формулы 57, которые являются типичными представителями соединений формулы (I), где A представляет собой (vi), могут быть получены следующим образом. Соединения формулы 45, где R1 имеет значение, определенное в формуле (I), при их обработке формиатом аммония и муравьиной кислотой, будут обеспечивать соединение формулы 57.

Схема 18

Как показано на Схеме 18, соединения формулы 58, которые являются типичными представителями соединений формулы (I), где A представляет собой (vii), могут быть получены следующим образом. Соединения формулы 48, где R1 имеет значение, определенное в формуле (I), при их обработке нитрометаном, будут обеспечивать соединения формулы 58 (Organic Preparations и Procedures International, 2001, 33, 381-386).

Схема 19

Как показано на Схеме 19, соединения формулы 60, которые являются типичными представителями соединений формулы (I), где A представляет собой (vi), могут быть получены следующим образом. Соединения формулы 48, где R1 имеет значение, определенное в формуле (I), при их обработке 1-(изоцианометилсульфонил)-4-метилбензолом, 59, и подходящим основанием, таким как, но не ограничиваясь этим, карбонат калия, в растворителе, таком как метанол или тетрагидрофуран, и с последующей обработкой подходящей кислотой, такой как хлористоводородная кислота, будут обеспечивать соединения формулы 60.

Схема 20

Как показано на Схеме 20, соединения формулы 63, которые являются типичными представителями соединений формулы (I), где A представляет собой (vi), могут быть получены следующим образом. Соединения формулы 33, где R1 имеет значение, определенное в формуле (I), при их обработке подходящим хлорирующим агентом, таким как тионилхлорид, будут обеспечивать соединения формулы 61. Соединения формулы 61, при их обработке 2-(триметилсилил)-2H-1,2,3-триазолом, 62, в растворителе, таком как сульфолан, будут обеспечивать соединение формулы 63.

Схема 21

Как показано на Схеме 21, соединения формулы 66, которые являются типичными представителями соединений формулы (I), где A представляет собой (ix), могут быть получены следующим образом. Соединения формулы 61, где R1 имеет значение, определенное в формуле (I), при их обработке гидразином в подходящем растворителе, таком как тетрагидрофуран, будут обеспечивать соединения формулы 64. Соединения формулы 64, при их обработке триметилортоформиатом, 65, в присутствии каталитического количества п-толуолсульфоновой кислоты в растворителе, таком как тетрагидрофуран, будут обеспечивать соединения формулы 66.

Схема 22

Как показано на Схеме 22, соединения формулы 69, которые являются типичными представителями соединений формулы (I), где A определен в формуле (I), могут быть получены следующим образом. Соединения формулы 67, где Ry представляет собой водород, алкил, арил, или две группы Ry вместе с атомом бора, с которым они связаны, образуют 1,3-диоксоборолан, в присутствии палладиевого катализатора с использованием условий реакции Сузуки, описанных на Схеме 1 в присутствии гетероарилиодида (A-I) обеспечивают соединения формулы 68. Соединения формулы 68 преобразуют в соединения формулы 69 путем обработки гидразином, как описано на Схеме 6.

Схема 23

Как показано на Схеме 23, соединения формулы 74, которые являются типичными представителями соединений формулы (I), где Rii и R4 имеют значения, определенные для формулы (I), получают, исходя из соединения формулы 70, где X1 представляет собой иод, бром или хлор. Обработка соединений формулы 70 сначала гидразином, а затем ди-трет-бутилдикарбонатом, как описано на Схеме 6, дает соединения формулы 71. Соединения формулы 71, при их взаимодействии с хлорангидридами кислот формулы 18 в присутствии основания, такого как карбонат калия, в тетрагидрофуране, при температуре окружающей среды, в течение от 2 до 8 часов обеспечивают соединения формулы 72. Альтернативно, соединения формулы 72 могут быть получены из соединений формулы 71 с использованием условий, описанных на Схеме 6. Соединения формулы 72 подвергают взаимодействию с (триметилсилил)ацетиленом в условиях, описанных на Схемах 5 и 6, с получением соединений формулы 73. Соединения формулы 74 получают из соединений формулы 73 путем их обработки Rii-N3 в водном трет-бутаноле, в присутствии сульфата меди(II) и (R)-2-((S)-1,2-дигидроксиэтил)-4-гидрокси-5-оксо-2,5-дигидрофуран-3-олата натрия, при 40-80°C в течение времени от 1 до 6 часов.

Схема 24

Как показано на Схеме 24, соединения формулы 76, которые являются типичными представителями соединений формулы (I), где A и R4 определены для формулы (I), получают из соединений формулы 75. Соединения формулы 75 можно обработать -B(ORy)2, где A имеет значения, определенные для формулы (I), и Ry представляет собой водород, алкил, арил, или две группы Ry вместе с атомом бора, с которым они связаны, образуют 1,3-диоксоборолан, в присутствии палладиевого катализатора, с использованием условий реакции Сузуки, описанных на Схеме 1, с получением соединения формулы 76.

Схема 25

Как показано на Схеме 25, соединения формулы 80, которые являются типичными представителями соединений формулы (I), где Rii и R4 определены для формулы (I), получают следующим образом. Соединения формулы 77 и 78 подвергают взаимодействию в условиях связывания по методу Стилле, описанных на Схеме 3, дают соединения формулы 79. Соединения формулы 79, при взаимодействии, как описано на Схеме 6, обеспечивают соединения формулы 80.

Схема 26

Как показано на Схеме 26, соединения формул 82, 83., 84 и 85, которые являются типичными представителями соединений формулы (I), где A, R4, R5, Ra и Rj имеют значения, определенные для формулы (I), получают из соединений формулы 81. Соединения формулы 81 можно обработать хлорангидридом кислоты, 18, в растворителе, таком как тетрагидрофуран, в присутствии основания, такого как карбонат калия или триэтиламин, с получением соединений формулы 82. Альтернативным растворителем является дихлорметан, и альтернативным основанием является пиридин. Хлорангидриды кислот можно получить из соответствующих карбоновых кислот путем обработки оксалилхлоридом с каталитическим количеством N,N-диметилформамида. Для получения соединений формулы 83, соединения формулы 81 можно обработать RjNCO в нагретом пиридине. Соединения формулы 84 получают из соединений формулы 81 путем обработки R5SO2Cl в пиридине при комнатной температуре или около этого. Соединения формулы 85 также получают из соединений формулы 81 в реакции восстановительного аминирования с RaCHO в присутствии восстановителя, такого как триацетоксиборогидрид натрия или цианоборогидрид натрия, и уксусной кислоты в растворителе, таком как 1,2-дихлорэтан, при комнатной температуре или около этого, и с последующей обработкой трифторуксусной кислотой в дихлорметане для удаления трет-бутоксикарбонильной защитной группы.

Схема 27

Как показано на Схеме 27, соединения формулы 87, где A, Rj и Rk определены для формулы (I), можно получить из соединений формулы 86. Соединения формулы 86 получают, как описано для соединений формулы 82 на Схеме 26. Соединения формулы 86 затем можно подвергнуть нагреванию в присутствии амина, HNRjRk, и основания, такого как триэтиламин, в растворителе, таком как ацетонитрил, с получением соединений формулы 87. Альтернативно, амин можно заменить гетероциклами, такими как пирролидин, пиперидин, пиперазин и морфолин.

Схема 28

Как показано на Схеме 28, соединения формулы 89, где A, R1, R2, R3, m, Zc и Zd определены для формулы (I), можно получить из соединений формулы 88. Соединения формулы 88 можно получить, как описано на Схемах 1-4, 7-9, 22, 24 и 26. В процессе получения соединений формулы 88, карбоновокислотная группа в виде боковой цепи в A может быть защищена в виде сложного эфира и затем гидролизована, оставляя карбоновую кислоту открытой без защиты, способами, которые известны специалистам в области органического синтеза. Соединения формулы 88, при их обработке амином (HNZcZd) с использованием условий связывания карбоновой кислоты-амина, известных специалистам в данной области, будут обеспечивать соединения формулы 89. Стандартные условий связывания карбоновой кислоты- амина включают добавление связывающего реагента, такого как, но не ограничиваясь этим, гидрохлорид 1-(3-диметиламинопропил)-3-этилкарбодиимида (EDCI), 1,3-дициклогексилкарбодиимид (DCC), хлорангидрид бис(2-оксо-3-оксазолидинил)фосфиновой кислоты (BOPCl), гексафторфосфат O-(7-азабензотриазол-1-ил)-N,N,N',N'-тетраметилурония (HATU) или тетрафторборат O-бензотриазол-1-ил-N,N,N',N'-тетраметилурония (TBTU), необязательно в присутствии основания, такого как триэтиламин или диизопропилэтиламин, с использованием или без вспомогательного вещества, такого как, но не ограничиваясь этим, 1-гидрокси-7-азабензотриазол (HOAT) или гидрат 1-гидроксибензотриазола (HOBT), в растворителе, таком как, но не ограничиваясь этим, дихлорметан или N,N-диметилформамид.

ПРИМЕРЫ

Соединения и способы по настоящему изобретению будут лучше понятны при обращении к представленным ниже примерам, которые предназначены в качестве иллюстрации, а не ограничения объема настоящего изобретения.

Пример 1

5-(1-бензил-1H-1,2,3-триазол-5-ил)-1H-индазольное соединение с 5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазолом

Пример 1A

трет-Бутил 5-иод-1H-индазол-1-карбоксилат

К охлажденному на ледяной бане раствору 4-иод-2-метиланилина (20 г, 83,24 ммоль) в хлороформе (250 мл) добавляли по каплям раствор уксусного ангидрида (21,2 г, 208,11 ммоль) в хлороформе (50 мл). По завершении добавления смесь перемешивали при комнатной температуре в течение 1 часа. Добавляли ацетат калия (2,5 г, 24,97 ммоль) и изоамилнитрит (22,3 мл, 166,48 ммоль) и смесь нагревали при 70°C в течение 20 часов. Смесь охлаждали и гасили насыщенным водным раствором NaHCO3 до pH 7. Смесь экстрагировали дихлорметаном и органическую фазу сушили над сульфатом натрия и фильтровали. Растворитель выпаривали при пониженном давлении. Неочищенное твердое вещество промывали метанолом, растворяли в тетрагидрофуране (200 мл) и обрабатывали теплым раствором KOH (60 г) в воде (200 мл). Смесь перемешивали в течение 15 минут и обрабатывали 6н раствором HCl до pH 1. Слои разделяли, органический слой сушили над сульфатом натрия и фильтровали и растворитель выпаривали при пониженном давлении. Неочищенное твердое вещество растворяли в дихлорметане (500 мл) и добавляли триэтиламин (23 мл, 166,48 ммоль) и ди-трет-бутилдикарбонат (23,6 г, 108,2 ммоль) и каталитическое количество диметиламинопиридина (~ 5 мг). Смесь перемешивали при комнатной температуре в течение 2 часов, разбавляли водой, экстрагировали дихлорметаном, сушили при помощи сульфата натрия и фильтровали. Растворитель выпаривали при пониженном давлении с получением указанного в заголовке соединения. MS (ESI+) m/z 344,9 (M+H)+.

Пример 1B

трет-Бутил 5-((триметилсилил)этинил)-1H-индазол-1-карбоксилат

Соединение Примера 1A (10,81 г, 31,4 ммоль), дихлорбис(трифенилфосфин)палладий(II) (1,1 г, 1,57 ммоль) и иодид меди(I) (365 мг, 1,92 ммоль) объединяли в триэтиламине (70 мл) в инертной атмосфере. Добавляли триметилсилилацетилен (5,0 мл, 36,0 ммоль) и смесь перемешивали при 60°C в течение ночи. Растворитель удаляли при пониженном давлении и полученный остаток растворяли в метиленхлориде и промывали 1 н раствором хлористоводородной кислоты. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 215,0 (M-99)+.

Пример 1C

5-Этинил-1H-индазол

Соединение Примера 1B (7,93 г, 25,2 ммоль) растворяли в метаноле (150 мл). Добавляли 1 н раствор гидроксида калия (50 мл) и смесь перемешивали при температуре окружающей среды в течение 1 часа. Растворитель удаляли при пониженном давлении и полученную суспензию растворяли в этилацетате и промывали водой и насыщенным солевым раствором. Органический слой сушили над сульфатом натрия и фильтровали и растворитель удаляли при пониженном давлении с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,24 (с, 1H), 8,10 (с, 1H), 7,95 (с, 1H), 7,55 (д, J=8,82 Гц, 1H), 7,39 (дд, J=8,48, 1,36 Гц, 1H), 4,03 (с, 1H).

Пример 1D

5-(1-бензил-1H-1,2,3-триазол-5-ил)-1H-индазольное соединение с 5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазолом

В сосуд для микроволнового нагрева добавляли 100,0 мг (0,70 ммоль) соединения Примера 1C и 94 мг (0,70 ммоль) бензилазида. Смесь нагревали при 160°C в течение 20 минут с использованием микроволнового облучения (CEM-Discover, 100 Ватт, время повышения температуры до заданного уровня 1 минута). Смесь растворяли в этилацетате и очищали при помощи хроматографии на силикагеле, используя для элюирования 75% этилацетата в гексане, с получением указанных в заголовке соединений. H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,28 (с, 1H), 13,12 (с, 1H), 8,61 (с, 1H), 8,23 (с, 1H), 8,13 (с, 1H), 8,11 (с, 1H), 7,94 (с, 1H), 7,82-7,89 (м, 2H), 7,56-7,70 (м, 2H), 7,20-7,44 (м, 9H), 6,97-7,02 (м, 2H), 5,69 (с, 2H), 5,65 (с, 2H). MS (CI) m/z 276 (M+H)+.

Пример 2

5-(1H-1,2,3-триазол-5-ил)-1H-индазол

В сосуд для микроволнового нагрева добавляли 100,0 мг (0,70 ммоль) соединения Примера 1C, 81 мг (0,7 ммоль) триметилсилилазида, CuI (4 мг) и диметилформамид/метанол (1 мл, 9:1). Смесь нагревали при 160°C в течение 20 минут с использованием микроволнового облучения (CEM-Discover, 100 Ватт, время повышения температуры до заданного уровня 1 минута). Смесь растворяли в этилацетате и органический слой промывали водой. Органический слой сушили над безводным MgSO4, фильтровали и концентрировали при пониженном давлении и очищали при помощи хроматографии на силикагеле, используя для элюирования 80% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,16 (с, 1H), 8,31 (с, 1H), 8,25 (с, 1H), 8,13 (с, 1H), 7,87 (д, J=8,82 Гц, 1H), 7,62 (д, J=8,82 Гц, 1H). MS (CI) m/z 186 (M+H)+.

Пример 3

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол

Пример 3A

трет-Бутил 5-иод-1H-индазол-1-карбоксилат

К охлажденному на ледяной бане раствору 4-иод-2-метиланилина (20 г, 83,24 ммоль) в хлороформе (250 мл) добавляли по каплям через капельную воронку раствор уксусного ангидрида (21,2 г, 208,11 ммоль) в хлороформе (50 мл). По завершении добавления смесь перемешивали при комнатной температуре в течение 1 часа. Добавляли ацетат калия (2,5 г, 24,97 ммоль) и изоамилнитрит (22,3 мл, 166,48 ммоль) и смесь нагревали при 70°C в течение 20 часов. Смесь затем охлаждали и гасили насыщенным водным раствором NaHCO3 до pH 7. Смесь экстрагировали дихлорметаном, сушили над сульфатом натрия, фильтровали и растворитель выпаривали при пониженном давлении. Неочищенное твердое вещество промывали метанолом, растворяли в тетрагидрофуране (200 мл) и обрабатывали теплым раствором KOH (60 г) в воде (200 мл). Смесь перемешивали в течение 15 минут и обрабатывали 6н раствором HCl до pH 1. Слои разделяли, органический слой сушили над сульфатом натрия и фильтровали и растворитель выпаривали при пониженном давлении. Неочищенное вещество растворяли в дихлорметане (500 мл) и триэтиламин (23 мл, 166,48 ммоль) и добавляли ди-трет-бутилдикарбонат (23,6 г, 108,2 ммоль) и каталитическое количество диметиламинопиридина (~5 мг). Смесь перемешивали при комнатной температуре в течение 2 часов, гасили водой, экстрагировали дихлорметаном и сушили над сульфатом натрия и фильтровали. Растворитель выпаривали при пониженном давлении с получением указанного в заголовке соединения. MS (ESI+) m/z 344,9 (M+H)+.

Пример 3B

трет-Бутил 5-((триметилсилил)этинил)-1H-индазол-1-карбоксилат

Соединение Примера 3A, (10,81 г, 31,4 ммоль), дихлорбис(трифенилфосфин)палладий(II) (1,1 г, 1,57 ммоль) и иодид меди(I) (365 мг, 1,92 ммоль) объединяли в триэтиламине (70 мл) в инертной атмосфере. Добавляли триметилсилилацетилен (5,0 мл, 36,0 ммоль) и смесь перемешивали при 60°C в течение ночи. Растворитель удаляли при пониженном давлении и полученный остаток растворяли в метиленхлориде и промывали 1 н раствором хлористоводородной кислоты. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 215,0 (M-99)+.

Пример 3C

5-Этинил-1H-индазол

Соединение Примера 3B (7,93 г, 25,2 ммоль) растворяли в метаноле (150 мл). Добавляли 1н раствор гидроксида калия (50 мл) и смесь перемешивали при температуре окружающей среды в течение 1 часа. Растворитель удаляли при пониженном давлении и полученную суспензию растворяли в этилацетате и промывали водой и насыщенным солевым раствором. Органический слой сушили над сульфатом натрия, фильтровали и растворитель удаляли при пониженном давлении с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,24 (с, 1H), 8,10 (с, 1H), 7,95 (с, 1H), 7,55 (д, J=8,82 Гц, 1H), 7,39 (дд, J=8,48, 1,36 Гц, 1H), 4,03 (с, 1H).

Пример 3D

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол

Соединение Примера 3C (40 мг, 0,28 ммоль), бензилазид (37 мг, 0,28 ммоль), CuSO4 (14 мг, 0,056 ммоль) и медную проволоку (14 мг) объединяли в трет-бутаноле (0,5 мл) и воде (0,5 мл) и нагревали в микроволновом реакторе CEM-Discover в течение 10 минут при 125°C и 100 Ватт. К смеси добавляли 1M HCl и воду, продукт экстрагировали дихлорметаном и очищали при помощи хроматографии на силикагеле (50% этилацетата в гексане) с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,10 (с, 1H), 8,60 (с, 1H), 8,23 (с, 1H), 8,11 (с, 1H), 7,85 (д, J=8,59, 1,53 Гц, 1H), 7,59 (д, J=8,59 Гц, 1H), 7,26-7,49 (м, 5H), 5,65 (с, 2H). MS (ESI+) m/z 276,0 (M+H)+.

Пример 4

5-[1-(2-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

В 5-мл микроволновую реакционную трубку CEM Microwave, которая была снабжена стержневой мешалкой из micro-flea с тефлоновым покрытием добавляли 17,6 мг (0,124 ммоль) соединения Примера 3C, 300 мкл водного раствора, содержащего 7,80 мг (0,118 ммоль) азида натрия; с последующим добавлением 15,79 мкл (0,118 ммоль; 21,80 мг 0,95 эквивалента) 2-метил-бензилбромида (добавляемого без растворителя). К суспензии затем добавляли 300 мкл трет-бутанола; 25 мг медной проволоки; и в завершение 50 мкл 1 н водного раствора пентагидрата сульфата меди. Микроволновой реакционный сосуд затем закрывали крышкой и нагревали при перемешивании в течение 10 минут при 125°C при мощности 100 Ватт в микроволновом устройстве CEM-Discover. После охлаждения до температуры окружающей среды смесь разбавляли 0,25 н водным раствором HCl; и водную суспензию экстрагировали дихлорметаном. Органический слой промывали дистиллированной водой; насыщенным водным раствором NaCl; и затем сушили над безводным сульфатом натрия и фильтровали. Высушеный раствор разбавляли ацетонитрилом; и растворимое органическое вещество затем фильтровали через пробку из стекловаты, на которую сверху был нанесен дополнительный слой безводного сульфата натрия. Аликвоту фильтрата затем отбирали для последующего ЖХ/МС анализа. Те растворы, которые содержали желаемый триазольный продукт, затем упаривали в вакууме и затем снова растворяли в 1,50 мл смеси 1:1 DMSO/метанол. Раствор неочищенного триазольного продукта затем очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода 0,1% ТФУ с получением указанного в заголовке соединения. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,37 (с, 3H), 5,66 (с, 2H), 7,16-7,34 (м, 4H), 7,63 (д, J=8,54 Гц, 1H), 7,87 (д, J=8,70, 1,37 Гц, 1H), 8,14 (с, 1H), 8,25 (с, 1H), 8,49 (с, 1H). MS (ESI+) m/z 289,9 (M+H)+.

Пример 5

5-[1-(3-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-метилбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,58 (с, 1H), 8,25 (с, 1H), 8,14 (с, 1H), 7,87 (д, J=8,85, 1,53 Гц, 1H), 7,64 (д, J=8,54 Гц, 1H), 7,30 (т, J=7,63 Гц, 1H), 7,14-7,24 (м, 3H), 5,60 (с, 2H), 2,31 (с, 3H). MS (ESI+) m/z 289,8 (M+H)+.

Пример 6

5-[1-(4-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-метилбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,55 (с, 1H), 8,24 (с, 1H), 8,14 (с, 1H), 7,86 (д, J=8,54, 1,53 Гц, 1H), 7,63 (д, J=8,85 Гц, 1H), 7,25-7,33 (м, 2H), 7,18-7,24 (м, 2H), 5,59 (с, 2H), 2,29 (с, 3H). MS (ESI+) m/z 290,1 (M+H)+.

Пример 7

5-[1-(3-метоксибензил)-1H-1,2,3-триазол-4-ил]-1H-индазол Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-метоксибензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,59 (с, 1H), 8,25 (с, 1H), 8,14 (с, 1H), 7,87 (д, J=8,54, 1,53 Гц, 1H), 7,64 (д, J=8,85 Гц, 1H), 7,33 (т, J=7,93 Гц, 1H), 6,89-7,00 (м, 3H), 5,62 (с, 2H), 3,76 (с, 3H). MS (ESI+) m/z 306,1 (M+H)+.

Пример 8

5-[1-(2-фторбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2-фторбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,57 (с, 1H), 8,25 (с, 1H), 8,12-8,17 (м, 1H), 7,87 (д, J=8,54, 1,53 Гц, 1H), 7,64 (д, J=8,54 Гц, 1H), 7,41-7,49 (м, J=7,32, 7,32 Гц, 2H), 7,22-7,33 (м, J=7,02 Гц, 2H), 5,71 (с, 2H). MS (ESI+) m/z 293,9 (M+H)+.

Пример 9

5-[1-(3-фторбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-фторбензилбромидом. H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,61 (с, 1H), 8,25 (с, 1H), 8,15 (с, 1H), 7,87 (д, J=8,85, 1,53 Гц, 1H), 7,64 (д, J=8,54 Гц, 1H), 7,41-7,51 (м, 1H), 7,15-7,28 (м, 3H), 5,68 (с, 2H). MS (ESI+) m/z 293,8 (M+H)+.

Пример 10

5-[1-(4-фторбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-фторбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,58 (с, 1H), 8,24 (с, 1H), 8,14 (с, 1H), 7,86 (д, J=8,85, 1,53 Гц, 1H), 7,64 (д, J=8,85 Гц, 1H), 7,46 (д, J=8,85, 5,49 Гц, 2H), 7,24 (т, J=9,00 Гц, 2H), 5,64 (с, 2H). MS (ESI+) m/z 293,9 (M+H)+.

Пример 11

5-[1-(2-хлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2-хлорбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,56 (с, 1H), 8,26 (с, 1H), 8,14 (с, 1H), 7,88 (д, J=8,54, 1,53 Гц, 1H), 7,64 (д, J=8,54 Гц, 1H), 7,55 (д, J=7,63, 1,53 Гц, 1H), 7,32-7,48 (м, 3H), 5,76 (с, 2H). MS (ESI+) m/z 309,8 (M+H)+.

Пример 12

5-[1-(3-хлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-хлорбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,62 (с, 1H), 8,26 (с, 1H), 8,15 (с, 1H), 7,87 (д, J=8,54, 1,53 Гц, 1H), 7,64 (д, J=8,54 Гц, 1H), 7,40-7,49 (м, J=7,63 Гц, 3H), 7,35 (д, J=6,41 Гц, 1H), 5,67 (с, 2H). MS (ESI+) m/z 309,8 (M+H)+.

Пример 13

5-[1-(4-хлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-хлорбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,58 (с, 1H), 8,24 (с, 1H), 8,15 (с, 1H), 7,86 (д, J=8,54, 1,53 Гц, 1H), 7,64 (д, J=8,85 Гц, 1H), 7,45-7,52 (м, 2H), 7,38-7,44 (м, 2H), 5,65 (с, 2H). MS (ESI-) m/z 307,7 (M-H)-.

Пример 14

5-[1-(2-бромбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2-бромбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,55 (с, 1H), 8,26 (с, 1H), 8,14 (с, 1H), 7,88 (д, J=8,54, 1,53 Гц, 1H), 7,72 (д, J=7,93 Гц, 1H), 7,64 (д, J=8,54 Гц, 1H), 7,41-7,50 (м, 1H), 7,27-7,40 (м, 2H), 5,74 (с, 2H). MS (ESI+) m/z 353,5 (M+H)+.

Пример 15

5-[1-(2-нитробензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2-нитробензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,57 (с, 1H), 8,27 (с, 1H), 8,12-8,22 (м, 2H), 7,88 (д, J=8,54, 1,53 Гц, 1H), 7,75-7,83 (м, 1H), 7,60-7,72 (м, 2H), 7,27 (д, J=7,63 Гц, 1H), 6,02 (с, 2H). MS (ESI+) m/z 320,8 (M+H)+.

Пример 16

5-[1-(3-нитробензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-нитробензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,65 (с, 1H), 8,21-8,28 (м, 3H), 8,15 (с, 1H), 7,80-7,91 (м, 2H), 7,73 (т, J=7,78 Гц, 1H), 7,65 (д, J=8,54 Гц, 1H), 5,83 (с, 2H). MS (ESI+) m/z 320,8 (M+H)+.

Пример 17

5-[1-(4-нитробензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-нитробензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,64 (с, 1H), 8,22-8,31 (м, 3H), 8,15 (с, 1H), 7,88 (д, J=8,70, 1,37 Гц, 1H), 7,57-7,68 (м, 3H), 5,83 (с, 2H). MS (ESI+) m/z 320,7 (M+H)+.

Пример 18

2-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил} бензонитрил

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2-цианобензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,61 (с, 1H), 8,26 (с, 1H), 8,15 (с, 1H), 7,93 (д, J=7,63 Гц, 1H), 7,88 (д, J=8,54, 1,53 Гц, 1H), 7,72-7,80 (м, 1H), 7,57-7,68 (м, 2H), 7,53 (д, J=7,93 Гц, 1H), 5,86 (с, 2H). MS (ESI+) m/z 300,9 (M+H)+.

Пример 19

3-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил} бензонитрил

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-цианобензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,63 (с, 1H), 8,26 (с, 1H), 8,15 (с, 1H), 7,85-7,93 (м, 2H), 7,83 (д, J=7,63 Гц, 1H), 7,72 (д, J=8,24 Гц, 1H), 7,56-7,68 (м, 2H), 5,74 (с, 2H). MS (ESI+) m/z 300,9 (M+H)+.

Пример 20

4-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил} бензонитрил

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-цианобензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,62 (с, 1H), 8,26 (с, 1H), 8,15 (с, 1H), 7,82-7,93 (м, J=8,24 Гц, 3H), 7,65 (д, J=8,54 Гц, 1H), 7,54 (д, J=8,24 Гц, 2H), 5,78 (с, 2H). MS (ESI+) m/z 300,7 (M+H)+.

Пример 21

5-{1-[2-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2-трифторметилбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,56 (с, 1H), 8,27 (с, 1H), 8,15 (с, 1H), 7,89 (д, J=8,85, 1,53 Гц, 1H), 7,85 (д, J=7,93 Гц, 1H), 7,72 (т, J=7,63 Гц, 1H), 7,55-7,68 (м, 2H), 7,33 (д, J=7,93 Гц, 1H), 5,85 (с, 2H). MS (ESI+) m/z 300,7 (M+H)+.

Пример 22

5-{1-[3-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-трифторметилбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,65 (с, 1H), 8,25 (с, 1H), 8,14 (с, 1H), 7,87 (д, J=8,70, 1,37 Гц, 1H), 7,77 (с, 1H), 7,71-7,76 (м, 1H), 7,61-7,69 (м, 3H), 5,78 (с, 2H). MS (ESI+) m/z 344,0 (M+H)+.

Пример 23

5-{1-[4-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-трифторметилбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,63 (с, 1H), 8,25 (с, 1H), 8,14 (с, 1H), 7,87 (д, J=8,54 Гц, 1H), 7,78 (д, J=7,93 Гц, 2H), 7,63 (д, J=8,54 Гц, 1H), 7,58 (д, J=7,93 Гц, 2H), 5,78 (с, 2H). MS (ESI+) m/z 344,2 (M+H)+.

Пример 24

5-{1-[3-(трифторметокси)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-трифторметоксибензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,64 (с, 1H), 8,25 (с, 1H), 8,14 (с, 1H), 7,87 (д, J=8,54 Гц, 1H), 7,64 (д, J=8,54 Гц, 1H), 7,56 (т, J=8,24 Гц, 1H), 7,31-7,45 (м, 3H), 5,73 (с, 2H). MS (ESI+) m/z 359,9 (M+H)+.

Пример 25

5-{1-[4-(трифторметокси)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-трифторметоксибензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,61 (с, 1H), 8,25 (с, 1H), 8,14 (с, 1H), 7,87 (д, J=8,70, 1,37 Гц, 1H), 7,63 (д, J=8,54 Гц, 1H), 7,52 (д, J=8,85 Гц, 2H), 7,40 (д, J=8,24 Гц, 2H), 5,70 (с, 2H). MS (ESI+) m/z 359,9 (M+H)+.

Пример 26

5-[1-(4-трет-бутилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-трет-бутилбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,58 (с, 1H), 8,24 (с, 1H), 8,13 (с, 1H), 7,86 (д, J=8,85, 1,53 Гц, 1H), 7,63 (д, J=8,54 Гц, 1H), 7,42 (д, J=8,24 Гц, 2H), 7,32 (д, J=8,24 Гц, 2H), 5,60 (с, 2H), 1,26 (с, 9H). MS (ESI+) m/z 332,1 (M+H)+.

Пример 27

метил 3-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил} бензоат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3-карбометоксибензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,62 (с, 1H), 8,25 (с, 1H), 8,14 (с, 1H), 7,92-7,99 (м, 2H), 7,87 (д, J=8,54, 1,53 Гц, 1H), 7,68 (д, J=7,63 Гц, 1H), 7,63 (д, J=8,54 Гц, 1H), 7,58 (т, J=7,63 Гц, 1H), 5,75 (с, 2H), 3,86 (с, 3H). MS (ESI+) m/z 333,9 (M+H)+.

Пример 28

метил 4-{[4-(1H-индазол-5-ил)-1H-1,2,3-триазол-1-ил]метил}бензоат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 4-карбометоксибензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,62 (с, 1H), 8,25 (с, 1H), 8,14 (с, 1H), 7,99 (д, J=8,24 Гц, 2H), 7,87 (д, J=8,85 Гц, 1H), 7,63 (д, J=8,54 Гц, 1H), 7,49 (д, J=8,24 Гц, 2H), 5,76 (с, 2H), 3,85 (с, 3H). MS (ESI+) m/z 333,9 (M+H)+.

Пример 29

5-[1-(2,4-диметилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2,4-диметилбензилхлорид. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,45 (с, 1H), 8,24 (с, 1H), 8,13 (с, 1H), 7,86 (д, J=8,54 Гц, 1H), 7,62 (д, J=8,54 Гц, 1H), 7,12 (д, J=7,93 Гц, 1H), 7,07 (с, 1H), 7,04 (д, J=7,63 Гц, 1H), 5,60 (с, 2H), 2,32 (с, 3H), 2,26 (с, 3H). MS (ESI+) m/z 304,0 (M+H)+.

Пример 30

5-[1-(3,5-диметилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3,5-диметилбензилбромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,56 (с, 1H), 8,24 (с, 1H), 8,13 (с, 1H), 7,87 (д, J=8,54 Гц, 1H), 7,63 (д, J=8,54 Гц, 1H), 6,95-7,01 (м, 3H), 5,55 (с, 2H), 2,26 (с, 6H). MS (ESI+) m/z 304,2 (M+H)+.

Пример 31

5-[1-(2,3-дихлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2,3-дихлорбензилхлоридом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,59 (с, 1H), 8,26 (с, 1H), 8,14 (с, 1H), 7,88 (д, J=8,70, 1,37 Гц, 1H), 7,69 (д, J=8,09, 1,37 Гц, 1H), 7,63 (д, J=8,54 Гц, 1H), 7,44 (т, J=7,78 Гц, 1H), 7,31 (д, J=7,78, 1,07 Гц, 1H), 5,81 (с, 2H). MS (ESI+) m/z 343,8 (M+H)+.

Пример 32

5-[1-(2,4-дихлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2,4-дихлорбензилхлоридом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,56 (с, 1H), 8,25 (с, 1H), 8,13 (с, 1H), 7,87 (д, J=8,54 Гц, 1H), 7,72 (д, J=2,14 Гц, 1H), 7,63 (д, J=8,54 Гц, 1H), 7,50 (д, J=8,39, 1,98 Гц, 1H), 7,40 (д, J=8,24 Гц, 1H), 5,74 (с, 2H). MS (ESI-) m/z 341,8 (M-H)-.

Пример 33

5-[1-(2,5-дихлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2,5-дихлорбензилхлоридом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,59 (с, 1H), 8,26 (с, 1H), 8,14 (с, 1H), 7,88 (д, J=8,85 Гц, 1H), 7,63 (д, J=8,85 Гц, 1H), 7,56-7,61 (м, 1H), 7,49-7,55 (м, 1H), 7,47 (д, J=2,44 Гц, 1H), 5,75 (с, 2H). MS (ESI+) m/z 343,8 (M+H)+.

Пример 34

5-[1-(3,5-дихлорбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 3,5-дихлорбензилхлоридом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,64 (с, 1H), 8,26 (с, 1H), 8,15 (с, 1H), 7,87 (д, J=8,85 Гц, 1H), 7,57-7,71 (м, 2H), 7,44 (д, J=1,53 Гц, 2H), 5,69 (с, 2H). MS (ESI+) m/z 344,1 (M+H)+.

Пример 35

5-{1-[2,4-бис(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 4, с замещением 2-метилбензилбромида 2,4-бис(трифторметил)бромидом. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,62 (с, 1H), 8,27 (с, 1H), 8,07-8,18 (м, 3H), 7,89 (д, J=8,70, 1,37 Гц, 1H), 7,64 (д, J=8,54 Гц, 1H), 7,49 (д, J=7,93 Гц, 1H), 5,96 (с, 2H). MS (ESI+) m/z 411,7 (M+H)+.

Пример 36

N-циклогексил-6-(1H-индазол-5-ил)имидазо[2,1-b][1,3]тиазол-5-амин

Пример 36A

1H-индазол-5-карбальдегид

К раствору 5-броминдазола (5 г, 25,38 ммоль) в тетрагидрофуране (100 мл), охлажденному при -50°C, в атмосфере аргона добавляли по каплям раствор 1,6 M н-бутиллития в гексане (40 мл, 63,44 ммоль). Добавляли диметилформамид (3,9 мл, 50,75 ммоль) и смеси давали нагреться до комнатной температуры и перемешивали в течение 15 минут. Смесь затем гасили водой, экстрагировали этилацетатом, предварительно абсорбировали на силикагель и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-30% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 10,03 (с, 1H), 8,45 (с, 1H), 8,35 (с, 1H), 7,85 (дд, J=8,70, 1,37 Гц, 1H), 7,69 (д, J=8,54 Гц, 1H).

Пример 36B

N-циклогексил-6-(1H-индазол-5-ил)имидазо[2,1-b][1,3]тиазол-5-амин

Соединение Примера 36A (50 мг, 0,34 ммоль) и 2-аминотиазол (28 мг, 0,34 ммоль) объединяли со скандийтрифлатом (8 мг, 0,017 ммоль) в безводном метаноле (1 мл) в 4-мл сосуде. Сосуд герметично закрывали и встряхивали при температуре окружающей среды в течение 30 минут. Добавляли циклогексилизоцианид (42 мл, 0,34 ммоль) и смесь встряхивали в течение 2 дней при комнатной температуре. Смесь очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода 0,1% ТФУ с получением указанного в заголовке соединения в форме соли ТФУ. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,12 (с, 1H), 8,32 (с, 1H), 8,13 (с, 1H), 8,05 (д, J=8,85, 1,22 Гц, 1H), 7,92 (д, J=4,27 Гц, 1H), 7,60 (д, J=8,54 Гц, 1H), 7,37 (д, J=3,66 Гц, 1H), 4,89 (с, 1H), 2,78-2,94 (м, 1H), 1,73-1,83 (м, 2H), 1,58-1,68 (м, 2H), 1,45-1,53 (м, 1H), 1,16-1,29 (м, 2H), 1,04-1,14 (м, 3H). MS (ESI+) m/z 338,1 (M+H)+.

Пример 37

N-циклогексил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиридин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 36B, с замещением 2-аминотиазола 2-аминопиридином. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,04 (с, 1H), 8,57 (с, 1H), 8,23-8,39 (м, 2H), 8,11 (с, 1H), 7,57 (д, J=8,54 Гц, 1H), 7,46 (д, J=8,85 Гц, 1H), 7,12-7,21 (м, 1H), 6,88 (т, J=6,71 Гц, 1H), 4,78 (д, J=5,80 Гц, 1H), 2,78-2,91 (м, 1H), 1,69-1,77 (м, J=10,98 Гц, 2H), 1,57-1,67 (м, 2H), 1,45-1,53 (м, 1H), 1,21-1,34 (м, 2H), 1,01-1,16 (м, 3H). MS (ESI+) m/z 332,1 (M+H)+.

Пример 38

N-циклогексил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиразин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 36B, с замещением 2-аминотиазола 2-аминопиразином. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,12 (с, 1H), 8,90 (д, J=1,22 Гц, 1H), 8,61 (с, 1H), 8,37 (д, J=4,58, 1,53 Гц, 1H), 8,29 (д, J=8,70, 1,37 Гц, 1H), 8,15 (с, 1H), 7,85 (д, J=4,58 Гц, 1H), 7,62 (д, J=8,85 Гц, 1H), 5,05 (д, J=6,71 Гц, 1H), 2,81-2,99 (м, 1H), 1,70-1,77 (м, J=10,68 Гц, 2H), 1,58-1,67 (м, 2Н), 1,47 (с, 1Н), 1,24-1,38 (м, 2Н), 1,00-1,16 (м, 3Н). MS (ESI+) m/z 333,1 (М+Н)+.

Пример 39

5- [1-бензил-4-(4-фторфенил)-1Н-имидазол-5-ил]-1Н-индазол

В 20-мл сцинтилляционный сосуд добавляли 50,0 мг (0,34 ммоль) соединения Примера 36А. К этому твердому веществу добавляли 2,0 мл раствора диметилформамида, содержащего 0,46 ммоль (49 мг) бензиламина и 50 мг порошкообразных активированных 4Å молекулярных сит. Сосуд затем закрывали крышкой и нагревали при 60°С в течение 4 часов на орбитальном встряхивающем устройстве. Сосуду давали охладиться до температуры окружающей среды; и крышку открывали. К суспензии добавляли 32 мг (0,23 ммоль) безводного карбоната калия с последующим добавлением 66 мг (0,23 ммоль) α-(п-толуолсульфонил)-4-фторбензилизонитрила. Сосуд затем закрывали крышкой и нагревали в течение ночи при 60°С на встряхивающем устройстве. Сосуд удаляли из встряхивающего устройства; давали охладиться до температуры окружающей среды; и полученную суспензию фильтровали. Фильтрат упаривали при пониженном давлении при умеренном нагревании на Savant Speed Vac. Неочищенные остатки снова растворяли в смеси 1:1 DMSO/метанол и очищали при помощи обращенно-фазовой ВЭЖХ с использованием градиентного элюирования ацетонитрил/вода ТФУ метода с получением указанного в заголовке соединения в форме соли ТФУ. 1Н ЯМР (300 МГц, ДМСО-d6) δ м.д. 9,01 (с, 1Н), 8,12 (с, 1Н), 7,76 (с, 1Н), 7,60 (д, J=8,48 Гц, 2Н), 7,32-7,45 (м, 2Н), 7,09-7,30 (м, 6Н), 6,96 (д, J=6,61, 2,88 Гц, 2Н), 5,23 (с, 2Н). MS (ECI) m/z 369 (М+Н)+.

Пример 40

N-{3-[4-(4-фторфенил)-5-(1H-индазол-5-ил)-1H-индазол-1-ил]пропил}-N,N-диметиламин

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 39, с замещением бензиламина N1,N1-диметилпропан-1,3-диамином. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 9,49 (с, 1H), 8,88 (с, 1H), 8,19 (с, 1H), 7,94 (с, 1H), 7,73 (д, J=8,81 Гц, 1H), 7,29-7,44 (м, 3H), 7,17 (т, J=8,98 Гц, 2H), 4,01 (т, J=7,12 Гц, 2H), 2,89-3,04 (м, J=10,51 Гц, 2H), 2,68 (с, 3H), 2,67 (с, 3H), 1,87-2,02 (м, 2H). MS (ECI) m/z 364 (M+H)+.

Пример 41

N-циклогексил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-амин

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии процедурой, описанной в Примере 36B, с использованием пиримидин-2-амина вместо тиазол-2-амина. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,21-13,41 (м, 1H), 9,07 (д, J=5,80 Гц, 1H), 8,85 (д, J=3,05 Гц, 1H), 8,51 (с, 1H), 8,24 (с, 1H), 8,14 (д, J=8,70, 1,37 Гц, 1H), 7,73 (д, J=8,85 Гц, 1H), 7,47-7,56 (м, 1H), 5,25-5,41 (м, J=2,75 Гц, 1H), 2,81-2,91 (м, J=10,53, 10,53 Гц, 1H), 1,74-1,83 (м, 2H), 1,56-1,66 (м, 2H), 1,43-1,50 (м, 1H), 1,24 (кв., J=1 1,09 Гц, 2H), 1,00-1,14 (м, 3H). MS (ESI+) m/z 333,1 (M+H)+.

Пример 42

5-[4-(4-фторфенил)-1-(1-фенилэтил)-1H-индазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 1-фенилэтанамина вместо бензиламина. 1H ЯМР (300 МГц, CDCl3) δ м.д. 8,04 (с, 1H), 7,75-7,84 (м, 1H), 7,35-7,55 (м, 4H), 7,20-7,31 (м, 5H), 6,76-7,01 (м, 4H), 5,09 (кв., J=7,12 Гц, 1H), 1,82 (д, 3H). MS (ECI) m/z 383 (M+H)+.

Пример 43

2-(1H-индазол-5-ил)-N-изопропилимидазо[1,2-a]пиримидин-3-амин

Соединение Примера 36A (42 мг, 0,287 ммоль) и 2-аминопиримидин (27 мг, 0,284 ммоль) объединяли со скандийтрифлатом (7 мг, 0,014 ммоль) в безводном метаноле (2 мл) в 4-мл сосуде. Сосуд герметично закрывали и встряхивали при температуре окружающей среды в течение 30 минут. Добавляли изопропилизоцианид (27 мл, 0,286 ммоль) и смесь встряхивали при температуре окружающей среды в течение ночи, а затем при 40°C в течение 2 часов. Смесь абсорбировали на силикагеле и очищали хроматографией на силикагеле с использованием для элюирования градиента 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,08 (с, 1H), 8,75 (д, J=6,95, 1,86 Гц, 1H), 8,60 (с, 1H), 8,31 (д, J=8,82, 1,36 Гц, 1H), 8,20 (д, J=4,75 Гц, 1H), 8,14 (с, 1H), 7,60 (д, J=8,82 Гц, 1H), 7,03 (д, J=6,78, 4,07 Гц, 1H), 6,54 (д, J=4,75 Гц, 1H), 4,86 (д, J=5,09 Гц, 1H), 1,05 (д, J=6,10 Гц, 6H). MS (ESI+) m/z 293,0 (M+H)+.

Пример 44

4-(1H-индазол-5-ил)-N-фенил-1,3-тиазол-2-амин

Пример 44A

трет-Бутил 5-бром-1H-индазол-1-карбоксилат

5-Броминдазол (4,40 г, 22,3 ммоль) и каталитическое количество диметиламинопиридина (~50 мг) растворяли в дихлорметане (100 мл). Добавляли ди-трет-бутилдикарбонат (5,43 г, 24,9 ммоль) и смесь перемешивали при температуре окружающей среды в течение ночи. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 297,2 (M+H)+.

Пример 44B

трет-Бутил 5-ацетил-1H-индазол-1-карбоксилат

Соединение Примера 44A (5,12 г, 17,2 ммоль), трибутил(1-этоксивинил)олово (7,0 мл, 20,7 ммоль) и дихлорбис(трифенилфосфин)палладий(II) (672 мг, 0,957 ммоль) объединяли в толуоле (85 мл). В смесь барботировали азот в течение 5 минут и смесь нагревали до 100°C в герметично закрытой пробирке в течение ночи. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 283,0 (M+Na)+.

Пример 44C

трет-Бутил 5-(2-бромацетил)-1H-индазол-1-карбоксилат

Соединение Примера 44B (1,60 г, 6,15 ммоль) и трибромид пиридиния (1,98 г, 6,19 ммоль) объединяли в тетрагидрофуране и нагревали до 40°C в течение 2 часов. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 360,9 (M+Na)+.

Пример 44D

4-(1H-индазол-5-ил)-N-фенил-1,3-тиазол-2-амин

Соединение Примера 44C (71 мг, 0,208 ммоль) и 1-фенил-2-тиомочевину (33 мг, 0,217 ммоль) объединяли в этаноле (300 мл) в 4-мл сосуде. Сосуд встряхивали при 80°C в течение ночи. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент метанол в дихлорметане (0-5%), с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,08 (с, 1H), 10,23 (с, 1H), 8,32 (с, 1H), 8,14 (с, 1H), 7,93 (д, J=8,59, 1,53 Гц, 1H), 7,75 (д, J=8,75, 1,07 Гц, 1H), 7,58 (д, J=8,90 Гц, 1H), 7,36 (д, J=8,59, 7,36 Гц, 1H), 7,25 (с, 1H), 6,92-7,02 (м, 1H). MS (ESI+) m/z 292,9 (M+H)+.

Пример 45

5-(2-метил-1,3-тиазол-4-ил)-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 44D, с замещением 1-фенил-2-тиомочевины тиоацетамидом. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,10 (с, 1H), 8,34 (с, 1H), 8,12 (с, 1H), 7,94 (д, J=8,82, 1,70 Гц, 1H), 7,85 (с, 1H), 7,57 (д, J=8,82 Гц, 1H), 2,73 (с, 3H). MS (ESI+) m/z 215,9 (M+H)+.

Пример 46

N-этил-4-(1H-индазол-5-ил)-1,3-тиазол-2-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 44D, с замещением 1-фенил-2-тиомочевины этилтиомочевиной. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,04 (с, 1H), 8,21 (с, 1H), 8,09 (с, 1H), 7,83 (д, J=8,65, 1,53 Гц, 1H), 7,58 (т, J=5,43 Гц, 1H), 7,51 (д, J=8,82 Гц, 1H), 6,96 (с, 1H), 3,22-3,34 (м, 2H), 1,21 (т, J=7,29 Гц, 3H). MS (ESI+) m/z 244,9 (M+H)+.

Пример 47

N-бензил-4-(1H-индазол-5-ил)-1,3-тиазол-2-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 44D, с замещением 1-фенил-2-тиомочевины 1-бензил-2-тиомочевиной. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,02 (с, 1H), 8,21 (с, 1H), 8,12 (т, J=5,83 Гц, 1H), 8,08 (с, 1H), 7,83 (д, J=8,90, 1,53 Гц, 1H), 7,50 (д, J=8,90 Гц, 1H), 7,39-7,45 (м, 2H), 7,35 (т, J=7,52 Гц, 2H), 7,26 (т, J=7,21 Гц, 1H), 6,97 (с, 1H), 4,54 (д, J=5,83 Гц, 1H). MS (ESI+) m/z 306,9 (M+H)+.

Пример 48

4-(1H-индазол-5-ил)-1,3-тиазол-2-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 44D, с замещением 1-фенил-2-тиомочевины тиомочевиной. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,03 (с, 1H), 8,17 (с, 1H), 8,07 (с, 1H), 7,81 (д, J=8,82, 1,36 Гц, 1H), 7,50 (д, J=8,82 Гц, 1H), 7,01 (с, 2H), 6,92 (с, 1H). MS (ESI+) m/z 216,9 (M+H)+.

Пример 49

4-(1H-индазол-5-ил)-N-(2-фенилэтил)-1,3-тиазол-2-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 44D с замещением 1-фенил-2-тиомочевины 1-фенэтилтиомочевиной. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,03 (с, 1H), 8,23 (с, 1H), 8,09 (с, 1H), 7,85 (д, J=8,65, 1,53 Гц, 1H), 7,71 (т, J=5,43 Гц, 1H), 7,51 (д, J=8,82 Гц, 1H), 7,26-7,36 (м, 4H), 7,18-7,26 (м, 1H), 6,97 (с, 1H), 3,47-3,59 (м, 1H), 2,94 (т, J=7,44 Гц, 1H). MS (ESI+) m/z 321,0 (M+H)+.

Пример 50

N-бензил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 43, с использованием бензилизоцианида вместо изопропилизоцианида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,10 (с, 1H), 8,50-8,58 (м, 2H), 8,39 (д, J=4,07, 2,03 Гц, 1H), 8,25 (д, J=8,81, 1,36 Гц, 1H), 8,13 (с, 1H), 7,61 (д, J=8,81 Гц, 1H), 7,24 (с, 5H), 6,92 (д, J=6,78, 4,07 Гц, 1H), 5,44 (т, J=6,27 Гц, 1H), 4,13 (д, J=6,10 Гц, 2H). MS (ESI+) m/z 341,0 (M+H)+.

Пример 51

N-бутил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 43, с использованием бутилизоцианида вместо изопропилизоцианида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,09 (с, 1H), 8,70 (д, J=6,78, 2,03 Гц, 1H), 8,55 (с, 1H), 8,44 (д, J=4,07, 2,03 Гц, 1H), 8,25 (д, J=8,82, 1,36 Гц, 1H), 8,14 (с, 1H), 7,61 (д, J=8,82 Гц, 1H), 7,03 (д, J=6,78, 4,07 Гц, 1H), 4,90 (т, J=5,93 Гц, 1H), 2,96 (с, 2H), 1,49 (с, 2H), 1,34 (с, 2H), 0,82 (т, J=7,29 Гц, 3H). MS (ESI+) m/z 307,0 (M+H)+.

Пример 52

N-(4-хлорфенил)-2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 43, с использованием 4-хлорфенилизоцианида вместо изопропилизоцианида. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,12 (с, 1H), 8,58 (дд, J=4,12, 1,98 Гц, 1H), 8,46 (д, J=15,87 Гц, 2H), 8,40 (дд, J=6,71, 1,83 Гц, 1H), 8,06-8,16 (м, 2H), 7,58 (д, J=8,85 Гц, 1H), 7,18 (д, J=8,85 Гц, 2H), 7,05 (дд, J=6,71, 3,97 Гц, 1H), 6,57 (д, J=8,85 Гц, 2H). MS (ESI+) m/z 361,0 (M+H)+.

Пример 53

2-(1H-индазол-5-ил)-N-(4-метоксифенил)имидазо[1,2-a]пиримидин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 43, с использованием 4-метоксифенилизоцианида вместо изопропилизоцианида. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,10 (с, 1H), 8,56 (дд, J=3,97, 2,14 Гц, 1H), 8,47 (с, 1H), 8,36 (дд, J=6,56, 1,98 Гц, 1H), 8,15 (дд, J=8,70, 1,37 Гц, 1H), 8,10 (с, 1H), 7,99 (с, 1H), 7,57 (д, J=8,54 Гц, 1H), 7,03 (дд, J=6,71, 4,27 Гц, 1H), 6,76 (д, J=8,85 Гц, 2H), 6,50 (д, J=8,85 Гц, 2H), 3,63 (с, 3H). MS (ESI+) m/z 357,4 (M+H)+.

Пример 54

2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 44D, с использованием 2-аминопиримидина вместо 1-фенил-2-тиомочевины. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,13 (с, 1H), 8,96 (дд, J=6,78, 2,03 Гц, 1H), 8,51 (дд, J=4,41, 2,03 Гц, 1H), 8,42 (с, 1H), 8,36 (с, 1H), 8,15 (с, 1H), 8,01 (дд, J=8,82, 1,70 Гц, 1H), 7,62 (д, J=8,48 Гц, 1H), 7,04 (дд, J=6,61, 4,24 Гц, 1H). MS (ESI+) m/z 236,1 (M+H)+.

Пример 55

метил N-[2-(1H-индазол-5-ил)имидазо[1,2-a]пиридин-3-ил]глицинат

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 36B, с использованием 2-аминопиридина вместо 2-аминотиазола и метил 2-изоцианоацетата вместо циклогексилизоцианида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,41 (с, 1H), 8,90 (д, J=6,75 Гц, 1H), 8,38 (с, 1H), 8,27 (с, 1H), 7,84-7,98 (м, 3H), 7,77 (д, J=8,90 Гц, 1H), 7,55 (тд, J=6,75, 1,23 Гц, 1H), 5,95-6,06 (м, 1H), 3,87 (д, J=4,60 Гц, 2H), 3,51 (с, 3H). MS (ESI+) m/z 340,1 (M+H)+.

Пример 56

N-бензил-2-(1H-индазол-5-ил)имидазо[1,2-a]пиридин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 36B, с использованием 2-аминопиридина вместо 2-аминотиазола и бензилизоцианида вместо циклогексилизоцианида. Конечный продукт осаждался из раствора с образрованием осадка, и его выделяли после фильтрации. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,04 (с, 1H), 8,49 (с, 1H), 8,16-8,27 (м, 2H), 8,09 (с, 1H), 7,58 (д, J=8,90 Гц, 1H), 7,44 (д, J=8,90 Гц, 1H), 7,19-7,35 (м, 5H), 7,13 (ддд, J=8,98, 6,67, 0,92 Гц, 1H), 6,80 (тд, J=6,75, 0,92 Гц, 1H), 5,32 (т, J=6,14 Гц, 1H), 4,12 (д, J=6,14 Гц, 2H). MS (ESI+) m/z 322,1 (M+H)+.

Пример 57

N-(4-хлорфенил)-2-(1H-индазол-5-ил)имидазо[1,2-a]пиридин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 36B, с использованием 2-аминопиридина вместо 2-аминотиазола и 1-хлор-4-изоцианобензола вместо циклогексилизоцианида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,06 (с, 1H), 8,39 (с, 2H), 8,05-8,14 (м, 2H), 7,94 (д, J=6,75 Гц, 1H), 7,62 (д, J=8,90 Гц, 1H), 7,55 (д, J=8,59 Гц, 1H), 7,28-7,34 (м, 1H), 7,17 (д, J=8,90 Гц, 2H), 6,88-6,96 (м, J=6,75, 6,75 Гц, 1H), 6,53 (д, J=8,59 Гц, 2H). MS (ESI+) m/z 360,0 (M+H)+.

Пример 58

2-(1H-индазол-5-ил)-N-(4-метоксифенил)имидазо[1,2-a]пиридин-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 36B, с использованием 2-аминопиридина вместо 2-аминотиазола и 1-изоциано-4-метоксибензола вместо циклогексилизоцианида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,04 (с, 1H), 8,44 (с, 1H), 8,14 (д, J=8,90, 1,23 Гц, 1H), 8,06 (с, 1H), 7,87-7,96 (м, 2H), 7,59 (д, J=8,90 Гц, 1H), 7,54 (д, J=8,59 Гц, 1H), 7,24-7,33 (м, 1H), 6,86-6,93 (м, J=6,75, 6,75 Гц, 1H), 6,75 (д, J=9,21 Гц, 2H), 6,47 (д, J=9,21 Гц, 2H), 3,63 (с, 3H). MS (ESI+) m/z 356,1 (M+H)+.

Пример 59

трет-бутил 4-[4-(4-фторфенил)-5-(1H-индазол-5-ил)-1H-имидазол-1-ил]пиперидин-1-карбоксилат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием трет-бутил 4-аминопиперидин-1-карбоксилата вместо бензиламина. 1H ЯМР (400 МГц, ДМСО-d5) δ м.д. 13,32 (с, 1H), 8,14 (с, 1H), 8,01 (с, 1H), 7,79 (с, 1H), 7,68 (д, J=8,59 Гц, 2H), 7,24-7,39 (м, 2H), 6,97 (т, J=8,90 Гц, 2H), 3,91-4,05 (м, 2H), 3,71-3,84 (м, 1H), 2,53-2,69 (м, 2H), 1,76-1,94 (м, 4H), 1,35-1,40 (м, 9H). MS (DCI) m/z 462 (M+H)+.

Пример 60

3,5-бис(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол

Пример 60A

трет-Бутил 5-бром-3-иод-1H-индазол-1-карбоксилат

К раствору 5-броминдазола (10 г, 50,75 ммоль) в диметилформамиде (100 мл) добавляли KOH (10 г, 177,63 ммоль). В течение 2 часов добавляли иод (20 г, 78,80 ммоль). Смесь обрабатывали раствором Na2S2O3 (20 г) в воде (200 мл), экстрагировали этилацетатом, промывали насыщенным солевым раствором, сушили над сульфатом натрия и фильтровали и растворитель удаляли при пониженном давлении. Твердое вещество растворяли в дихлорметане (350 мл) и обрабатывали ди-трет-бутилдикарбонатом (14,4 г, 65,98 ммоль) и диметиламинопиридином (10 мг, 0,08 ммоль). Смесь перемешивали в течение 20 минут при комнатной температуре и пропускали непосредственно через слой силикагеля с получением указанного в заголовке соединения. MS (DCI/NH3) m/z 422,9 (M+H)+.

Пример 60B

трет-бутил 5-бром-3-фенил-1H-индазол-1-карбоксилат и трет-бутил 5-бром-3-иод-1H-индазол-1-карбоксилат

К раствору соединения Примера 60A (2,1 г, 5 ммоль) в толуоле (10 мл) добавляли Pd(PPh3)4 (173 мг, 0,15 ммоль), раствор Na2CO3 (1,1 г, 10 ммоль) в воде (5 мл) и раствор фенилбороновой кислоты (671 мг, 5,5 ммоль) в метаноле (3 мл). Смесь перемешивали при комнатной температуре в течение 5 дней, гасили водой, экстрагировали этилацетатом и очищали при помощи хроматографии на силикагеле, используя для элюирования смесь 5% этилацетата/гексан, с получением указанных в заголовке соединений в виде смеси. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 8,28 (д, J=1,53 Гц, 1H), 8,12 (д, J=8,85 Гц, 1H), 7,97-8,04 (м, 3H), 7,80-7,86 (м, 2H), 7,75 (д, J=1,83 Гц, 1H), 7,54-7,63 (м, 3H), 1,68 (с, 9H), 1,64 (с, 9H). MS (ESI+) m/z 373,9 (M+H)+.

Пример 60C

трет-Бутил 3,5-бис((триметилсилил)этинил)-1H-индазол-1-карбоксилат и трет-бутил 5-бром-3-((триметилсилил)этинил)-1H-индазол-1-карбоксилат

Соединение Примера 60B (1 г, 2,55 ммоль), дихлорбис(трифенилфосфин)палладий(II) (89 мг, 0,13 ммоль), триэтиламин (1,78 мл, 12,75 ммоль), триметилсилилацетилен (0,432 мл, 3,06 ммоль) и CuI (24 мг, 0,13 ммоль) объединяли в диметилформамиде (10 мл) и перемешивали при комнатной температуре в течение 20 часов. Смесь разбавляли этилацетатом, промывали водой и очищали при помощи хроматографии на силикагеле с получением указанных в заголовке соединений. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 8,10 (д, J=8,85 Гц, 1H), 8,07 (д, J=8,85 Гц, 1H), 7,97 (д, J=1,83 Гц, 1H), 7,84 (с, 1H), 7,82 (дд, J=8,85, 1,83 Гц, 1H), 7,71 (дд, J=8,54, 1,53 Гц, 1H), 1,65 (с, 18H), 0,33 (д, J=0,92 Гц, 18H).

Пример 60D

трет-бутил 3, 5-диэтинил-1H-индазол-1-карбоксилат и трет-бутил 5-бром-3-этинил-1H-индазол-1-карбоксилат

К раствору соединения Примера 60C (350 мг, 0,85 ммоль) в тетрагидрофуране (5 мл) добавляли раствор 1M TBAF в тетрагидрофуране (2 мл, 2 ммоль). Через 10 минут растворитель выпаривали при пониженном давлении и неочищенную смесь очищали при помощи хроматографии на силикагеле, элюируя смесью 5% этилацетата в гексане, с получением указанных в заголовке соединений. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 8,12 (д, J=7,93 Гц, 1H), 8,07 (д, J=8,85 Гц, 1H), 8,01 (д, J=1,53 Гц, 1H), 7,90 (с, 1H), 7,83 (дд, J=8,85, 1,83 Гц, 1H), 7,74 (дд, J=8,85, 1,53 Гц, 1H), 4,91 (с, 1H), 4,90 (с, 1H), 4,29 (с, 1H), 1,66 (с, 9H), 1,65 (с, 9H).

Пример 60E

3,5-бис(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 3D, с использованием соединения Примера 60D вместо соединения Примера 3C. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,35 (с, 1H), 8,76 (с, 1H), 8,71 (с, 1H), 8,70 (с, 1H), 7,92 (д, J=8,61, 1,28 Гц, 1H), 7,64 (д, J=8,79 Гц, 1H), 7,38-7,43 (м, 8H), 7,33-7,37 (м, 2H), 5,73 (с, 2H), 5,66 (с, 2H). MS (ESI+) m/z 433,2 (M+H)+.

Пример 61

5-(1-бензил-1H-1,2,3-триазол-4-ил)-3-фенил-1H-индазол

Пример 61A

трет-Бутил 3-фенил-5-((триметилсилил)этинил)-1H-индазол-1-карбоксилат и трет-бутил 5-бром-3-фенил-1H-индазол-1-карбоксилат

Соединение Примера 60B (1 г, 2,55 ммоль), дихлорбис(трифенилфосфин)палладий(II) (89 мг, 0,13 ммоль), триэтиламин (1,78 мл, 12,75 ммоль), триметилсилилацетилен (0,432 мл, 3,06 ммоль) и CuI (24 мг, 0,13 ммоль) объединяли в диметилформамиде (10 мл) и перемешивали при комнатной температуре в течение 20 часов. Смесь разбавляли этилацетатом и очищали при помощи хроматографии на силикагеле с получением указанного в заголовке соединения. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 8,29 (д, J=1,53 Гц, 1H), 8,09-8,19 (м, 3H), 7,96-8,03 (м, 4H), 7,83 (дд, J=8,85, 1,83 Гц, 1H), 7,72 (дд, J=8,85, 1,53 Гц, 1H), 7,50-7,65 (м, 6H), 1,68 (с, 18H), 0,26-0,27 (м, 9H).

Пример 61B

трет-Бутил 5-этинил-3-фенил-1H-индазол-1-карбоксилат и трет-бутил 5-бром-3-фенил-1H-индазол-1-карбоксилат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 60D, с использованием соединения Примера 61A вместо соединения Примера 60C. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 8,28 (д, J=1,53 Гц, 1H), 8,21 (с, 1H), 8,16 (д, J=8,54 Гц, 1H), 8,12 (д, J=8,85 Гц, 1H), 7,97-8,05 (м, 4H), 7,83 (дд, J=8,85, 1,83 Гц, 1H), 7,75 (дд, J=8,85, 1,53 Гц, 1H), 7,53-7,64 (м, 6H), 4,27 (с, 1H), 1,68 (с, 9H), 1,68 (с, 9H).

Пример 61C

5-(1-бензил-1H-1,2,3-триазол-4-ил)-3-фенил-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 3D, с использованием соединения Примера 61B вместо соединения Примера 3C. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,38 (с, 1H), 8,77 (с, 1H), 8,52 (с, 1H), 8,06 (д, J=7,33 Гц, 2H), 7,98 (д, J=8,79 Гц, 1H), 7,69 (д, J=8,79 Гц, 1H), 7,53-7,61 (м, J=7,51, 7,51 Гц, 2H), 7,33-7,48 (м, 6H), 5,68 (с, 2H). MS (ESI+) m/z 352,0 (M+H)+.

Пример 62

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Пример 62A

2-Фтор-5-((триметилсилил)этинил)бензонитрил

5-Бром-2-фторбензонитрил (5,01 г, 25,0 ммоль), дихлорбис(трифенилфосфин)палладий(II) (652 мг, 0,929 ммоль) и иодид меди(I) (413 мг, 2,17 ммоль) объединяли в триэтиламине (15 мл) в атмосфере азота. Добавляли триметилсилилацетилен (4,2 мл, 29,7 ммоль) и смесь нагревали до 100°C. Смесь отверждалась, и реакцию отслеживали методом ЖХ/МС. После завершения реакции смесь разбавляли метиленхлоридом и промывали 1 н раствором HCl. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, элюируя с использованием градиента этилацетата в гексане (5-45%), с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,09 (дд, J=6,10, 2,03 Гц, 1H), 7,77-7,97 (м, 1H), 7,54 (т, J=9,15 Гц, 1H), 0,15-0,32 (м, 9H).

Пример 62B

5-Этинил-2-фторбензонитрил

Тетрабутиламмонийфторид (1,0 M раствор в тетрагидрофуране 70 мл) добавляли к раствору соединения Примера 62A (5,05 г, 23,2 ммоль) в тетрагидрофуране (50 мл) и оставляли для перемешивания в течение 20 минут. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, элюируя с использованием градиента 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,13 (дд, J=6,27, 2,20 Гц, 1H), 7,82-7,95 (м, 1H), 7,56 (т, J=8,99 Гц, 1H), 4,40 (с, 1H).

Пример 62C

5-(1-Бензил-1H-1,2,3-триазол-4-ил)-2-фторбензонитрил

Соединение Примера 62B (1,68 г, 11,6 ммоль) растворяли в трет-бутаноле (14 мл). Добавляли бензилазид (2,14 г, 15,8 ммоль) и смесь переносили в 14 микроволновых сосудов (1,0 мл каждый). В каждый микроволновой сосуд добавляли воду (0,5 мл), небольшой кусок медной проволоки и 1 M раствор сульфата меди(II) (0,5 мл) и сосуды нагревали в микроволновом реакторе CEM-Discover при 125°C с использованием мощности 100 Ватт, в течение 10 минут каждый. Содержимое сосудов объединяли, разбавляли этилацетатом и промывали водой и насыщенным солевым раствором. Органическое вещество абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-50% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,73 (с, 1H), 8,33-8,44 (м, 1H), 8,19-8,32 (м, 1H), 7,56-7,70 (м, 1H), 7,28-7,47 (м, 5H), 5,68 (с, 2H).

Пример 62D

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Гидразингидрат (18 мл) добавляли к соединению Примера 62C (1,93 г, 6,94 ммоль) в этаноле (10 мл). Смесь нагревали до 95°C в течение ночи. Смесь разбавляли этилацетатом и промывали водой. Некоторое количество продукта осаждалось в делительной воронке, и его фильтровали с получением указанного в заголовке соединения. Этилацетатный слой концентрировали при пониженном давлении и полученное твердое вещество растирали в порошок с метанолом с получением дополнительного количества указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,43 (с, 1H), 8,42 (с, 1H), 8,21 (с, 1H), 7,67 (д, J=8,82, 1,70 Гц, 1H), 7,38 (с, 5H), 7,26 (д, J=8,48 Гц, 1H), 5,64 (с, 2H), 5,38 (с, 2H). MS (ESI+) m/z 291,0 (M+H)+.

Пример 63

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1-[(1-метилпиперидин-4-ил)карбонил]-1H-индазол-3-амин

Соединение Примера 62D (44 мг, 0,152 ммоль), гидрохлорид 1-метилпиперидин-4-карбоновой кислоты (27 мг, 0,150 ммоль) и HATU (61 мг, 0,160 ммоль) объединяли в тетрагидрофуране (2 мл). добавляли диизопропилэтиламин (110 мл, 0,631 ммоль) и смесь нагревали до 90°C в течение 30 минут. Смесь разбавляли метиленхлоридом и промывали 1 н раствором гидроксида натрия. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-15% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,58 (с, 1H), 8,47 (с, 1H), 8,26 (д, J=8,48 Гц, 1H), 7,97 (д, J=8,48, 1,70 Гц, 1H), 7,38 (с, 5H), 6,58 (с, 2H), 5,67 (с, 2H), 3,35-3,47 (м, 1H), 2,95 (д, J=1 1,19 Гц, 2H), 2,28 (с, 3H), 2,03-2,20 (м, 2H), 1,92 (с, 2H), 1,77 (с, 2H). MS (ESI+) m/z 416,2 (M+H)+.

Пример 64

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-метоксиацетамид

Пример 64A

трет-Бутил 3-амино-5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-карбоксилат

Соединение Примера 62D (1,80 г, 6,20 ммоль) суспендировали в метиленхлориде (100 мл) с каталитическим количеством диметиламинопиридина. Добавляли раствор ди-трет-бутилдикарбоната (1,36 г, 6,23 ммоль) в метиленхлориде (50 мл) по каплям в течение 1 часа. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. MS (ESI+) m/z 391,1 (M+H)+.

Пример 64B

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-метоксиацетамид

Соединение Примера 64A (45 мг, 0,115 ммоль) растворяли в метиленхлориде (1,5 мл) и пиридине (0,5 мл). Добавляли метоксиацетилхлорид (18 мкл, 0,197 ммоль) и смесь перемешивали при температуре окружающей среды в течение 2 часов. Растворители удаляли с использованием теплого потока азота, смесь вводили в колонку с силикагелем и продукт очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением трет-бутил 5-(1-бензил-1H-1,2,3-триазол-4-ил)-3-(2-метоксиацетамидо)-1H-индазол-1-карбоксилата (58 мг). Промежутотчное соединение растворяли в метиленхлориде (2 мл) и трифторуксусной кислоте (1 мл) и перемешивали при температуре окружающей среды в течение ночи. Растворители удаляли при пониженном давлении и смесь очищали при помощи препаративной ВЭЖХ на колонке C8, с использованием градиента от 10% до 100% ацетонитрила/вода, содержащая 0,1% трифторуксусной кислоты, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,79 (с, 1H), 10,16 (с, 1H), 8,59 (с, 1H), 8,20 (с, 1H), 7,83 (д, J=8,65, 1,53 Гц, 1H), 7,51 (д, J=8,82 Гц, 1H), 7,37 (с, 5H), 5,64 (с, 2H), 4,12 (с, 2H), 3,42 (с, 3H). MS (ESI+) m/z 363,0 (M+H)+.

Пример 65

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид

Соединение Примера 64A (81 мг, 0,207 ммоль) растворяли в метиленхлориде (2 мл) и пиридине (0,5 мл). Добавляли гидрохлорид диметиламиноацетилхлорида, 80% (120 мг, 0,607 ммоль) тремя порциями в течение 2 часов и смесь перемешивали при температуре окружающей среды в течение ночи. Добавляли трифторуксусную кислоту (2 мл) и смесь перемешивали в течение 3 часов. Смесь разбавляли метиленхлоридом и промывали 1 н раствором гидроксида натрия. Органический слой абсорбировали на силикагеле и очищали с использованием хроматографии на силикагеле, используя для элюирования градиент 5-15% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,77 (с, 1H), 10,05 (с, 1H), 8,58 (с, 1H), 8,24 (с, 1H), 7,82 (д, J=8,65, 1,53 Гц, 1H), 7,50 (д, J=8,82 Гц, 1H), 7,30-7,44 (м, 5H), 5,64 (с, 2H), 3,16-3,20 (м, 2H), 2,34 (с, 6H). MS (ESI+) m/z 376,1 (M+H)+.

Пример 66

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бутанамид

Соединение Примера 64A (76 мг, 0,195 ммоль) растворяли в метиленхлориде (2 мл) и пиридине (0,2 мл). Добавляли бутирилхлорид (26 мкл, 0,250 ммоль) и смесь перемешивали при температуре окружающей среды в течение 2 часов. Добавляли трифторуксусную кислоту (1 мл) и смесь перемешивали в течение 3 часов. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали с использованием хроматографии на силикагеле, используя для элюирования градиент 1-8% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,70 (с, 1H), 10,30 (с, 1H), 8,57 (с, 1H), 8,23 (с, 1H), 7,81 (д, J=8,82 Гц, 1H), 7,49 (д, J=8,82 Гц, 1H), 7,37 (с, 5H), 5,64 (с, 2H), 2,39 (т, J=7,29 Гц, 2H), 1,67 (с, 2H), 0,97 (т, J=7,46 Гц, 3H). MS (ESI+) m/z 361,1 (M+H)+.

Пример 67

5-[4-(4-фторфенил)-1-пиперидин-4-ил-1H-индазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием пиперидин-4-амина вместо бензиламина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,28 (с, 1H), 8,14 (с, 1H), 7,94 (с, 1H), 7,78 (с, 1H), 7,63-7,72 (м, 2H), 7,21-7,43 (м, 2H), 6,90-7,04 (м, 2H), 4,14 (д, J=5,59, 1,86 Гц, 1H), 3,53-3,74 (м, J=5,76 Гц, 1H), 2,94 (д, J=12,21 Гц, 2H), 2,21-2,35 (м, 2H), 1,74-1,88 (м, 3H). MS (DCI) m/z 362 (M+H)+.

Пример 68

5-{4-(4-фторфенил)-1-[2-(1-метилпирролидин-2-ил)этил]-1H-индазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 2-(1-метилпирролидин-2-ил)этанамина вместо бензиламина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,30 (с, 1H), 8,14 (с, 1H), 7,86 (с, 1H), 7,82 (с, 1H), 7,68 (д, J=8,48 Гц, 1H), 7,24-7,47 (м, 3H), 6,92-7,08 (м, 2H), 3,83 (т, J=7,80 Гц, 2H), 2,71-2,93 (м, 1H), 1,88-2,01 (м, 3H), 1,74-1,88 (м, 1H), 1,00-1,83 (м, 7H). MS (DCI) m/z 390 (M+H)+.

Пример 69

5-{4-(4-фторфенил)-1-[3-(4-метилпиперазин-1-ил)пропил]-1H-имидазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 3-(4-метилпиперазин-1-ил)пропан-1-амина вместо бензиламина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 8,13 (с, 1H), 7,81 (с, 2H), 7,67 (д, J=8,48 Гц, 1H), 7,32-7,45 (м, 2H), 7,27 (д, J=8,48, 1,36 Гц, 1H), 6,87-7,06 (м, 2H), 3,72-3,91 (м, 2H), 1,92-2,21 (м, 10H), 1,91-2,20 (с, 3H), 1,51-1,66 (м, 2H). MS (ESI+) m/z 419 (M+H)+.

Пример 70

этил 5-(1H-индазол-5-ил)изоксазол-3-карбоксилат

Соединение Примера 3C (1,83 г, 12,9 ммоль) растворяли в толуоле (60 мл) и триэтиламине (2,2 мл) и нагревали до 90°C. Этил 2-хлор-2-(гидроксиимино)ацетат (1,89 г, 12,5 ммоль) растворяли в толуоле (15 мл) и добавляли по каплям в течение 30 минут. После добавления смесь разбавляли этилацетатом и промывали 1 н раствором хлористоводородной кислоты. Органический слой концентрировали при пониженном давлении и полученный остаток растирали в порошок с метанолом с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,38 (с, 1H), 8,43 (с, 1H), 8,23 (с, 1H), 7,92 (д, J=8,82, 1,36 Гц, 1H), 7,70 (д, J=8,82 Гц, 1H), 7,44 (с, 1H), 4,41 (кв., J=7,12 Гц, 2H), 1,35 (т, J=7,12 Гц, 3H). MS (ESI+) m/z 257,9 (M+H)+.

Пример 71

5-(1H-индазол-5-ил)-N-метилизоксазол-3-карбоксамид

Пример 71 A

5-(1H-индазол-5-ил)изоксазол-3-карбоновая кислота

Соединение Примера 70 (1,50 г, 5,83 ммоль) растворяли в тетрагидрофуране (100 мл), метанол (10 мл) и воде (10 мл). Добавляли гидроксид калия (680 мг, 12,1 ммоль) и смесь перемешивали при температуре окружающей среды в течение 2 часов. Растворители удаляли при пониженном давлении и полученный остаток растирали в порошок со смесью 1 н хлористоводородной кислоты и метанола с получением твердого вещества, которое фильтровали с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-dd) δ м.д. 13,37 (с, 1H), 8,39 (с, 1H), 8,22 (с, 1H), 7,90 (дд, J=8,81, 1,36 Гц, 1H), 7,69 (д, J=8,82 Гц, 1H), 7,30 (с, 1H).

Пример 71B

5-(1H-индазол-5-ил)-N-метилизоксазол-3-карбоксамид

Соединение Примера 71A (46 мг, 0,201 ммоль), HATU (88 мг, 0,231 ммоль) и диизопропилэтиламин (133 мкл, 0,764 ммоль) объединяли в тетрагидрофуране (2 мл). Добавляли монометиламин (40% раствор в воде) (50 мкл) и реакционную смесь перемешивали при 50°C в течение 2 часов. Смесь разбавляли метиленхлоридом и промывали 1 н раствором гидроксида натрия, 1 н раствором хлористоводородной кислоты и насыщенным солевым раствором. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 8,72 (кв., J=4,30 Гц, 1H), 8,39 (с, 1H), 8,23 (с, 1H), 7,89 (д, J=8,65, 1,53 Гц, 1H), 7,69 (д, J=8,82 Гц, 1H), 7,28 (с, 1H), 2,80 (д, J=4,75 Гц, 3H). MS (ESI+) m/z 243,0 (M+H)+.

Пример 72

5-(3-бензилизоксазол-5-ил)-1H-индазол

Фенилацетальдегид (90+ %) (266 мг, 2,38 ммоль) растворяли в трет-бутаноле (1 мл) и воде (1 мл). Добавляли гидроксиламингидрохлорид (79 мг, 1,14 ммоль) с последующим добавлением 6 н раствора гидроксида натрия (19 мкл, 31,7 ммоль). Смесь перемешивали в течение 30 минут. Медленно добавляли хлорамин-T тригидрат (308 мг, 1,09 ммоль) в течение 5 минут, с последующим добавлением сульфата меди (II) и небольшого куска медной проволоки. Добавляли соединение Примера 3C (154 мг, 1,08 ммоль) и смесь перемешивали при 50°C в течение 2 часов, затем при температуре окруающей среды в течение ночи. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,31 (с, 1H), 8,28 (с, 1H), 8,18 (с, 1H), 7,79 (дд, J=8,65, 1,53 Гц, 1H), 7,64 (д, J=8,81 Гц, 1H), 7,13-7,46 (м, 5H), 6,83 (с, 1H), 4,04 (с, 2H). MS (ESI+) m/z 275,7 (M+H)+.

Пример 73

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид

Соединение Примера 64A (72 мг, 0,184 ммоль) растворяли в метиленхлориде (2 мл) и пиридине (0,2 мл). Добавляли бензоилхлорид (36 мкл, 0,310 ммоль) и смесь перемешивали при температуре окружающей среды в течение 2 часов. Добавляли трифторуксусную кислоту (1 мл) и смесь перемешивали в течение 3 часов. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали хроматографией на силикагеле, используя для элюирования градиент 1-8% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,88 (с, 1H), 10,81 (с, 1H), 8,63 (с, 1H), 8,16 (с, 1H), 8,06-8,13 (м, 2H), 7,88 (д, J=8,82, 1,36 Гц, 1H), 7,59-7,64 (м, J=7,12 Гц, 1H), 7,51-7,59 (м, 3H), 7,31-7,42 (м, 5H), 5,63 (с, 2H). MS (ESI+) m/z 395,1 (M+H)+.

Пример 74

5-(3-пропилизоксазол-5-ил)-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 72, с использованием бутральдегида вместо фенилацетальдегида. 1H ЯМР (300 МГц, ДМСО-d<j) δ м.д. 13,31 (с, 1H), 8,28 (с, 1H), 8,20 (с, 1H), 7,76-7,85 (м, 1H), 7,63-7,70 (м, 1H), 6,88 (с, 1H), 2,63 (т, J=7,46 Гц, 2H), 1,61-1,79 (м, 2H), 0,96 (т, J=7,29 Гц, 3H). MS (ESI+) m/z 228,0 (M+H)+.

Пример 75

N-бензил-4-(1H-индазол-5-ил)-5-фенил-1,3-тиазол-2-амин

Пример 75A

1H-индазол-5-карбоновая кислота

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 3A, с использованием метил 4-амино-3-метилбензоата вместо 4-иод-2-метиланилина. В процессе конечной обработки добавление 6 н раствора HCl до достижения pH 6 приводило к образованию твердого вещества, которое фильтровали, промывали два раза водой и сушили в вакууме с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,32 (с, 1H), 12,83 (с, 1H), 8,46 (с, 1H), 8,24 (с, 1H), 7,92 (дд, J=8,82, 1,70 Гц, 1H), 7,60 (д, J=8,82 Гц, 1H).

Пример 75B

N-Метокси-N-метил-1H-индазол-5-карбоксамид

К суспензии соединения Примера 75A (1,6 г, 10 ммоль) и N,O-диметилгидроксиламина (1,1 г, 11 ммоль) в дихлорметане (40 мл) и диметилформамиде (10 мл) добавляли триэтиламин (1,67 мл, 12 ммоль) и EDC (2,1 г, 11 ммоль) и смесь перемешивали при комнатной температуре в течение 24 часов. Растворители выпаривали при пониженном давлении и полученный остаток разбавляли этилацетатом и промывали водой. Органический слой сушили над сульфатом натрия и очищали при помощи колоночной хроматографии на силикагеле в этилацетате с получением указанного в заголовке соединения. MS (ESI+) m/z 206,0 (M+H)+.

Пример 75C

1-(1H-индазол-5-ил)-2-фенилэтанон

Раствор соединения Примера 75B (900 мг, 4,39 ммоль) в тетрагидрофуране (10 мл) охлаждали в атмосфере аргона с использованием ледяной бани и обрабатывали при помощи 2M раствора бензилмагнийхлорида в тетрагидрофуране (6,6 мл, 13,16 ммоль). Реакционную смесь перемешивали в течение ночи при комнатной температуре с последующим добавлением еще одного эквивалента бензилмагнийхлорида. Смесь нагревали при 70°C в течение 9 часов. Добавляли еще один эквивалент бензилмагнийхлорида и реакционную смесь нагревали при 70°C еще в течение 90 минут и давали охладиться до комнатной температуры. Добавляли насыщенный водный раствор хлорида аммония и продукт экстрагировали этилацетатом и очищали при помощи колоночной хроматографии на силикагеле, с использованием 30% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 237,1 (M+H)+.

Пример 75D

трет-Бутил 5-(2-фенилацетил)-1H-индазол-1-карбоксилат

К суспензии соединения Примера 75C (236 мг, 1 ммоль) в дихлорметане (2 мл) добавляли ди-трет-бутилдикарбонат (327 мг, 1,5 ммоль) и щепотку диметиламинопиридина (~2 мг). Смесь перемешивали в течение 15 минут и пропускали через слой силикагеля и элюировали дихлорметаном. Растворитель выпаривали при пониженном давлении с получением указанного в заголовке соединения. MS (ESI+) m/z 337,0 (M+H)+.

Пример 75E

2-Бром-1-(1H-индазол-5-ил)-2-фенилэтанон

К раствору соединения Примера 75D (336 мг, 1 ммоль) в тетрагидрофуране (20 мл), нагреваемому при 40°C на масляной бане, добавляли по каплям через капельную воронку раствор трибромида пиридиния (352 мг, 1,1 ммоль) в тетрагидрофуране (20 мл) в течение 10 минут. Реакционную смесь нагревали еще в течение 2 часов и затем охлаждали, фильтровали и фильтрат упаривали с получением указанного в заголовке соединения. MS (ESI-) m/z 212,9 (M-H)".

Пример 75F

N-бензил-4-(1H-индазол-5-ил)-5-фенил-1,3-тиазол-2-амин

Сосуд, содержащий соединение Примера 75E (50 мг, 0,16 ммоль) и 1-бензилтиомочевину (26 мг, 0,16 ммоль) в этаноле (1 мл), закрывали крышкой и нагревали в нагревательном устройстве с встряхиванием при 80°C в течение 2 часов. Раствор неочищенного продукта очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения в форме соли ТФУ. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,99 (с, 1H), 8,33-8,37 (м, 1H), 8,01 (с, 1H), 7,92-7,99 (м, 1H), 7,82 (с, 1H), 7,60-7,67 (м, J=7,83, 7,83 Гц, 1H), 7,31-7,45 (м, 5H), 7,17-7,30 (м, 5H), 4,53 (д, J=4,60 Гц, 2H). MS (ESI+) m/z 383,0 (M+H)+.

Пример 76

4-(1H-индазол-5-ил)-N,5-дифенил-1,3-тиазол-2-амин

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 75F, с использованием 1-фенилтиомочевины вместо 1-бензилтиомочевины. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,09 (с, 1H), 10,29 (с, 1H), 8,05 (д, J=0,92 Гц, 1H), 7,89 (д, J=1,53, 0,92 Гц, 1H), 7,69 (д, J=8,59, 1,23 Гц, 2H), 7,47 (дт, J=8,59, 0,92 Гц, 1H), 7,40-7,44 (м, 1H), 7,26-7,37 (м, 7H), 6,94-7,02 (м, J=7,36, 7,36 Гц, 1H). MS (ESI+) m/z 369,0 (M+H)+.

Пример 77

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол

Пример 77A

трет-бутил 5-(циклопропилэтинил)-1H-индазол-1-карбоксилат

Соединение Примера 44A (2,31 г, 7,77 ммоль), циклопропилацетилен (620 мг, 9,37 ммоль), дихлорбис(трифенилфосфин)палладий(II) (170 мг, 0,242 ммоль) и иодид меди(I) (92 мг, 0,483 ммоль) объединяли в триэтиламине (10 мл) в инертной атмосфере азота. Смесь нагревали до 100°C в герметично закрытой пробирке в течение 4 часов. Смесь разбавляли метиленхлоридом и промывали 1 н раствором хлористоводородной кислоты. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 283,0 (M+H)+.

Пример 77B

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол

Соединение Примера 77A (145 мг, 0,51 ммоль) и бензилазид (82 мг, 0,62 ммоль) нагревали без растворителя в микроволновом реакторе CEM-Discover при 150°C и 150 Ватт в течение 10 минут. Неочищенную смесь растворяли в дихлорметане и очищали при помощи колоночной хроматографии на силикагеле, с использованием 50% этилацетата в гексане в качестве элюента. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,12 (с, 1H), 8,11 (д, J=5,52 Гц, 2H), 7,79 (д, J=8,59, 1,53 Гц, 1H), 7,60 (д, J=8,59 Гц, 1H), 7,26-7,45 (м, 5H), 5,69 (с, 2H), 1,78-1,92 (м, 1H), 0,98-1,09 (м, 2H), 0,31-0,45 (м, 2H). MS (ESI+) m/z 316,0 (M+H)+.

Пример 78

5-(1-бензил-4-циклопропил-1H-1,2,3-триазол-5-ил)-1H-индазол

Указанное в заголовке соединение выделяли в виде побочного продукта в соответствии с процедурой, описанной в Примере 77B. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,29 (с, 1H), 8,14 (с, 1H), 7,80 (с, 1H), 7,65 (д, J=8,85 Гц, 1H), 7,29 (д, J=8,54, 1,53 Гц, 1H), 7,21-7,27 (м, 3H), 6,93 (д, J=7,48, 1,98 Гц, 2H), 5,49 (с, 2H), 1,70-1,80 (м, 1H), 0,81-0,92 (м, 4H). MS (ESI+) m/z 316,0 (M+H)+.

Пример 79

2-(1H-индазол-5-ил)-3-фенилимидазо[1,2-a]пиримидин

Сосуд, содержащий соединение Примера 75E (80 мг, 0,25 ммоль) и пиримидин-2-амин (23 мг, 0,25 ммоль) в этаноле (1 мл), закрывали крышкой и нагревали в нагревательном устройстве с встряхиванием при 80°C в течение 21 часа. Раствор неочищенного продукта очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,69 (дд, J=4,30, 1,84 Гц, 1H), 8,59 (дд, J=6,75, 1,84 Гц, 1H), 8,07 (с, 1H), 8,02 (с, 1H), 7,46-7,65 (м, 7H), 7,16 (дд, J=6,75, 3,99 Гц, 1H). MS (ESI+) m/z 312,0 (M+H)+.

Пример 80

5-[1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Пример 80A

4-(азидометил)тетрагидро-2H-пиран

4-(Иодметил)тетрагидро-2H-пиран (4,76 г, 21,1 ммоль) растворяли в диметилсульфоксиде (25 мл). Добавляли азид натрия (2,70 г, 41,5 ммоль) и смесь перемешивали при температуре окружающей среды в течение ночи. Полученную суспензию разбавляли простым диэтиловым эфиром и промывали водой. Органический слой концентрировали при пониженном давлении с получением указанного в заголовке соединения. Продукт использовали непосредственно в последующих реакциях без его идентификации.

Пример 80B

5-[1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Соединение Примера 80A (122 мг, 0,864 ммоль) и соединение Примера 3C (150 мг, 0,619 ммоль) объединяли в микроволновом сосуде с трет-бутанолом (1 мл) и водой (1 мл). Добавляли небольшой кусок медной проволоки с последующим добавлением сульфата меди(II) (5 мг, 0,02 ммоль) и содержимое сосуда перемешивали в микроволновом устройстве (CEM-Discover) при 125°C при 100 Вт в течение 10 минут. Смесь разбавляли метиленхлоридом и промывали 1 н раствором хлористоводородной кислоты. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, DMS(MJ) δ м.д. 13,11 (с, 1H), 8,53 (с, 1H), 8,22 (с, 1H), 8,12 (с, 1H), 7,85 (д, J=8,48, 1,36 Гц, 1H), 7,60 (д, J=8,82 Гц, 1H), 4,32 (д, J=7,12 Гц, 2H), 3,85 (д, J=1 1,70, 2,54 Гц, 2H), 3,21-3,36 (м, 2H), 2,14 (с, 1H), 1,47 (с, 2H), 1,30 (с, 2H). MS (ESI+) m/z 284,0 (M+H)+.

Пример 81

5-[3-(пиперидин-1-илкарбонил)изоксазол-5-ил]-1H-индазол

Пример 81A

5-(1H-индазол-5-ил)изоксазол-3-карбоновая кислота

Соединение Примера 70 (1,50 г, 5,83 ммоль) растворяли в тетрагидрофуране (100 мл), метаноле (10 мл) и воде (10 мл). Добавляли гидроксид калия (680 мг, 12,1 ммоль) и смесь перемешивали при температуре окружающей среды в течение 2 часов. Растворители удаляли при пониженном давлении и полученный остаток растирали в порошок со смесью 1 н хлористоводородной кислоты и метанола с получением твердого вещества, которое фильтровали с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 8,41 (с, 1H), 8,23 (с, 1H), 7,91 (дд, J=8,82, 1,70 Гц, 1H), 7,70 (д, J=8,82 Гц, 1H), 7,36 (с, 1H).

Пример 81B

5-[3-(пиперидин-1-илкарбонил)изоксазол-5-ил]-1H-индазол

Соединение Примера 81A (110 мг, 0,480 ммоль), пиперидин (55 мкл, 0,556 ммоль) и HATU (101 мг, 0,266 ммоль) объединяли в диметилформамиде (2 мл). Добавляли диизопропилэтиламин (133 мкл, 0,764 ммоль) и реакционную смесь перемешивали при 45°C в течение 2 часов. Смесь разбавляли этилацетатом и промывали 1 н раствором гидроксида натрия, 1 н раствором хлористоводородной кислоты, водой (3 раза) и насыщенным солевым раствором. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,37 (с, 1H), 8,34-8,40 (м, 1H), 8,21-8,25 (м, 1H), 7,84-7,91 (м, 1H), 7,66-7,72 (м, 1H), 7,20 (с, 1H), 3,59-3,69 (м, 2H), 3,48-3,58 (м, 2H), 1,47-1,72 (м, 6H). MS (ESI+) m/z 297,0 (M+H)+.

Пример 82

5-(1H-индазол-5-ил)-N-фенилизоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием анилина вместо пиперидина. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,40 (с, 1H), 10,74 (с, 1H), 8,44 (с, 1H), 8,25 (с, 1H), 7,93 (д, J=8,85, 1,53 Гц, 1H), 7,82 (д, J=7,63 Гц, 2H), 7,72 (д, J=8,85 Гц, 1H), 7,44 (с, 1H), 7,35-7,42 (м, 2H), 7,16 (т, J=7,32 Гц, 1H). MS (ESI+) m/z 304,9 (M+H)+.

Пример 83

N-циклогексил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Соединение Примера 81A (53 мг, 0,231 ммоль), циклогексиламин (29 мкл, 0,253 ммоль) и HATU (101 мг, 0,266 ммоль) объединяли в диметилформамиде (2 мл). Добавляли диизопропилэтиламин (133 мкл, 0,764 ммоль) и реакционную смесь перемешивали при 45°C в течение 2 часов. Смесь разбавляли этилацетатом и промывали 1 н раствором гидроксида натрия, 1 н раствором хлористоводородной кислоты, водой (3 раз) и насыщенным солевым раствором. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 8,58 (д, J=8,14 Гц, 1H), 8,38 (с, 1H), 8,22 (с, 1H), 7,88 (д, J=8,81, 1,70 Гц, 1H), 7,69 (д, J=8,81 Гц, 1H), 7,28 (с, 1H), 3,69-3,86 (м, 1H), 1,77 (с, 4H), 1,60 (д, J=12,21 Гц, 1H), 1,20-1,46 (м, 4H), 1,06-1,20 (м, 1H). MS (ESI+) m/z 311,0 (M+H)+.

Пример 84

5-[3-(пиперидин-1-илметил)изоксазол-5-ил]-1H-индазол

Соединение Примера 81B (22 мг, 0,0742 ммоль) растворяли в тетрагидрофуране (2,5 мл) в инертной атмосфере азота. Добавляли литийалюминийгидрид (1,0 M раствор в тетрагидрофуране) (250 мкл) и смесь нагревали до 70°C в течение 20 минут. Добавляли метанол и смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент метанола в дихлорметане (0-7%), с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,30 (с, 1H), 8,31 (с, 1H), 8,20 (с, 1H), 7,84 (д, J=8,59, 1,53 Гц, 1H), 7,66 (д, J=8,59 Гц, 1H), 6,92 (с, 1H), 3,54 (с, 2H), 2,32-2,46 (м, 2H), 1,47-1,59 (м, 4H), 1,33-1,46 (м, 2H). MS (ESI+) m/z 283,0 (M+H)+.

Пример 85

[5-(1H-индазол-5-ил)изоксазол-3-ил]метанол

Соединение Примера 70 (84 мг, 0,366 ммоль) растворяли в тетрагидрофуране (8 мл). Добавляли литийалюминийгидрид (1,0 M раствор в тетрагидрофуране) (3,0 мл) 1,0-мл порциями в течение 2 часов. По окончании добавления, смесь перемешивали еще в течение 30 минут. Смесь разбавляли метиленхлоридом и промывали водой и органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-20% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,31 (с, 1H), 8,31 (с, 1H), 8,21 (с, 1H), 7,83 (д, J=8,59, 1,53 Гц, 1H), 7,67 (д, J=8,90 Гц, 1H), 6,93 (с, 1H), 5,51 (с, 1H), 4,56 (д, J=2,45 Гц, 1H). MS (ESI+) m/z 215,9 (M+H)+.

Пример 86

5-(1H-индазол-5-ил)-N-(2-метоксиэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 2-метоксиэтиламина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 8,74 (т, J=4,92 Гц, 1H), 8,39 (с, 1H), 8,23 (с, 1H), 7,89 (д, J=8,65, 1,53 Гц, 1H), 7,69 (д, J=8,82 Гц, 1H), 7,30 (с, 1H), 3,38-3,53 (м, 4H), 3,28 (с, 3H). MS (ESI+) m/z 287,0 (M+H)+.

Пример 87

5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол

Пример 87A

1-(5-Иод-1H-индазол-1-ил)этанон

4-Иод-2-метиланилин (30,2 г, 130 ммоль) растворяли в хлороформе (300 мл) и охлаждали до 5°C. Добавляли по каплям уксусный ангидрид (35 мл, 343 ммоль) и смеси давали нагреться до температуры окружающей среды. Добавляли ацетат калия (4,21 г, 42,9 ммоль) и изоамилнитрит (37 мл, 277 ммоль) и смесь нагревали до 70°C в течение ночи. Смесь нейтрализовали насыщенным водным раствором бикарбоната натрия и экстрагировали метиленхлоридомом. Растворители удаляли при пониженном давлении и полученный остаток растирали в порошок с метанолом с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,41 (с, 1H), 8,33 (с, 1H), 8,05-8,21 (м, 1H), 7,90 (дд, J=8,48, 1,70 Гц, 1H), 2,71 (с, 3H).

Пример 87B

1-Бензил-5-фенил-4-(трибутилстаннил)-1H-1,2,3-триазол

Фенилэтинил-три-н-бутилолово (8,25 г, 21,1 ммоль) и бензилазид (2,3 мл, 18,4 ммоль) объединяли и нагревали до 150°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 526,3 (M+H)+.

Пример 87C

1-(5-(1-Бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-ил)этанон

Соединение Примера 87A (139 мг, 0,486 ммоль), соединение Примера 87B (284 мг, 0,542 ммоль), дихлорбис(трифенилфосфин)палладий(II) (40 мг, 0,057 ммоль) и тиофен-2-карбоксилат меди (167 мг, 0,876 ммоль) объединяли в толуоле (1,5 мл) в микроволновом сосуде в инертной атмосфере азота. Сосуд нагревали в микроволновом устройстве (CEM-Discover) до 150°C при 125 Ватт в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 394,1 (M+H)+.

Пример 87D

5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол

Соединение Примера 87C (95 мг, 0,242 ммоль) растворяли в тетрагидрофуране (2,0 мл), метаноле (1,0 мл) и воде (1,0 мл) и добавляли гидроксид калия (64 мг, 1,14 ммоль). Смесь перемешивали в течение 2 часов и разбавляли этилацетатом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,08 (с, 1H), 8,00 (с, 1H), 7,79 (с, 1H), 7,44-7,56 (м, 5H), 7,24-7,36 (м, 5H), 6,95-7,03 (м, 2H), 5,49 (с, 2H). MS (ESI+) m/z 252,1 (M+H)+.

Пример 88

5-(4-бензил-1H-1,2,3-триазол-1-ил)-1H-индазол

Соединение Примера 87A (969 мг, 3,39 ммоль), 3-фенил-1-пропин (392 мг, 3,37 ммоль), азид натрия (278 мг, 4,28 ммоль), аскорбат натрия (68 мг, 3,43 ммоль), карбонат натрия (75 мг, 0,708 ммоль) и L-пролин (78 мг, 8,98 ммоль) объединяли в 1:1 смеси диметилсульфоксида и воды (10 мл). Добавляли сульфат меди(II) пентагидрат (46 мг, 0,184 ммоль) и смесь перемешивали при 65°C в течение 3 часов. Добавляли 6н раствор гидроксида натрия (1 мл) и смесь перемешивали в течение 30 минут для удаления защиты у индазола. Смесь разбавляли этилацетатом и промывали 1 н раствором хлористоводородной кислоты. Органический слой концентрировали при пониженном давлении и полученный остаток растирали в порошок с метанолом. Оставшиеся твердые частицы абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,35 (с, 1H), 8,58 (с, 1H), 8,17-8,27 (м, 1H), 7,86 (д, J=8,82, 2,03 Гц, 1H), 7,67-7,77 (м, 1H), 7,27-7,36 (м, 2H), 7,18-7,27 (м, 1H), 4,10 (с, 1H). MS (ESI+) m/z 276,0 (M+H)+.

Пример 89

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Пример 89A

5-(Циклопропилэтинил)-2-фторбензонитрил

5-Бром-2-фторбензонитрил (3,06 г, 15,3 ммоль), дихлорбис(трифенилфосфин)палладий(II) (478 мг, 0,681 ммоль) и иодид меди(I) (165 мг, 0,866 ммоль) объединяли в триэтиламине (15 мл) в инертной атмосфере азота. Добавляли циклопропилацетилен (1,8 мл) и смесь нагревали до 60°C, пока она не превращалась в черное твердое вещество. Смесь разбавляли метиленхлоридом и промывали 1 н раствором хлористоводородной кислоты. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 319,0 (M+H)+.

Пример 89B

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Соединение Примера 89A (211 мг, 1,14 ммоль) и бензилазид (143 мкл, 1,14 ммоль) объединяли в микроволновом (CEM-Discover) сосуде и нагревали до 160°C, с использованием мощности 100 Ватт, в течение 26 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 20-60% этилацетата в гексане, с получением смеси неразделимых триазольных региомеров. Смесь региомеров обрабатывали гидразингидратом (3,0 мл) и этанолом (3,0 мл) и нагревали до 90°C в течение 1 часа. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 1-6% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,43 (с, 1H), 8,07 (с, 1H), 7,63 (д, J=8,65, 1,53 Гц, 1H), 7,32-7,45 (м, 3H), 7,24-7,32 (м, 3H), 5,68 (с, 2H), 5,40 (с, 2H), 1,69-1,83 (м, 1H), 0,98-1,08 (м, 2H), 0,32-0,42 (м, 2H). MS (ESI+) m/z 331,1 (M+H)+.

Пример 90

5-(1-бензил-4-циклопропил-1H-1,2,3-триазол-5-ил)-1H-индазол-3-амин

Указанное в заголовке соединение выделяли в виде побочного продукта в соответствии с процедурой, описанной в Примере 89B. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,62 (с, 1H), 7,79 (с, 1H), 7,32 (д, J=8,48 Гц, 1H), 7,20-7,27 (м, 3H), 7,15 (д, J=8,65, 1,53 Гц, 1H), 6,93 (д, J=7,12, 2,37 Гц, 2H), 5,49 (с, 2H), 5,45 (с, 2H), 1,71-1,82 (м, 1H), 0,80-0,89 (м, 4H). MS (ESI+) m/z 331,1 (M+H)+.

Пример 91

5-(3-изобутилизоксазол-5-ил)-1H-индазол-3-амин

Пример 91A

2-фтор-5-(3-изобутилизоксазол-5-ил)бензонитрил

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 72, с использованием изовалеральдегида вместо фенилацетальдегида и с использованием соединения Примера 62B вместо соединения Примера 3C. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,47 (дд, J=6,10, 2,03 Гц, 1H), 8,19-8,29 (м, 1H), 7,71 (т, J=8,99 Гц, 1H), 7,08 (с, 1H), 2,56 (д, J=7,12 Гц, 2H), 1,86-2,10 (м, 1H), 0,94 (д, J=6,78 Гц, 6H).

Пример 91B

5-(3-изобутилизоксазол-5-ил)-1H-индазол-3-амин

К соединению Примера 91A (75 мг, 0,307 ммоль) добавляли гидразингидрат (1,5 мл) в этаноле (1,0 мл). Смесь нагревали до 70°C в течение ночи в герметично закрытом сосуде. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения

1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,67 (с, 1H), 8,26 (с, 1H), 7,66 (дд, J=8,82, 1,70 Гц, 1H), 7,32 (д, J=8,48 Гц, 1H), 6,67 (с, 1H), 5,56 (с, 2H), 2,51-2,58 (м, 2H), 1,89-2,11 (м, 1H), 0,95 (д, J=6,44 Гц, 6H). MS (ESI+) m/z 257,0 (M+H)+.

Пример 92

5-(3-бензилизоксазол-5-ил)-1H-индазол-3-амин

Пример 92A

5-(3-бензилизоксазол-5-ил)-2-фторбензонитрил

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 72, с использованием соединения Примера 62B вместо соединения Примера 3C. Неочищенный продукт использовали на следующей стадии без дополнительной очистки или определения его характеристик.

Пример 92B

5-(3-бензилизоксазол-5-ил)-1H-индазол-3-амин

К соединению Примера 92A (65 мг, 0,234 ммоль) добавляли гидразингидрат (1,5 мл) в этаноле (1,0 мл). Смесь нагревали до 70°C в течение ночи в герметично закрытом сосуде. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-20% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,67 (с, 1H), 8,26 (с, 1H), 7,66 (д, J=8,82, 1,70 Гц, 1H), 7,32 (д, J=8,48 Гц, 1H), 6,67 (с, 1H), 5,56 (с, 2H), 2,45-2,57 (м, 2H), 1,91-2,08 (м, 1H), 0,95 (д, J=6,44 Гц, 6H). MS (ESI+) m/z 291,0 (M+H)+.

Пример 93

N-{2-[4-(4-фторфенил)-5-(1H-индазол-5-ил)-1H-имидазол-1-ил]этил}-N,N-диметиламин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 2-диметиламиноэтиламина вместо бензиламина. 1H ЯМР (500 МГц, c) δ м.д. 13,28 (с, 1H), 8,14 (с, 1H), 7,78-7,87 (м, 2H), 7,68 (д, J=8,54 Гц, 1H), 7,33-7,41 (м, 2H), 7,28 (д, J=8,54, 1,53 Гц, 1H), 6,95-7,05 (м, 2H), 3,86 (т, J=6,56 Гц, 2H), 2,31 (т, J=6,71 Гц, 2H), 2,00 (с, 6H).

Пример 94

5-[4-(4-фторфенил)-1-(3-морфолин-4-илпропил)-1H-имидазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 3-морфолинопропиламина вместо бензиламина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 13,28 (с, 1H), 8,14 (с, 1H), 7,79-7,87 (м, 2H), 7,68 (д, J=8,24 Гц, 1H), 7,34-7,42 (м, 2H), 7,28 (д, J=8,54, 1,53 Гц, 1H), 6,92-7,03 (м, 2H), 3,77-3,89 (м, 2H), 3,24-3,30 (м, 4H), 2,10 (т, J=6,56 Гц, 2H), 1,96-2,05 (м, 4H), 1,54-1,66 (м, 2H). MS (ESI+) m/z 406,1 (M+H)+.

Пример 95

5-[4-(4-фторфенил)-1-(3-пирролидин-1-илпропил)-1H-имидазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 3-пирролидинопропиламина вместо бензиламина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,13 (д, J=0,92 Гц, 1H), 7,79-7,85 (м, 2H), 7,68 (д, J=8,54 Гц, 1H), 7,38 (д, J=8,85, 5,49 Гц, 2H), 7,27 (д, J=8,54, 1,53 Гц, 1H), 6,99 (т, J=9,00 Гц, 2H), 3,82-3,90 (м, 2H), 2,21 (т, J=6,71 Гц, 2H), 2,08-2,18 (м, 4H), 1,56-1,65 (м, 2H), 1,44-1,53 (м, 4H). MS (ESI+) m/z 390,2 (M+H)+.

Пример 96

5-{4-(4-фторфенил)-1-[2-(4-метилпиперидин-1-ил)этил]-1H-имидазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 2-(4-метилпиперидин-1-ил)этанамина вместо бензиламина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 13,29 (с, 1H), 8,14 (с, 1H), 7,83 (с, 1H), 7,81 (с, 1H), 7,67 (д, J=8,54 Гц, 1H), 7,32-7,40 (м, 2H), 7,28 (дд, J=8,54, 1,53 Гц, 1H), 6,93-7,04 (м, 2H), 3,85 (т, J=6,56 Гц, 2H), 2,60 (д, J=1 1,60 Гц, 2H), 2,37 (т, J=6,56 Гц, 2H), 1,71-1,85 (м, 2H), 1,45 (д, J=1 1,29 Гц, 2H), 1,15-1,30 (м, 1H), 0,95-1,07 (м, 2H), 0,83 (д, J=6,71 Гц, 3H) MS (ESI+) m/z 404,1 (M+H)+.

Пример 97

5-[1-(1-бензилпиперидин-4-ил)-4-(4-фторфенил)-1H-имидазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 4-амино-N-бензилпиперидина вместо бензиламина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 13,32 (с, 1H), 8,14 (с, 1H), 8,02 (с, 1H), 7,78 (с, 1H), 7,69 (д, J=8,54 Гц, 1H), 7,17-7,40 (м, 8H), 6,97 (т, J=8,85 Гц, 2H), 3,50-3,63 (м, 1H), 3,40 (с, 2H), 2,82 (д, J=1 1,90 Гц, 2H), 1,90-2,05 (м, 2H), 1,72-1,89 (м, 4H). MS (ESI+) m/z 452,2 (M+H)+.

Пример 98

5-[4-(4-фторфенил)-1-(2-морфолин-4-илэтил)-1H-имидазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 2-морфолиноэтиламина вместо бензиламина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 13,27 (с, 1H), 8,14 (с, 1H), 7,86 (с, 1H), 7,81 (с, 1H), 7,67 (д, J=8,54 Гц, 1H), 7,33-7,42 (м, 2H), 7,29 (д, J=8,54 Гц, 1H), 6,95-7,06 (м, 2H), 3,87 (т, J=6,41 Гц, 2H), 3,42-3,51 (м, 4H), 2,40 (т, J=6,56 Гц, 2H), 2,21 (д, J=3,97 Гц, 4H). MS (ESI+) m/z 392,1 (M+H)+.

Пример 99

5-[1-(1-бензилпирролидин-3-ил)-4-(4-фторфенил)-1H-имидазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 3-пирролидинобензиламина вместо бензиламина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 13,29 (с, 1H), 8,13 (с, 1H), 8,03 (с, 1H), 7,76 (с, 1H), 7,67 (д, J=8,54 Гц, 1H), 7,29-7,38 (м, 6H), 7,20-7,28 (м, 2H), 6,98 (т, J=9,00 Гц, 2H), 4,25-4,34 (м, 1H), 3,53-3,69 (м, 2H), 2,89-2,97 (м, 1H), 2,84 (д, J=9,76, 3,05 Гц, 1H), 2,55 (д, J=10,07, 6,71 Гц, 1H), 2,17-2,34 (м, 2H), 1,92-2,03 (м, 1H). MS (ESI+) m/z 438,1 (M+H)+.

Пример 100

Пример 100 удален и не является частью данного документа.

Пример 101

2-{4-[4-(4-фторфенил)-5-(1H-индазол-5-ил)-1H-имидазол-1-ил]пиперидин-1-ил}-2-оксоэтанол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 39, с использованием 1-(4-аминопиперидин-1-ил)-2-гидроксиэтанона вместо бензиламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 13,27 (с, 1H), 8,14 (с, 1H), 7,99 (с, 1H), 7,81 (с, 1H), 7,69 (д, J=8,48 Гц, 1H), 7,25-7,39 (м, 4H), 6,91-7,03 (м, 2H), 4,48 (т, J=5,43 Гц, 1H), 4,34-4,44 (м, 1H), 4,07 (т, J=5,59 Гц, 1H), 3,79-3,91 (м, 1H), 3,64-3,77 (м, 1H), 2,85 (м, 1H), 2,77-2,90 (м, 5H). MS (DCI) m/z 420 (M+H)+.

Пример 102

5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Пример 102A

5-(1-Бензил-5-фенил-1H-1,2,3-триазол-4-ил)-2-фторбензонитрил

Соединение Примера 87B (415 мг, 0,792 ммоль), 5-бром-2-фторбензонитрил (158 мг, 0,790 ммоль), дихлорбис(трифенилфосфин)палладий(II) (52 мг, 0,074 ммоль) и тиофен-2-карбоксилат меди (226 мг, 1,19 ммоль) объединяли в толуоле (2 мл) в микроволновом сосуде в инертной атмосфере азота. Сосуд нагревали в микроволновом устройстве (CEM-Discover) до 150°C при 125 Ватт в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент этилацетата в гексане (5-40%), с получением указанного в заголовке соединения. MS (ESI+) m/z 355,1 (M+H)+.

Пример 102B

5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Соединение Примера 102A (120 мг, 0,339 ммоль) обрабатывали гидразингидратом (1,0 мл) в этаноле (1,0 мл) и нагревали до 60°C в течение ночи. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,40 (с, 1H), 8,06 (с, 1H), 7,42-7,55 (м, 3H), 7,23-7,33 (м, 5H), 7,02-7,10 (м, 2H), 6,94-7,02 (м, 2H), 5,49 (с, 2H), 5,34 (с, 2H). MS (ESI+) m/z 367,1 (M+H)+.

Пример 103

2-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]пропан-2-ол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 2-метил-3-бутин-2-ола вместо 3-фенил-1-пропина, за исключением того, что неочищенную реакционную смесь гасили при помощи 2 мл 1 н водного раствора NaOH; и перемешивали в течение 1,5 часов при температуре окружающей среды. Суспензию затем сушили путем испарения с использованием потока нагретого газообразного азота перед осуществлением эстракции. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,51 (с, 1H), 8,22-8,29 (м, 2H), 7,88 (д, J=9,00, 1,98 Гц, 1H), 7,77 (д, J=8,85 Гц, 1H), 1,57 (с, 6H). MS (ESI+) m/z 244,0 (M+H)+.

Пример 104

5-[4-(метоксиметил)-1H-1,2,3-триазол-1-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием метилпропаргилового эфира вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,73 (с, 1H), 8,23-8,29 (м, J=1,83 Гц, 2H), 7,88 (д, J=8,85, 2,14 Гц, 1H), 7,78 (д, J=9,15 Гц, 1H), 4,57 (с, 2H), 3,35 (с, 3H). MS (ESI+) m/z 230,0 (M+H)+.

Пример 105

1-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]-1-фенилэтанол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 2-фенил-3-бутин-2-ола вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,52 (с, 1H), 8,21-8,28 (м, 2H), 7,87 (д, J=8,85, 2,14 Гц, 1H), 7,76 (д, J=9,15 Гц, 1H), 7,51-7,57 (м, 2H), 7,34 (т, J=7,78 Гц, 2H), 7,24 (т, J=7,32 Гц, 1H), 1,92 (с, 3H). MS (ESI+) m/z 306,0 (M+H)+.

Пример 106

5-(4-пропил-1H-1,2,3-триазол-1-ил)-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 1-пентина вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,50 (с, 1H), 8,20-8,30 (м, 2H), 7,87 (д, J=9,00, 1,98 Гц, 1H), 7,77 (д, J=8,85 Гц, 1H), 2,71 (т, J=7,48 Гц, 2H), 1,64-1,78 (м, 2H), 0,97 (т, J=7,32 Гц, 3H). MS (ESI+) m/z 228,0 (M+H)+.

Пример 107

1-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]пропан-2-ол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием пент-4-ин-2-ола вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,49 (с, 1H), 8,20-8,33 (м, 2H), 7,88 (дд, J=9,00, 1,98 Гц, 1H), 7,74-7,82 (м, 1H), 3,95-4,08 (м, 1H), 2,74-2,89 (м, 2H), 1,16 (д, J=6,10 Гц, 3H). MS (ESI+) m/z 244,0 (M+H)+.

Пример 108

3-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]пропан-1-ол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 4-пентин-1-ола вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,50 (с, 1H), 8,28 (с, 1H), 8,23 (д, J=1,83 Гц, 1H), 7,83-7,91 (м, 1H), 7,74-7,82 (м, 1H), 4,50 (т, J=6,41 Гц, 1H), 3,51 (т, J=6,41 Гц, 2H), 2,77 (т, J=7,63 Гц, 2H), 1,80-1,90 (м, 2H). MS (ESI+) m/z 244,0 (M+H)+.

Пример 109

1-{[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]метил}-1H-1,2,3-бензотриазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 1-пропаргил-1H-бензотриазола вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,91 (с, 1H), 8,21-8,29 (м, 2H), 8,07 (д, J=8,54 Гц, 1H), 7,99 (д, J=8,54 Гц, 1H), 7,84 (д, J=9,00, 1,98 Гц, 1H), 7,72-7,81 (м, 1H), 7,57-7,65 (м, 1H), 7,41-7,52 (м, 1H), 6,16 (с, 2H). MS (ESI-) m/z 315,0 (M-H)-.

Пример 110

5-{4-[(фенилтио)метил]-1H-1,2,3-триазол-1-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием фенилпропаргилсульфида вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,59 (с, 1H), 8,26 (с, 1H), 8,21 (д, J=1,22 Гц, 1H), 7,80-7,86 (м, 1H), 7,72-7,79 (м, 1H), 7,43 (д, J=8,39, 1,37 Гц, 2H), 7,35 (т, J=7,78 Гц, 2H), 7,22 (т, J=7,32 Гц, 1H), 4,38 (с, 2H). MS (ESI+) m/z 308,3 (M+H)+.

Пример 111

5-(4-циклопропил-1H-1,2,3-триазол-1-ил)-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием циклопропилацетилена вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,46 (с, 1H), 8,25 (с, 1H), 8,20 (д, J=1,53 Гц, 1H), 7,84 (д, J=9,00, 1,98 Гц, 1H), 7,76 (д, J=8,85 Гц, 1H), 1,97-2,14 (м, 1H), 0,93-1,06 (м, 2H), 0,77-0,91 (м, 2H). MS (ESI+) m/z 226,0 (M+H)+.

Пример 112

5-[4-(2-фенилэтил)-1H-1,2,3-триазол-1-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 1-фенил-1-бутина вместо 3-фенил-1-пропина. Продукт представлял собой 1:1 смесь исходного вещества и указанного в заголовке соединения. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,48 (с, 1H), 8,25 (с, 1H), 8,21 (д, J=1,53 Гц, 1H), 8,06 (с, 1H), 7,81-7,89 (м, 1H), 7,73-7,80 (м, 1H), 7,61 (дд, J=8,85, 1,53 Гц, 1H), 7,45 (д, J=8,54 Гц, 1H), 7,25-7,36 (м, 4H), 7,17-7,25 (м, 1H), 3,04 (с, 4H). MS (ESI+) m/z 290,1 (M+H)+.

Пример 113

5-[4-(циклогексилметил)-1H-1,2,3-триазол-1-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 3-циклогексил-1-пропина вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,49 (с, 1H), 8,21-8,29 (м, 2H), 7,88 (д, J=9,00, 1,98 Гц, 1H), 7,77 (д, J=8,85 Гц, 1H), 2,61 (д, J=6,71 Гц, 2H), 1,54-1,77 (м, 6H), 1,08-1,30 (м, 3H), 0,91-1,05 (м, 2H). MS (ESI+) m/z 282,2 (M+H)+.

Пример 114

5-(4-циклопентил-1H-1,2,3-триазол-1-ил)-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием циклопентилацетилена вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,52 (с, 1H), 8,19-8,30 (м, 2H), 7,88 (д, J=9,00, 1,98 Гц, 1H), 7,77 (д, J=8,85 Гц, 1H), 3,13-3,27 (м, 1H), 1,98-2,15 (м, 2H), 1,57-1,84 (м, 6H). MS (ESI+) m/z 254,0 (M+H)+.

Пример 115

1-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]циклогексанол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 1-этинил-1-циклогексанола вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,52 (с, 1H), 8,21-8,30 (м, J=1,53 Гц, 2H), 7,89 (дд, J=9,00, 1,98 Гц, 1H), 7,77 (д, J=8,85 Гц, 1H), 2,16-2,46 (м, 1H), 1,92-2,05 (м, 2H), 1,77-1,86 (м, 2H), 1,61-1,77 (м, 2H), 1,51-1,59 (м, 1H), 1,42-1,51 (м, 2H), 1,28-1,40 (м, J=9,92, 2,90 Гц, 1H). MS (ESI+) m/z 284,0 (M+H)+.

Пример 116

5-[4-(феноксиметил)-1H-1,2,3-триазол-1-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием фенилпропаргилового эфира вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,87 (с, 1H), 8,22-8,34 (м, 2H), 7,89 (д, J=8,85, 1,83 Гц, 1H), 7,79 (д, J=9,15 Гц, 1H), 7,29-7,41 (м, 2H), 7,09 (д, J=7,63 Гц, 2H), 6,99 (т, J=7,32 Гц, 1H), 5,25 (с, 2H). MS (ESI+) m/z 292,0 (M+H)+.

Пример 117

5-{4-[(1,1-диоксидотиоморфолин-4-ил)метил]-1H-1,2,3-триазол-1-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием N-пропаргилтиоморфолин-сульфона вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,81 (с, 1H), 8,24-8,36 (м, 2H), 7,89 (д, J=9,00, 1,98 Гц, 1H), 7,80 (д, J=9,15 Гц, 1H), 4,38 (с, 2H), 3,30-3,56 (м, J=39,36 Гц, 8H). MS (ESI+) m/z 332,9 (M+H)+.

Пример 118

5-[4-(3-фенилпропил)-1H-1,2,3-триазол-1-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 1-фенил-1-пентина вместо 3-фенил-1-пропина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 8,52 (с, 1H), 8,26 (с, 1H), 8,23 (д, J=1,53 Гц, 1H), 7,87 (д, J=9,00, 1,98 Гц, 1H), 7,76 (д, J=9,15 Гц, 1H), 7,31 (т, J=7,32 Гц, 2H), 7,23-7,28 (м, 2H), 7,20 (т, J=7,32 Гц, 1H), 2,74 (т, J=7,63 Гц, 2H), 2,65-2,72 (м, 2H), 1,95-2,05 (м, 2H). MS (ESI+) m/z 304,2 (M+H)+.

Пример 119

[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил](фенил)метанон

Пример 119A

трет-Бутил 5-этинил-1H-индазол-1-карбоксилат

К раствору соединения Примера 3C (230 мг, 1,62 ммоль) в дихлорметане (10 мл) добавляли ди-трет-бутилдикарбонат (459 мг, 2,1 ммоль) и щепотку диметиламинопиридина (~3 мг) и смесь перемешивали в течение 30 минут при комнатной температуре. Добавляли воду и продукт экстрагировали дихлорметаном, сушили над сульфатом натрия, фильтровали и растворитель выпаривали при пониженном давлении с получением указанного в заголовке соединения. MS (ESI+) m/z 265,0 (M+Na)+.

Пример 119B

[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил](фенил)метанон

В атмосфере аргона сосуд, содержащий соединение Примера 119A (90 мг, 0,37 ммоль), бензилазид (0,047 мл, 0,37 ммоль), тетрагидрофуран (3 мл), триэтиламин (0,062 мл, 0,44 ммоль), CuI (71 мг, 0,37 ммоль) и бензоилхлорид (0,059 мл, 0,51 ммоль), закрывали крышкой и встряхивали в течение 16 часов. Растворители выпаривали и продукт очищали при помощи колоночной хроматографии на силикагеле в 5-30% этилацетата в гексане. Неочищенное вещество обрабатывали при помощи ТФУ (0,5 мл) в дихлорметане (1 мл) и очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 13,08 (с, 1H), 7,98 (с, 1H), 7,77 (с, 1H), 7,54 (д, J=8,24, 1,22 Гц, 2H), 7,43-7,48 (м, 1H), 7,33-7,40 (м, 2H), 7,22-7,30 (м, 5H), 7,17-7,21 (м, 2H), 5,74 (с, 2H). MS (ESI+) m/z 380,1 (M+H)+.

Пример 120

N,N-диэтил-N-{[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]метил}амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 1,1-диэтилпропаргиламина вместо 3-фенил-1-пропина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,98 (с, 1H), 8,30 (д, J=1,36 Гц, 1H), 8,27 (с, 1H), 7,85-7,93 (м, 1H), 7,75-7,83 (м, 1H), 4,53 (д, J=4,07 Гц, 2H), 3,11-3,23 (м, 4H), 1,31 (т, J=7,12 Гц, 6H). MS (ESI+) m/z 271,0 (M+H)+.

Пример 121

этил N-[2-(1H-индазол-5-ил)имидазо[1,2-a]пиримидин-3-ил]-бета-аланинат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 43, с использованием этилизоцианопропионат вместо изопропилизоцианида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,09 (с, 1H), 8,71 (д, J=6,78, 2,03 Гц, 1H), 8,54 (с, 1H), 8,46 (д, J=4,24, 1,87 Гц, 1H), 8,23 (д, J=8,82, 1,36 Гц, 1H), 8,14 (с, 1H), 7,61 (д, J=8,82 Гц, 1H), 7,05 (д, J=6,78, 4,07 Гц, 1H), 5,03 (т, J=5,93 Гц, 1H), 3,96 (кв., J=7,12 Гц, 2H), 3,23 (кв., J=6,22 Гц, 2H), 2,47-2,55 (м, 2H), 1,08 (т, J=7,12 Гц, 3H). MS (ESI+) m/z 351,1 (M+H)+.

Пример 122

5-(1-бензил-5-метил-1H-1,2,3-триазол-4-ил)-1H-индазол

Пример 122A

1-Бензил-5-метил-4-(трибутилстаннил)-1H-1,2,3-триазол

Трибутил(1-пропинил)олово (3,87 г, 11,8 ммоль) и бензилазид (2,2 мл, 17,6 ммоль) объединяли и нагревали до 150°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 464,2 (M+H)+.

Пример 122B

1-(5-(1-Бензил-5-метил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-ил)этанон

Соединение Примера 87A (235 мг, 0,821 ммоль), соединение Примера 122A (380 мг, 0,822 ммоль), дихлорбис(трифенилфосфин)палладий(II) (60 мг, 0,085 ммоль) и тиофен-2-карбоксилат меди (325 мг, 1,23 ммоль) объединяли в толуоле (2,0 мл) в микроволновом сосуде в инертной атмосфере азота. Сосуд нагревали в микроволновом устройстве (CEM-Discover) до 150°C при 125 Ватт в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 332,2 (M+H)+.

Пример 122C

5-(1-бензил-5-метил-1H-1,2,3-триазол-4-ил)-1H-индазол

Соединение Примера 122B (109 мг, 0,329 ммоль) растворяли в тетрагидрофуране (3,0 мл) и воде (0,5 мл) и добавляли гидроксид калия (53 мг, 0,945 ммоль). Смесь перемешивали в течение 2 часов, разбавляли этилацетатом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-5% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,13 (с, 1H), 8,12 (с, 1H), 8,01 (с, 1H), 7,71-7,78 (м, 1H), 7,59-7,66 (м, 1H), 7,31-7,45 (м, 3H), 7,23-7,29 (м, 2H), 5,65 (с, 2H), 2,43 (с, 3H). MS (ESI+) m/z 290,1 (M+H)+.

Пример 123

5-(1-бензил-5-метил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Пример 123A

5-(1-Бензил-5-метил-1H-1,2,3-триазол-4-ил)-2-фторбензонитрил

Соединение Примера 122A (415 мг, 0,792 ммоль), 5-бром-2-фторбензонитрил (158 мг, 0,790 ммоль), дихлорбис(трифенилфосфин)палладий(II) (52 мг, 0,074 ммоль) и тиофен-2-карбоксилат меди (226 мг, 1,19 ммоль) объединяли в толуоле (2 мл) в микроволновом сосуде в инертной атмосфере азота. Сосуд нагревали в микроволновом устройстве (CEM-Discover) при 150°C при 125 Ватт в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 293,0 (M+H)+.

Пример 123B

5-(1-бензил-5-метил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Соединение Примера 123A (120 мг, 0,339 ммоль) обрабатывали гидразингидратом (1,0 мл) в этаноле (1,0 мл) и нагревали до 60°C в течение ночи. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент метанол в дихлорметане (0-5%), с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,43 (с, 1H), 7,98 (с, 1H), 7,60 (д, J=8,65, 1,53 Гц, 1H), 7,27-7,44 (м, 4H), 7,21-7,27 (м, 2H), 5,65 (с, 2H), 5,41 (с, 2H), 2,41 (с, 3H). MS (ESI+) m/z 305,1 (M+H)+.

Пример 124

N3-[2-(1H-индазол-5-ил)имидазо[1,2-α]пиримидин-3-ил]-β-аланамид

Соединение Примера 121 (42 мг, 0,120 ммоль) и 7 н раствор аммиака в метаноле (1,0 мл) объединяли и нагревали до 60°C в течение ночи. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент метанола в дихлорметане (1-7%), с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,09 (с, 1H), 8,76 (д, J=6,78, 2,03 Гц, 1H), 8,56 (с, 1H), 8,45 (д, J=4,07, 2,03 Гц, 1H), 8,24 (д, J=8,82, 1,36 Гц, 1H), 8,15 (с, 1H), 7,61 (д, J=8,48 Гц, 1H), 7,32 (с, 1H), 7,03 (д, J=6,78, 4,07 Гц, 1H), 6,85 (с, 1H), 4,93 (т, J=6,10 Гц, 1H), 3,11-3,23 (м, 2H), 2,32 (т, J=6,78 Гц, 2H). MS (ESI+) m/z 322,0 (M+H)+.

Пример 125

5-(1-бензил-5-иод-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Пример 125A

5-(1-Бензил-5-иод-1H-1,2,3-триазол-4-ил)-2-фторбензонитрил

Смесь соединения Примера 62B (200 мг, 1,38 ммоль), бензилазида (0,176 мл, 1,38 ммоль), тетрагидрофурана (12 мл), триэтиламина (0,230, 1,56 ммоль), CuI (263 мг, 1,38 ммоль) и ICl (0,069 мл, 1,38 ммоль) в атмосфере аргона перемешивали при комнатной температуре в течение 24 часов. Растворитель выпаривали и неочищенную смесь растворяли в дихлорметане, загружали непосредственно в колонку с силикагелем и элюировали смесью этилацетат/гексан (10-20%) с получением указанного в заголовке соединения. MS (ESI+) m/z 404,9 (M+H)+.

Пример 125B

5-(1-бензил-5-иод-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Соединение Примера 125A (50 мг, 0,12 ммоль) и гидразинмоногидрат (1 мл) в этаноле (1 мл) нагревали при 95°C в течение 2 часов. Добавляли воду и твердое вещество собирали фильтрованием и затем очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения в форме соли ТФУ. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 12,07 (с, 1H), 8,30 (с, 1H), 7,83 (д, J=8,85, 1,53 Гц, 1H), 7,44 (д, J=8,54 Гц, 1H), 7,38-7,43 (м, J=7,32, 7,32 Гц, 2H), 7,32-7,37 (м, 1H), 7,23-7,27 (м, J=7,02 Гц, 2H), 5,74 (с, 2H), 4,00 (с, 2H). MS (ESI+) m/z 417,0 (M+H)+.

Пример 126

N-{3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенил}-N'-(3-метилфенил)мочевина

Пример 126A

1-(3-(1-Бензил-4-(3-циано-4-фторфенил)-1H-1,2,3-триазол-5-ил)фенил)-3-м-толилмочевина

В атмосфере аргона сосуд, содержащий соединение Примера 125A (94 мг, 0,23 ммоль), 1-(3-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)фенил)-3-м-толилмочевину (полученную в соответствии с процедурой, описанной в WO2004/113304) (990 мг, 0,26 ммоль), PdCl2dppf.дихлорметан (19 мг, 0,02 ммоль), карбонат калия (64 мг, 0,46 ммоль), DME (2 мл) и воду (0,2 мл), закрывали крышкой и нагревали в нагревательном устройстве с встряхиванием при 80°C в течение 90 минут. Растворители выпаривали и продукт экстрагировали метанолом/дихлорметаном. Очистка при помощи колоночной хроматографии на силикагеле с использованием 10% этилацетата в гексане давала указанное в заголовке соединение. MS (ESI+) m/z 503,2 (M+H)+.

Пример 126B

N-{3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенил}-N'-(3-метилфенил)мочевина

Соединение Примера 126A (25 мг, 0,05 ммоль) и гидразинмоногидрат (0,5 мл) в этаноле (2 мл) нагревали при 80°C в течение 1 часа. Неочищенную смесь загружали в колонку с силикагелем и элюировали с использованием градиента 0-5% метанола в дихлорметане с получением указанного в заголовке соединения. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,40 (с, 1H), 8,79 (с, 1H), 8,63 (с, 1H), 8,12 (с, 1H), 7,57 (д, J=8,24, 1,22 Гц, 1H), 7,43 (т, J=1,83 Гц, 1H), 7,38 (т, J=7,93 Гц, 1H), 7,23-7,34 (м, 4H), 7,08-7,22 (м, 4H), 7,03 (д, J=6,71 Гц, 2H), 6,88 (д, J=7,63 Гц, 1H), 6,78 (д, J=7,32 Гц, 1H), 5,50 (с, 2H), 5,36 (с, 2H), 2,26 (с, 3H). MS (ESI+) m/z 515,3 (M+H)+.

Пример 127

5-(1H-индазол-5-ил)-N-(2-изопропоксиэтил)изоксазол-3-карбоксамид

В 20-мл сосуд добавляли раствор соединения Примера 81A (37 мг, 0,18 ммоль), растворенного в диметилформамиде (0,8 мл), с последующим добавлением HATU (61 мг, 0,18 ммоль), растворенного в диметилформамиде (0,8 мл). Затем добавляли раствор 2-изопропоксиэтанамина (20 мг, 0,20 ммоль), растворенного в диметилформамиде (0,9 мл), с последующим добавлением диизопропилэтиламина (42 мг, 0,36 ммоль), растворенного в диметилформамиде (0,8 мл). Смесь затем встряхивали при 40°C в течение трех часов. Неочищенную реакционную смесь фильтровали через Si-карбонатный картридж (6 мл, 2 г), поставляемый компанией Silicycle Chemical Division, с использованием метанола, контролировали методом ЖХ/МС и концентрировали досуха. Остаток растворяли в смеси 1:1 DMSO/метанол и очищали при помощи обращенно-фазовой ВЭЖХ (Agilent, градиент 5%-100% ТФУ/вода, в течение 8 минут). 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,38-8,43 (м, 1H), 8,22-8,30 (м, 1H), 7,90 (д, 1H), 7,73 (д, 1H), 7,21-7,29 (м, 1H), 3,56-3,65 (м, 1H), 3,52 (т, 2H), 3,43 (т, 2H), 1,10 (д, 6H). MS (ESI+) m/z 315 (M+H)+.

Пример 128

5-[3-(морфолин-4-илкарбонил)изоксазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием морфолина вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,36-8,43 (м, 1H), 8,22-8,29 (м, 1H), 7,89 (д, 1H), 7,72 (д, 1H), 7,11-7,22 (м, 1H), 3,68-3,72 (м, 4H), 3,61-3,68 (м, 4H). MS (ESI+) m/z 299 (M+H)+.

Пример 129

5-(1H-индазол-5-ил)-N-(3-морфолин-4-илпропил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 127, с использованием 3-морфолинопропан-1-амина вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,37-8,46 (м, 1H), 8,20-8,31 (м, 1H), 7,91 (д, 1H), 7,73 (д, 1H), 7,17-7,36 (м, 1H), 3,98-4,08 (м, 2H), 3,57-3,73 (м, 2H), 3,42-3,51 (м, 2H), 3,35-3,41 (м, 2H), 3,14-3,22 (м, 2H), 3,01-3,14 (м, 2H), 1,88-2,06 (м, 2H). MS (ESI+) m/z 356 (M+H)+.

Пример 130

N-[2-(1H-имидазол-4-ил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием 2-(1H-имидазол-4-ил)этанамина вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,90-8,97 (м, 1H), 8,34-8,46 (м, 1H), 8,20-8,32 (м, 1H), 7,90 (д, 1H), 7,72 (д, 1H), 7,38-7,49 (м, 1H), 7,14-7,28 (м, 1H), 3,57 (т, 2H), 2,96 (т, 2H). MS (ESI+) m/z 323 (M+H)+.

Пример 131

(3R)-1-{[5-(1H-индазол-5-ил)изоксазол-3-ил]-карбонил}пиперидин-3-ол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием гидрохлорида (R)-пиперидин-3-ола вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,34-8,45 (м, 1H), 8,19-8,30 (м, 1H), 7,89 (д, 1H), 7,72 (д, 1H), 7,13 (д, 1H), 4,03-4,19 (м, 1H), 3,64-3,72 (м, 1H), 3,54-3,62 (м, 1H), 3,34-3,44 (м, 1H), 3,20-3,32 (м, 1H), 2,99-3,10 (м, 1H), 1,67-2,03 (м, 2H), 1,36-1,61 (м, 2H). MS (ESI+) m/z 313 (M+H)+.

Пример 132

1-{[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил}пиперидин-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием пиперидин-3-карбоксамида вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,36-8,45 (м, 1H), 8,22-8,32 (м, 1H), 7,90 (д, 1H), 7,72 (д, 1H), 7,07-7,23 (м, 1H), 4,27-4,56 (м, 1H), 3,91-4,05 (м, 1H), 3,09-3,37 (м, 1H), 2,85-3,04 (м, 1H), 2,31-2,45 (м, 1H), 1,89-2,05 (м, 1H), 1,73-1,86 (м, 1H), 1,60-1,72 (м, 1H), 1,36-1,55 (м, 1H). MS (ESI-) m/z 338 (M-H)-.

Пример 133

2-[2-(4-{[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил}пиперазин-1-ил)этокси]этанол

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 127, с использованием 2-(2-(пиперазин-1-ил)этокси)этанола вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,39-8,48 (м, 1H), 8,19-8,32 (м, 1H), 7,92 (д, 1H), 7,74 (д, 1H), 7,17-7,27 (м, 1H), 4,49-4,60 (м, 1H), 3,94-4,01 (м, 1H), 3,76-3,81 (м, 4H), 3,56-3,63 (м, 2H), 3,51-3,56 (м, 2H), 3,33-3,43 (м, 3H), 3,13-3,23 (м, 1H), 2,65-2,75 (м, 2H). MS (ESI+) m/z 386 (M+H)+.

Пример 134

5-{3-[(4-метил-1,4-диазепан-1-ил)карбонил]изоксазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 127, с использованием 1-метил-1,4-диазепана вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,38-8,46 (м, 1H), 8,22-8,32 (м, 1H), 7,85-7,98 (м, 1H), 7,75 (д, 1H), 7,22 (д, 1H), 4,07-4,19 (м, 1H), 3,69-3,77 (м, 2H), 3,59-3,67 (м, 1H), 3,44-3,59 (м, 1H), 3,35-3,44 (м, 1H), 3,24-3,35 (м, 2H), 2,84-2,95 (м, 3H), 2,66-2,74 (м, 1H), 2,10-2,26 (м, 2H). MS (ESI+) m/z 326 (M+H)+.

Пример 135

N-(3-гидроксипропил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием 3-аминопропан-1-ола вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,36-8,45 (м, 1H), 8,20-8,30 (м, 1H), 7,84-7,94 (м, 1H), 7,71 (д, 1H), 7,18-7,28 (м, 1H), 3,48 (т, 2H), 3,35 (т, 2H), 1,64-1,78 (м, 2H). MS (ESI+) m/z 387 (M+H)+.

Пример 136

N-[(1R)-2-гидрокси-1-фенилэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием (R)-2-амино-2-фенилэтанола вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 9,11 (д, 1H), 8,37-8,46 (м, 1H), 8,23-8,28 (м, 1H), 7,91 (д, 1H), 7,73 (д, 1H), 7,40-7,45 (м, 2H), 7,32-7,39 (м, 2H), 7,23-7,32 (м, 2H), 5,05-5,13 (м, 1H), 3,66-3,72 (м, 2H). MS (ESI+) m/z 349 (M+H)+.

Пример 137

N-[3-(1H-индазол-1-ил)пропил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием 3-(1H-индазол-1-ил)пропан-1-амина вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 9,02-9,10 (м, 1H), 8,40-8,44 (м, 1H), 8,25-8,29 (м, 1H), 7,87-7,95 (м, 1H), 7,71-7,82 (м, 2H), 7,61-7,69 (м, 1H), 7,20-7,29 (м, 1H), 4,28 (т, 2H), 3,33 (т, 2H), 2,06-2,19 (м, 2H). MS (ESI+) m/z 337 (M+H)+.

Пример 138

5-(1H-индазол-5-ил)-N-[3-(2-оксопирролидин-1-ил)пропил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием 1-(3-аминопропил)пирролидин-2-она вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,38-8,43 (м, 1H), 8,24-8,30 (м, 1H), 7,87-7,93 (м, 1H), 7,73 (д, 1H), 7,22-7,26 (м, 1H), 3,39 (т, 2H), 3,21-3,30 (м, 4H), 2,26 (т, 2H), 1,90-2,00 (м, 2H), 1,70-1,79 (м, 2H). MS (ESI+) m/z 354 (M+H)+.

Пример 139

N-{2-[4-(аминосульфонил)фенил]этил}-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 127, с использованием 4-(2-аминоэтил)бензолсульфонамида вместо 2-изопропоксиэтанамина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,37-8,42 (м, 1H), 8,24-8,29 (м, 1H), 7,86-7,93 (м, 1H), 7,70-7,80 (м, 3H), 7,47 (д, 2H), 7,20-7,24 (м, 1H), 3,57 (т, 2H), 2,96 (т, 2H). MS (ESI+) m/z 412 (M+H)+.

Пример 140

[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил](3-хлорфенил)метанон

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 119B, с использованием 3-хлорбензоилхлорида вместо бензоилхлорида. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,09 (с, 1H), 7,99 (с, 1H), 7,77 (с, 1H), 7,38-7,51 (м, 4H), 7,28-7,37 (м, 3H), 7,20-7,27 (м, 4H), 5,78 (с, 2H). MS (ESI+) m/z 414,1 (M+H)+.

Пример 141

[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил] (циклопропил)метанон

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 119B, с использованием циклопропанкарбонилхлорида вместо бензоилхлорида. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,26 (с, 1H), 8,18 (с, 1H), 8,08 (с, 1H), 7,61-7,70 (м, 2H), 7,29-7,40 (м, 3H), 7,24 (д, J=7,02 Гц, 2H), 5,79 (с, 2H), 1,86-2,00 (м, 1H), 0,98-1,12 (м, 2H), 0,77-0,93 (м, 2H). MS (ESI+) m/z 344,1 (M+H)+.

Пример 142

5-[5-циклопропил-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Пример 142A

5-Циклопропил-1-((тетрагидро-2H-пиран-4-ил)метил)-4-(трибутилстаннил)-1H-1,2,3-триазол

Циклопропилацетилен (142 мг, 2,15 ммоль) добавляли к 1,1,1-трибутил-N,N-диметилстаннанамину (716 мг, 2,14 ммоль) в гексане (3,0 мл) и перемешивали в герметично закрытом сосуде при 70°C в течение 2 часов. Смесь охлаждали до температуры окружающей среды и содержимое сосуда перемешивали без герметизации в течение 10 минут. Добавляли соединение Примера 80A (455 мг, 3,22 ммоль) и сосуд снова герметично закрывали и нагревали до 130°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент этилацетата в гексане (5-50%), с получением указанного в заголовке соединения. MS (ESI+) m/z 498,3 (M+H)+.

Пример 142B

1-(5-(5-Циклопропил-1-((тетрагидро-2H-пиран-4-ил)метил)-1H-1,2,3-триазол-4-ил)-1H-индазол-1-ил)этанон

Соединение Примера 142A (220 мг, 0,444 ммоль), соединение Примера 87A (128 мг, 0,447 ммоль), дихлорбис(трифенилфосфин)палладий(II) (33 мг, 0,047 ммоль) и тиофен-2-карбоксилат меди (127 мг, 0,666 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали 150°C в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-70% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 366,0 (M+H)+.

Пример 142C

5-[5-циклопропил-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Соединение Примера 142B (46 мг, 0,126 ммоль) растворяли в тетрагидрофуране (2,0 мл) и воде (0,5 мл) и добавляли гидроксид калия (80 мг, 1,43 ммоль). Смесь перемешивали в течение 2 часов, разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-8% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, CDCl3) δ м.д. 8,19 (с, 1H), 7,96 (д, J=8,82 Гц, 1H), 7,61 (д, J=7,80 Гц, 1H), 7,25-7,28 (м, 1H), 4,34 (д, J=6,44 Гц, 2H), 4,02 (д, J=1 1,36, 3,56 Гц, 2H), 3,42 (т, J=1 1,53 Гц, 2H), 2,33-2,46 (м, 1H), 1,81-1,95 (м, 1H), 1,59-1,70 (м, 2H), 1,43-1,58 (м, 2H), 1,23-1,28 (м, 1H), 1,10-1,20 (м, 2H), 0,47-0,62 (м, 2H). MS (ESI+) m/z 324,1 (M+H)+.

Пример 143

N1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]метил}глицинамид

Пример 143A

2-((1-Бензил-4-(трибутилстаннил)-lΗ-1,2,3-триазол-5-ил)метил)изоиндолин-1,3-дион

N-Пропаргилфталимид (2,35 мг, 12,7 ммоль) добавляли к 1,1,1-трибутил-N,N-диметилстаннанамину (4,23 мг, 12,7 ммоль) в гексане (3,0 мл) и перемешивали в герметично закрытом сосуде при 70°C в течение 2 часов. Смесь охлаждали до температуры окружающей среды и содержимое сосуда перемешивали без герметизации в течение 10 минут. Добавляли бензилазид (2,0 мл, 16,0 ммоль) и сосуд снова герметично закрывали и нагревали до 130°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 609,3 (M+H)+.

Пример 143B

2-((4-(1-Ацетил-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил)метил)изоиндолин-1,3-дион

Соединение Примера 143A (567 мг, 0,934 ммоль), соединение Примера 87A (268 мг, 0,934 ммоль), дихлорбис(трифенилфосфин)палладий(II) (67 мг, 0,095 ммоль) и тиофен-2-карбоксилат меди (268 мг, 1,41 ммоль) объединяли в толуоле (2,5 мл) в микроволновом сосуде в инертной атмосфере азота. Сосуд нагревали в микроволновом устройстве (CEM-Discover) до 150°C при 125 Ватт в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 477,2 (M+H)+.

Пример 143C

(1-Бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил)метанамин

Соединение Примера 143B (140 мг, 0,294 ммоль) обрабатывали гидразингидратом (0,7 мл) в этаноле (0,7 мл) и перемешивали при температуре окружающей среды в течение ночи. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 1-6% метанола в дихлорметане, с получением указанного в заголовке соединения. MS (ESI+) m/z 305,0 (M+H)+.

Пример 143D

N1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]метил}глицинамид

Соединение Примера 143C (66 мг, 0,217 ммоль), N-(трет-бутоксикарбонил)-глицин (39 мг, 0,223 ммоль) и ΗATU (85 мг, 0,224 ммоль) объединяли в метиленхлориде (2,5 мл). Добавляли диизопропилэтиламин (150 мкл, 0,865 ммоль) и смесь перемешивали при температуре окружающей среды в течение ночи. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-6% метанола в дихлорметане, с получением трет-бутил 2-((1-бензил-4-(lΗ-индазол-5-ил)-lΗ-1,2,3-триазол-5-ил)метиламино)-2-оксоэтилкарбамата. Этот карбамат растворяли в тетрагидрофуране (2 мл) и добавляли 0,5 мл раствора 1 н хлористоводородной кислоты в диэтиловом эфире и смесь перемешивали в течение 20 минут при комнатной температуре. Растворители удаляли при пониженном давлении и к смеси добавляли диэтиловый эфир и перемешивали при комнатной температуре в течение ночи. Растворитель декантировали и полученный остаток сушили под потоком азота с получением указанного в заголовке соединения в форме гидрохлоридной соли. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,21 (с, 1H), 9,02 (т, J=5,09 Гц, 1H), 8,11-8,16 (м, 2H), 8,06 (с, 2H), 7,75-7,82 (м, 1H), 7,64 (д, J=8,82 Гц, 1H), 7,30-7,45 (м, 3H), 7,23-7,31 (м, 2H), 5,72 (с, 2H), 4,57 (д, J=5,09 Гц, 2H), 3,41 (кв., J=5,76 Гц, 2H). MS (ESI+) m/z 362,1 (M+H)+.

Пример 144

(4-фторфенил) [4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил}метанон

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 119B, с использованием 4-фторбензоилхлорида вместо бензоилхлорида и с использованием соединения Примера 80A вместо бензилазида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,10 (с, 1H), 8,00 (с, 1H), 7,72-7,80 (м, 3H), 7,38-7,44 (м, 1H), 7,30-7,36 (м, 1H), 7,09-7,19 (м, 2H), 4,41 (д, J=7,12 Гц, 2H) 3,80 (д, J=1 1,36, 2,54 Гц, 2H), 3,14-3,26 (м, 2H), 2,04-2,19 (м, 1H), 1,38-1,49 (м, 2H), 1,19-1,35 (м, 2H). MS (ESI+) m/z 406,1 (M+H)+.

Пример 145

(4-хлорфенил)[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил]метанон

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 119B, с использованием 4-хлорбензоилхлорида вместо бензоилхлорида и с использованием соединения Примера 80A вместо бензилазида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,10 (с, 1H), 8,00 (с, 1H), 7,77 (с, 1H), 7,68 (д, J=8,48 Гц, 2H), 7,29-7,45 (м, 4H), 4,42 (д, J=7,12 Гц, 2H), 3,81 (д, J=1 1,19, 2,71 Гц, 2H), 3,14-3,27 (м, 2H), 2,03-2,19 (м, 1H), 1,38-1,51 (м, 2H), 1,22-1,36 (м, 2H). MS (ESI+) m/z 422,1 (M+H)+.

Пример 146

(3-хлорфенил)[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил}метанон

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 119B, с использованием 3-хлорбензоилхлорида вместо бензоилхлорида и с использованием соединения Примера 80A вместо бензилазида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,04 (с, 1H), 7,95 (с, 1H), 7,64 (с, 1H), 7,48-7,54 (м, 1H), 7,29-7,35 (м, 1H), 7,22-7,28 (м, 1H), 7,13-7,22 (м, 3H), 4,58 (д, J=7,12 Гц, 2H), 3,86 (д, J=1 1,53, 2,37 Гц, 2H), 3,20-3,30 (м, 2H), 2,11-2,24 (м, 1H), 1,45-1,54 (м, 2H), 1,33-1,44 (м, 2H). MS (ESI+) m/z 422,1 (M+H)+.

Пример 147

(2-хлорфенил)[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил}метанон

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 119B, с использованием 2-хлорбензоилхлорида вместо бензоилхлорида и с использованием соединения Примера 80A вместо бензилазида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,08 (с, 1H), 7,99 (с, 1H), 7,75 (с, 1H), 7,66 (т, J=1,86 Гц, 1H), 7,56 (д, J=7,80 Гц, 1H), 7,47-7,53 (м, 1H), 7,36-7,42 (м, 1H), 7,23-7,34 (м, 2H), 4,45 (д, J=6,78 Гц, 2H), 3,82 (д, J=1 l,19, 2,37 Гц, 2H), 3,18-3,29 (м, 2H), 2,09-2,23 (м, 1H), 1,41-1,53 (м, 2H), 1,28-1,38 (м, 2H). MS (ESI+) m/z 422,1 (M+H)+.

Пример 148

циклопентил[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил}метанон

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 119B, с использованием циклопентанкарбонилхлорида вместо бензоилхлорида и с использованием соединения Примера 80A вместо бензилазида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,27 (с, 1H), 8,18 (с, 1H), 7,95 (с, 1H), 7,68 (д, J=8,48 Гц, 1H), 7,52 (д, J=8,48, 1,70 Гц, 1H), 4,47 (д, J=7,12 Гц, 2H), 3,85 (д, J=1 1,53, 2,37 Гц, 2H), 3,18-3,30 (м, 2H), 3,02-3,14 (м, 1H), 2,00-2,17 (м, 1H), 1,19-1,76 (м, 12H). MS (ESI+) m/z 380,1 (M+H)+.

Пример 149

1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоновая кислота

Пример 149A

Метил 1-бензил-4-(трибутилстаннил)-1H-1,2,3-триазол-5-карбоксилат

Метилпропиолат (5,75 г, 68,4 ммоль) добавляли к метилэтил(трибутилстаннил)карбамату (26,9 г, 68,6 ммоль) в большой герметично закрытой пробирке. Смесь нагревали до 70°C в течение ночи. Смесь охлаждали до температуры окружающей среды и содержимое сосуда перемешивали без герметизации в течение 10 минут. Добавляли бензилазид (10,2 мл, 81,6 ммоль) и сосуд снова герметично закрывали и нагревали до 130°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 508,3 (M+H)+.

Пример 149B

метил 4-(1-ацетил-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-карбоксилат

Соединение Примера 149A (7,17 г, 14,1 ммоль), соединение Примера 87A (4,02 г, 14,1 ммоль), дихлорбис(трифенилфосфин)палладий(II) (1,01 мг, 1,44 ммоль) и тиофен-2-карбоксилат меди (4,07 мг, 21,3 ммоль) объединяли в толуоле (55 мл) в большой герметично закрытой пробирке в инертной атмосфере азота. Пробирку герметично закрывали и нагревали при 150°C в течение 30 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 376,1 (M+H)+.

Пример 149C

1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоновая кислота

Соединение Примера 149B (3,40 мг, 9,06 ммоль) растворяли в тетрагидрофуране (100 мл), метаноле (10 мл) и воде (10 мл) и добавляли гидроксид калия (1,63 г, 29,1 ммоль). Смесь перемешивали в течение 3 часов, разбавляли этилацетатом и промывали 1 н раствором хлористоводородной кислоты, промывали насыщенным солевым раствором и объединенные органические слои сушили над сульфатом натрия. После фильтрования растворители удаляли при пониженном давлении с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,16 (с, 1H), 8,11-8,18 (м, 2H), 7,66-7,76 (м, 1H), 7,54-7,62 (м, 1H), 7,31-7,43 (м, 3H), 7,22-7,29 (м, 2H), 5,93 (с, 2H). MS (ESI+) m/z 320,0 (M+H)+.

Пример 150

5-{5-(4-фторфенил)-1-[4-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин

Пример 150A

1-(азидометил)-4-(трифторметил)бензол

Азид натрия (2,30 г, 35,4 ммоль) добавляли к раствору 4-(трифторметил)бензилбромида (4,26 г, 17,8 ммоль), растворенного в диметилсульфоксиде (15 мл), и перемешивали при температуре окружающей среды в течение ночи. Смесь разбавляли этилацетатом, промывали водой и насыщенным солевым раствором и сушили над сульфатом натрия. После фильтрования растворитель удаляли при пониженном давлении с получением указанного в заголовке соединения. Неочищенный продукт использовали на следующей стадии без его дополнительного анализа.

Пример 150B

5-(4-фторфенил)-4-(трибутилстаннил)-1-(4-(трифторметил)бензил)-1H-1,2,3-триазол

4-Фторфенилацетилен (524 мг, 4,36 ммоль) добавляли к 1,1,1-трибутил-N,N-диметилстаннанамину (1,46 г, 4,37 ммоль) и смесь перемешивали в герметично закрытом сосуде при 50°C в течение 30 минут. Смесь охлаждали до температуры окружающей среды и содержимое сосуда перемешивали без герметизации в течение 10 минут. Добавляли соединение Примера 150A (1,28 г, 6,30 ммоль) и сосуд снова герметично закрывали и нагревали до 130°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-35% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 612,3 (M+H)+.

Пример 150C

2-фтор-5-(5-(4-фторфенил)-1-(4-(трифторметил)бензил)-1H-1,2,3-триазол-4-ил)бензонитрил

Соединение Примера 150B (485 мг, 0,795 ммоль), 5-бром-2-фторбензонитрил (143 мг, 0,715 ммоль), дихлорбис(трифенилфосфин)палладий(II) (49 мг, 0,070 ммоль) и тиофен-2-карбоксилат меди (205 мг, 1,08 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали при 150°C в течение 30 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 441,2 (M+H)+.

Пример 150D

5-{5-(4-фторфенил)-1-[4-(трифторметил)бензил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин

Соединение Примера 150C обрабатывали гидразингидратом (1,0 мл) в этаноле (1,0 мл) и реакционную смесь перемешивали и нагревали до 65°C в течение 3 часов. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-6% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,42 (с, 1H), 8,04 (с, 1H), 7,67 (д, J=8,14 Гц, 2H), 7,26-7,41 (м, 4H), 7,22 (д, J=8,48 Гц, 2H), 7,03-7,15 (м, 2H), 5,62 (с, 2H), 5,36 (с, 2H). MS (ESI+) m/z 453,1 (M+H)+.

Пример 151

5-[1-бензил-5-(4-фторфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Пример 151A

1-бензил-5-(4-фторфенил)-4-(трибутилстаннил)-1H-1,2,3-триазол

4-Фторфенилацетилен (525 мг, 4,37 ммоль) добавляли к 1,1,1-трибутил-N,N-диметилстаннанамину (1,46 г, 4,37 ммоль) и смесь перемешивали в герметично закрытом сосуде при 50°C в течение 2 часов. Смесь охлаждали до температуры окружающей среды и содержимое сосуда перемешивали без герметизации в течение 10 минут. Добавляли бензилазид (850 мкл, 6,80 ммоль) и сосуд снова герметично закрывали и нагревали до 130°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-35% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 544,4 (M+H)+.

Пример 151B

5-(1-Бензил-5-(4-фторфенил)-1H-1,2,3-триазол-4-ил)-2-фторбензонитрил

Соединение Примера 151A (361 мг, 0,666 ммоль), 5-бром-2-фторбензонитрил (119 мг, 0,595 ммоль), дихлорбис(трифенилфосфин)палладий(II) (45 мг, 0,064 ммоль) и тиофен-2-карбоксилат меди (193 мг, 1,01 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали 150°C в течение 30 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 373,0 (M+H)+.

Пример 151C

5-[1-бензил-5-(4-фторфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Соединение Примера 151B (135 мг, 0,363 ммоль) обрабатывали гидразингидратом (1,0 мл) в этаноле (1,0 мл) и перемешивали и нагревали до 65°C в течение 3 часов. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-6% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,40 (с, 1H), 8,02 (с, 1H), 7,24-7,38 (м, 7H), 7,03-7,14 (м, 2H), 6,98 (д, J=7,29, 2,20 Гц, 2H), 5,50 (с, 2H), 5,35 (с, 2H). MS (ESI+) m/z 385,1 (M+H)+.

Пример 152

[4-(1H-индазол-5-ил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-5-ил](тетрагидро-2H-пиран-4-ил)метанон

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 119B, с использованием соединения Примера 80A вместо бензилазида и с использованием тетрагидро-2H-пиран-4-карбонилхлорида вместо бензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,30 (с, 1H), 8,18 (с, 1H), 8,00 (с, 1H), 7,69 (д, J=8,48 Гц, 1H), 7,53 (д, J=8,65, 1,53 Гц, 1H), 4,48 (д, J=7,12 Гц, 2H), 3,79-3,90 (м, 2H), 3,62-3,74 (м, 2H), 3,18-3,30 (м, 2H), 2,76-2,88 (м, 1H), 2,64-2,76 (м, 2H), 2,00-2,17 (м, 1H), 1,20-1,58 (м, 8H). MS (ESI+) m/z 396,0 (M+H)+.

Пример 153

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Пример 153A

1-бензил-5-o-толил-4-(трибутилстаннил)-1H-1,2,3-триазол

2-Этинилтолуол (456 мкл, 3,62 ммоль) добавляли к 1,1,1-трибутил-N,N-диметилстаннанамину (1,21 г, 3,62 ммоль) и смесь перемешивали в герметично закрытом сосуде при 70°C в течение 3 часов. Смесь охлаждали до температуры окружающей среды и содержимое сосуда перемешивали без герметизации в течение 10 минут. Добавляли бензилазид (678 мкл, 5,42 ммоль) и сосуд снова герметично закрывали и нагревали до 130°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-45% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 539,8 (M+H)+.

Пример 153B

1-(5-(1-Бензил-5-o-толил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-ил)этанон

Соединение Примера 153A (119 мг, 0,221 ммоль), соединение Примера 87A (63 мг, 0,221 ммоль), дихлорбис(трифенилфосфин)палладий(II) (16 мг, 0,023 ммоль) и тиофен-2-карбоксилат меди (65 мг, 0,341 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали при 150°C в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-45% этилацетат в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 408,7 (M+H)+.

Пример 153C

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Соединение Примера 153B (42 мг, 0,103 ммоль) растворяли в тетрагидрофуране (2,0 мл) и воде (0,3 мл) и добавляли гидроксид калия (48 мг, 0,856 ммоль). Смесь перемешивали в течение 1 часа, разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 1-6% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,07 (с, 1H), 7,97 (с, 1H), 7,73 (с, 1H), 7,44-7,53 (м, 3H), 7,39 (т, J=6,95 Гц, 1H), 7,28-7,35 (м, 2H), 7,21-7,29 (м, 3H), 6,86-6,95 (м, 2H), 5,28-5,45 (м, 2H), 1,59 (с, 3H). MS (ESI+) m/z 366,1 (M+H)+.

Пример 154

5-{1-бензил-5-[(4-метилпиперазин-1-ил)карбонил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием соединения Примера 149C вместо соединения Примера 81A и с использованием 1-метилпиперазина вместо пиперидина и тетрагидрофурана вместо диметилформамида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,20 (с, 1H), 8,16 (с, 1H), 7,96 (с, 1H), 7,57-7,69 (м, 2H), 7,31-7,44 (м, 3H), 7,23-7,30 (м, 2H), 5,36-5,83 (м, 2H), 3,40-3,65 (м, J=4,75 Гц, 2H), 2,38-2,49 (м, 2H), 2,10-2,22 (м, 2H), 1,89 (с, 3H), 1,40 (т, J=4,92 Гц, 2H). MS (ESI+) m/z 402,2 (M+H)+.

Пример 155

5-{[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил]карбонил}пиперидин-4-ол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием соединения Примера 149C вместо соединения Примера 81A и с использованием 4-гидроксипиперидина вместо пиперидина и тетрагидрофурана вместо диметилформамида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,15-13,24 (м, 1H), 8,16 (с, 1H), 7,97 (с, 1H), 7,55-7,68 (м, 2H), 7,32-7,43 (м, 3H), 7,23-7,30 (м, 2H), 5,41-5,83 (м, J=65,10 Гц, 2H), 4,58 (д, J=3,39 Гц, 1H), 3,74-3,91 (м, 1H), 3,37-3,48 (м, 2H), 2,66-2,79 (м, 1H), 2,25-2,47 (м, 1H), 1,54-1,68 (м, 1H), 1,20-1,36 (м, 1H), 0,74-0,90 (м, 1H), 0,40-0,60 (м, 1H). MS (ESI+) m/z 403,1 (M+H)+.

Пример 156

1-ацетил-5-[5-(4-фторфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Пример 156A

5-(4-фторфенил)-1-((тетрагидро-2H-пиран-4-ил)метил)-4-(трибутилстаннил)-1H-1,2,3-триазол

4-Фторфенилацетилен (440 мкл, 3,88 ммоль) добавляли к 1,1,1-трибутил-N,N-диметилстаннанамину (1,30 г, 3,89 ммоль) и смесь перемешивали в герметично закрытом сосуде при 50°C в течение 40 минут. Смесь охлаждали до температуры окружающей среды и содержимое сосуда перемешивали без герметизации в течение 10 минут. Добавляли соединение Примера 80A (710 мкл, 5,68 ммоль) и сосуд снова герметично закрывали и нагревали до 130°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 552,4 (M+H)+.

Пример 156B

1-ацетил-5-[5-(4-фторфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Соединение Примера 156A (433 мг, 0,787 ммоль), соединение Примера 87A (205 мг, 0,717 ммоль), дихлорбис(трифенилфосфин)палладий(II) (55 мг, 0,078 ммоль) и тиофен-2-карбоксилат меди (224 мг, 1,17 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали до 150°C в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-45% этилацетата в гексане, и растирали в порошок с метанолом с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,40-8,48 (м, J=0,68 Гц, 1H), 8,25 (д, J=8,82 Гц, 1H), 7,82-7,91 (м, 1H), 7,73 (д, J=8,48, 1,70 Гц, 1H), 7,50-7,60 (м, 2H), 7,38-7,49 (м, 2H), 4,13 (д, J=7,12 Гц, 2H), 3,76 (д, J=1 1,36, 2,54 Гц, 2H), 3,10-3,25 (м, 2H), 2,70 (с, 3H), 1,86-2,08 (м, 1H), 1,37 (д, J=12,55, 1,70 Гц, 2H), 1,03-1,23 (м, 2H). MS (ESI+) m/z 420,2 (M+H)+.

Пример 157

1-бензил-4-(1H-индазол-5-ил)-N,N-диметил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием соединения Примера 149C вместо соединения Примера 81A и с использованием диметиламина вместо пиперидина и тетрагидрофурана вместо диметилформамида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,19 (с, 1H), 8,15 (с, 1H), 7,96 (т, J=1,19 Гц, 1H), 7,62 (д, J=1,36 Гц, 2H), 7,33-7,44 (м, 3H), 7,24-7,33 (м, 2H), 5,59 (с, 2H), 2,92 (с, 3H), 2,21 (с, 3H). MS (ESI+) m/z 347,1 (M+H)+.

Пример 158

N,1-дибензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием соединения Примера 149C вместо соединения Примера 81A и с использованием бензиламина вместо пиперидина и тетрагидрофурана вместо диметилформамида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,15 (с, 1H), 9,35 (т, J=6,10 Гц, 1H), 8,01 (д, J=12,55 Гц, 2H), 7,68 (д, J=8,82, 1,36 Гц, 1H), 7,53 (д, J=8,82 Гц, 1H), 7,17-7,41 (м, 10H), 5,66 (с, 2H), 4,41 (д, J=6,10 Гц, 2H). MS (ESI+) m/z 409,1 (M+H)+.

Пример 159

N-(2-гидрокси-2-фенилэтил)-5-(1H-индазол-5-ил)-N-метилизоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием DL-альфа-(метиламинометил)бензилового спирта вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,01 (с, 1H), 8,29 (с, 1H), 8,17 (с, 1H), 7,73-7,85 (м, 1H), 7,62-7,72 (м, 1H), 7,16-7,43 (м, 5H), 6,86 (с, 1H), 5,17 (д, J=4,39 Гц, 1H), 4,89 (с, 1H), 3,71 (д, J=5,49 Гц, 2H), 3,10 (с, 3H). MS (ESI+) m/z 363,1 (M+H)+.

Пример 160

N-[(1S)-2-гидрокси-1-фенилэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (S)-2-амино-2-фенилэтанола вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,37 (с, 1H), 9,05 (д, J=8,14 Гц, 1H), 8,40 (с, 1H), 8,23 (с, 1H), 7,89 (д, J=8,65, 1,53 Гц, 1H), 7,70 (д, J=8,82 Гц, 1H), 7,20-7,46 (м, 6H), 5,02-5,13 (м, 1H), 4,98 (т, J=5,59 Гц, 1H), 3,61-3,82 (м, 2H). MS (ESI+) m/z 349,0 (M+H)+.

Пример 161

N-бензил-N-(2-гидроксиэтил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 2-(бензиламино)этанола вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,37 (с, 1H), 9,05 (д, J=8,48 Гц, 1H), 8,40 (с, 1H), 8,23 (с, 1H), 7,89 (д, J=8,65, 1,53 Гц, 1H), 7,70 (д, J=8,82 Гц, 1H), 7,22-7,45 (м, 6H), 5,02-5,14 (м, 1H), 4,98 (т, J=5,76 Гц, 1H), 3,61-3,81 (м, 2H). MS (ESI+) m/z 349,0 (M+H)+.

Пример 162

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-3-метил-1H-индазол

Пример 162A

1-(5-Бром-3-метил-1H-индазол-1-ил)этанон

5-Бром-3-метил-1H-индазол (838 мг, 3,97 ммоль) растворяли в метиленхлориде (15 мл) и диизопропилэтиламине (0,7 мл). Добавляли уксусный ангидрид (500 мкл, 5,29 ммоль) и смесь перемешивали при температуре окружающей среды в течение ночи. Смесь разбавляли этилацетатом, промывали 1 н раствором гидроксида натрия, затем 1 н раствором хлористоводородной кислоты, затем насыщенным солевым раствором. Органический слой сушили над сульфатом натрия и растворитель удаляли при пониженном давлении с получением указанного в заголовке соединения. MS (ESI+) m/z 252,7 (M+H)+.

Пример 162B

1-(5-(1-Бензил-5-o-толил-1H-1,2,3-триазол-4-ил)-3-метил-1H-индазол-1-ил)этанон

Соединение Примера 153A (436 мг, 0,808 ммоль), Пример 162A (205 мг, 0,810 ммоль), дихлорбис(трифенилфосфин)палладий(II) (56 мг, 0,080 ммоль) и тиофен-2-карбоксилат меди (239 мг, 1,25 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали 150°C в течение 30 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 422,6 (M+H)+.

Пример 162C

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-3-метил-1H-индазол

Соединение Примера 162B (202 мг, 0,548 ммоль) растворяли в тетрагидрофуране (5,0 мл), метаноле (0,5 мл) и воде (0,5 мл) и добавляли гидроксид калия (133 мг, 2,37 ммоль). Смесь перемешивали в течение 1 часа и затем разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 30-80% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,63 (с, 1H), 7,70 (с, 1H), 7,44-7,52 (м, 1H), 7,38-7,43 (м, 1H), 7,29-7,38 (м, 4H), 7,22-7,29 (м, 3H), 6,89-6,96 (м, J=6,44, 3,05 Гц, 2H), 5,30-5,48 (м, 2H), 2,32 (с, 3H), 1,58 (с, 3H). MS (ESI+) m/z 380,1 (M+H)+.

Пример 163

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Пример 163 A

5-(1-Бензил-5-o-толил-1H-1,2,3-триазол-4-ил)-2-фторбензонитрил

Соединение Примера 153A (450 мг, 0,834 ммоль), 5-бром-2-фторбензонитрил (167 мг, 0,835 ммоль), дихлорбис(трифенилфосфин)палладий(II) (56 мг, 0,080 ммоль) и тиофен-2-карбоксилат меди (242 мг, 1,27 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали при 150°C в течение 30 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 369,2 (M+H)+.

Пример 163B

5-[1-бензил-5-(2-метилфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Соединение Примера 163A (202 мг, 0,548 ммоль) обрабатывали гидразингидратом (1,0 мл) в этаноле (1,0 мл) и перемешивали и нагревали до 60°C в течение ночи. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 35-85% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,38 (с, 1H), 8,11 (с, 1H), 7,41-7,49 (м, 1H), 7,33-7,40 (м, J=6,95, 6,95 Гц, 1H), 7,28-7,32 (м, 2H), 7,21-7,28 (м, 3H), 7,00-7,06 (м, 1H), 6,86-6,95 (м, 3H), 5,27-5,44 (м, 4H), 1,58 (с, 3H). MS (ESI+) m/z 381,1 (M+H)+.

Пример 164

2-{2-[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]этил}-1H-изоиндол-1,3(2H)-дион

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 2-(бут-3-инил)изоиндолин-1,3-диона вместо 3-фенил-1-пропина. Неочищенный продукт подвергали обработке 25% ТФУ/дихлорметан и очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,33 (с, 1H), 8,65 (с, 1H), 8,22 (с, 1H), 8,18 (д, J=1,53 Гц, 1H), 7,78-7,90 (м, 5H), 7,71-7,75 (м, 1H), 3,92 (т, J=7,21 Гц, 2H), 3,08 (т, J=7,21 Гц, 2H). MS (ESI+) m/z 359,0 (M+H)+.

Пример 165

5-{4-[(2,4-дихлорфенокси)метил]-1H-1,2,3-триазол-1-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 2,4-дихлор-1-(проп-2-инилокси)бензола вместо 3-фенил-1-пропина. Неочищенный продукт подвергали обработке 25% ТФУ/дихлорметан и очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,38 (с, 1H), 8,93 (с, 1H), 8,28 (д, J=1,53 Гц, 1H), 8,23 (с, 1H), 7,88 (д, J=8,90, 1,84 Гц, 1H), 7,76 (д, J=8,90 Гц, 1H), 7,59 (д, J=2,46 Гц, 1H), 7,39-7,49 (м, 2H), 5,37 (с, 2H). MS (ESI+) m/z 359,9 (M+H)+.

Пример 166

5-{4-[(2,6-дихлорфенокси)метил]-1H-1,2,3-триазол-1-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием 1,3-дихлор-2-(проп-2-инилокси)бензола вместо 3-фенил-1-пропина. Неочищенный продукт подвергали обработке 25% ТФУ/дихлорметан и очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 13,39 (с, 1H), 8,97 (с, 1H), 8,29 (д, J=1,53 Гц, 1H), 8,24 (с, 1H), 7,89 (д, J=9,00, 1,98 Гц, 1H), 7,76 (д, J=8,85 Гц, 1H), 7,51-7,55 (м, 2H), 7,19-7,26 (м, J=8,24, 8,24 Гц, 1H), 5,23 (с, 2H). MS (ESI+) m/z 359,9 (M+H)+.

Пример 167

5-[5-(4-фторфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Соединение Примера 156B (168 мг, 0,401 ммоль) растворяли в тетрагидрофуране (5,0 мл), метаноле (0,5 мл) и воде (0,5 мл) и добавляли гидроксид калия (138 мг, 2,46 ммоль). Смесь перемешивали в течение 1 часа и разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 0-7% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,08 (с, 1H), 8,02 (с, 1H), 7,77 (с, 1H), 7,50-7,58 (м, 2H), 7,37-7,49 (м, 4H), 4,11 (д, J=7,12 Гц, 2H), 3,76 (д, J=1 1,53, 2,71 Гц, 2H), 3,11-3,24 (м, 2H), 1,88-2,03 (м, 1H), 1,30-1,43 (м, J=12,72, 1,86 Гц, 2H), 1,04-1,22 (м, 2H). MS (ESI+) m/z 378,1 (M+H)+.

Пример 168

1-{[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]метил}-1H-индазол

Пример 168A

1-(Проп-2-инил)-1H-индазол

Индазол (530 мг, 4,49 ммоль) растворяли в диметилформамиде (4 мл). Медленно добавляли гидрид натрия (60% суспензия в минеральном масле, 231 мг, 5,78 ммоль) и смесь перемешивали в течение 10 минут. Добавляли пропаргилбромид (80% масс. в толуоле, 5,0 мл) и смесь перемешивали при температуре окружающей среды в течение ночи. Смесь разбавляли этилацетатом, промывали избыточным количеством воды, абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-30% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 157,1 (M+H)+.

Пример 168B

1-{[1-(1H-индазол-5-ил)-1H-1,2,3-триазол-4-ил]метил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 88, с использованием соединения Примера 168A вместо 3-фенил-1-пропина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 8,78 (с, 1H), 8,22 (д, J=2,03, 0,68 Гц, 1H), 8,20 (с, 1H), 8,10 (д, J=1,02 Гц, 1H), 7,80-7,87 (м, 2H), 7,75-7,80 (м, 1H), 7,68-7,74 (м, 1H), 7,39-7,46 (м, 1H), 7,13-7,19 (м, 1H), 5,81 (с, 2H). MS (ESI+) m/z 316,0 (M+H)+.

Пример 169

5-[1-бензил-5-(пиперидин-1-илкарбонил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием соединения Примера 149C вместо соединения Примера 81A и с использованием тетрагидрофурана вместо диметилформамида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,20 (с, 1H), 8,16 (с, 1H), 7,95-8,00 (м, J=1,02 Гц, 1H), 7,62-7,68 (м, 1H), 7,57-7,63 (м, 1H), 7,31-7,44 (м, 3H), 7,24-7,30 (м, 2H), 5,36-5,84 (м, J=69,17 Гц, 2H), 3,43-3,59 (м, 2H), 2,43-2,59 (м, 2H), 1,17-1,46 (м, J=39,67 Гц, 4H), 0,49-0,65 (м, 2H). MS (ESI+) m/z 387,1 (M+H)+.

Пример 170

5-[5-(2-метилфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Пример 170A

1-((Тетрагидро-2H-пиран-4-ил)метил)-5-o-толил-4-(трибутилстаннил)-1H-1,2,3-триазол

2-Этинилтолуол (576 мг, 4,57 ммоль) добавляли к 1,1,1-трибутил-N,N-диметилстаннанамин (1,53 г, 4,58 ммоль) и смесь перемешивали в герметично закрытом сосуде при 70°C в течение 2 часов. Смесь охлаждали до температуры окружающей среды и содержимое сосуда перемешивали без герметизации в течение 10 минут. Добавляли соединение Примера 80A (648 мг, 4,59 ммоль) и сосуд снова герметично закрывали и нагревали до 130°C в течение ночи. Смесь очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 5-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 548,4 (M+H)+.

Пример 170B

1-(5-(1-((Тетрагидро-2H-пиран-4-ил)метил)-5-o-толил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-ил)этанон

Соединение Примера 170A (432 мг, 0,791 ммоль), соединение Примера 87A (222 мг, 0,776 ммоль), дихлорбис(трифенилфосфин)палладий(II) (58 мг, 0,083 ммоль) и тиофен-2-карбоксилат меди (231 мг, 1,21 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали при 150°C в течение 20 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 20-70% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 416,2 (M+H)+.

Пример 170C

5-[5-(2-метилфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Соединение Примера 170B (184 мг, 0,443 ммоль) растворяли в тетрагидрофуране (3,0 мл), метаноле (0,3 мл) и воде (0,3 мл) и добавляли гидроксид калия (140 мг, 2,50 ммоль). Смесь перемешивали в течение 3 часов и разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 35-100% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,08 (с, 1H), 7,98 (с, 1H), 7,68-7,74 (м, J=1,02, 1,02 Гц, 1H), 7,49-7,56 (м, 1H), 7,45-7,49 (м, 3H), 7,41-7,45 (м, J=7,46 Гц, 2H), 4,10 (д, J=13,73, 6,95 Гц, 1H), 3,89 (д, J=13,90, 7,80 Гц, 1H), 3,77 (д, J=10,51, 2,71 Гц, 2H), 3,10-3,24 (м, 2H), 1,92 (с, 3H), 1,88-1,98 (м, 1H), 1,26-1,43 (м, 2H), 1,04-1,21 (м, 2H). MS (ESI+) m/z 374,1 (M+H)+.

Пример 171

5-[5-(2-метилфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Пример 171A

2-фтор-5-(1-((тетрагидро-2H-пиран-4-ил)метил)-5-o-толил-1H-1,2,3-триазол-4-ил)бензонитрил

Соединение Примера 170A (411 мг, 0,752 ммоль), 5-бром-2-фторбензонитрил (151 мг, 0,755 ммоль), дихлорбис(трифенилфосфин)палладий(II) (52 мг, 0,074 ммоль) и тиофен-2-карбоксилат меди (223 мг, 1,17 ммоль) объединяли в толуоле (2,0 мл) в 4-мл сосуде в инертной атмосфере азота. Сосуд герметично закрывали и нагревали 150°C в течение 30 минут. Смесь абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиента 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 377,6 (M+H)+.

Пример 171B

5-[5-(2-метилфенил)-1-(тетрагидро-2H-пиран-4-илметил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Соединение Примера 171A (175 мг, 0,465 ммоль) обрабатывали гидразингидратом (2,0 мл) в этаноле (2,0 мл) и смесь перемешивали и нагревали до 65°C в течение 2 часов. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 1-8% метанола в дихлорметане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,39 (с, 1H), 8,08 (с, 1H), 7,45-7,55 (м, 1H), 7,37-7,45 (м, 3H), 7,01-7,08 (м, J=8,48 Гц, 1H), 6,89-6,97 (м, 1H), 5,34 (с, 2H), 4,09 (д, J=13,73, 6,95 Гц, 1H), 3,89 (д, J=13,73, 7,63 Гц, 1H), 3,70-3,81 (м, 2H), 3,08-3,24 (м, 2H), 1,91 (с, 3H), 1,84-1,99 (м, 1H), 1,22-1,41 (м, 2H), 1,04-1,20 (м, 2H). MS (ESI+) m/z 389,1 (M+H)+.

Пример 172

5-[1-бензил-5-(морфолин-4-илкарбонил)-1H-1,2,3-триазол-4-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием соединения Примера 149C вместо соединения Примера 81A, морфолина вместо пиперидина и тетрагидрофурана вместо диметилформамида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,22 (с, 1H), 8,18 (с, 1H), 7,95-8,03 (м, 1H), 7,64-7,70 (м, 1H), 7,57-7,64 (м, 1H), 7,33-7,45 (м, 3H), 7,24-7,31 (м, 2H), 5,76 (с, 1H), 5,52 (с, 1H), 3,33-3,59 (м, 4H), 2,61-2,74 (м, 2H), 2,45-2,59 (м, 2H). MS (ESI+) m/z 389,1 (M+H)+.

Пример 173

5-[1-бензил-5-(4-метоксифенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

В атмосфере аргона сосуд, содержащий соединение Примера 125B (50 мг, 0,12 ммоль), 4-метоксифенилбороновую кислоту (20 мг, 0,13 ммоль), PdCl2(dppf).дихлорметан (10 мг, 0,01 ммоль) и карбонат калия (33 мг, 0,24 ммоль) в DME (2 мл) и воде (0,2 мл), закрывали крышкой и нагревали при 80°C в нагревательном устройстве с встряхиванием в течение 48 часов. Растворитель выпаривали при пониженном давлении и продукт очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,85 (с, 1H), 8,18 (с, 1H), 7,26-7,34 (м, 3H), 7,19-7,25 (м, 2H), 7,16-7,19 (м, 2H), 7,02 (т, J=8,13 Гц, 4H), 5,47 (с, 2H), 3,80 (с, 3H). MS (ESI+) m/z 397,1 (M+H)+.

Пример 174

N-[(1S)-1-бензил-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (S)-(-)-2-амино-3-фенил-1-пропанола вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 8,47 (д, J=8,82 Гц, 1H), 8,38 (с, 1H), 8,22 (с, 1H), 7,87 (д, J=8,82, 1,70 Гц, 1H), 7,69 (д, J=8,82 Гц, 1H), 7,23-7,31 (м, 3H), 7,22 (с, 1H), 7,12-7,21 (м, 1H), 4,90 (т, J=5,59 Гц, 1H), 4,07-4,28 (м, 1H), 3,40-3,58 (м, 2H), 2,89-3,00 (м, 1H), 2,75-2,86 (м, 1H). MS (ESI+) m/z 363,0 (M+H)+.

Пример 175

N-[(1S,2R)-2-гидрокси-2,3-дигидро-1H-инден-1-ил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (1S,2R)-(-)-цис-1-амино-2-инданола вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,38 (с, 1H), 8,42 (с, 1H), 8,24 (с, 1H), 8,16 (д, J=8,48 Гц, 1H), 7,91 (д, J=8,82, 1,70 Гц, 1H), 7,71 (д, J=8,48 Гц, 1H), 7,45 (с, 1H), 7,16-7,32 (м, 4H), 5,36-5,47 (м, 2H), 4,50-4,61 (м, 1H), 3,14 (д, J=15,43, 5,26 Гц, 1H), 2,90 (д, J=16,28, 1,70 Гц, 1H). MS (ESI+) m/z 361,0 (M+H)+.

Пример 176

5-{3-[(3-фенилморфолин-4-ил)карбонил]изоксазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием гидрохлорида 3-фенилморфолина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,38 (с, 1H), 8,32-8,46 (м, 1H), 8,24 (с, 1H), 7,81-7,96 (м, 1H), 7,70 (д, J=8,82 Гц, 1H), 7,37-7,55 (м, 4H), 7,26-7,37 (м, 2H), 5,34-5,71 (м, 1H), 4,51 (д, J=13,22 Гц, 1H), 3,78-4,39 (м, 3H), 3,59 (т, J=1 1,36 Гц, 1H), 3,33-3,41 (м, 1H). MS (ESI+) m/z 375,0 (M+H)+.

Пример 177

N-бензил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием бензиламина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 9,35 (т, J=6,27 Гц, 1H), 8,40 (с, 1H), 8,23 (с, 1H), 7,89 (д, J=8,82, 1,70 Гц, 1H), 7,69 (д, J=8,82 Гц, 1H), 7,33-7,40 (м, 4H), 7,32 (с, 1H), 7,22-7,30 (м, 1H), 4,48 (д, J=6,10 Гц, 2H). MS (ESI+) m/z 319,0 (M+H)+.

Пример 178

((1S)-2-{[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил}-6,7-диметокси-1,2,3,4-тетрагидроизохинолин-1-ил)метанол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (S)-(6,7-диметокси-1,2,3,4-тетрагидроизохинолин-1-ил)метанола вместо пиперидина. MS (ESI+) m/z 435,1 (M+H)+.

Пример 179

N-[(1R)-3-гидрокси-1-фенилпропил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (R)-3-амино-3-фенилпропанола вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,37 (с, 1H), 9,24 (д, J=8,48 Гц, 1H), 8,39 (с, 1H), 8,23 (с, 1H), 7,88 (д, J=8,82, 1,70 Гц, 1H), 7,69 (д, J=8,82 Гц, 1H), 7,38-7,46 (м, 2H), 7,34 (т, J=7,46 Гц, 2H), 7,19-7,30 (м, 2H), 5,09-5,27 (м, 1H), 4,62 (т, J=4,92 Гц, 1H), 3,37-3,52 (м, 2H), 2,00-2,16 (м, 1H), 1,84-2,00 (м, 1H). MS (ESI+) m/z 363,1 (M+H)+.

Пример 180

N-[(1S)-3-гидрокси-1-фенилпропил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (S)-3-амино-3-фенилпропанола вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 9,24 (д, J=8,14 Гц, 1H), 8,39 (с, 1H), 8,22 (с, 1H), 7,88 (д, J=8,65, 1,53 Гц, 1H), 7,69 (д, J=8,81 Гц, 1H), 7,37-7,45 (м, 2H), 7,29-7,37 (м, 2H), 7,19-7,29 (м, 2H), 5,08-5,30 (м, 1H), 4,55-4,68 (м, 1H), 3,37-3,51 (м, 2H), 2,00-2,14 (м, 1H), 1,83-1,99 (м, 1H). MS (ESI+) m/z 363,0 (M+H)+.

Пример 181

N-2,3-дигидро-1H-инден-1-ил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 1-аминоиндана вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,37 (с, 1H), 9,13 (д, J=8,14 Гц, 1H), 8,39 (с, 1H), 8,23 (с, 1H), 7,89 (д, J=8,82, 1,36 Гц, 1H), 7,70 (д, J=8,82 Гц, 1H), 7,35 (с, 1H), 7,15-7,32 (м, 4H), 5,55 (кв., J=7,91 Гц, 1H), 2,95-3,08 (м, 1H), 2,76-2,94 (м, 1H), 2,37-2,49 (м, 1H), 2,01-2,15 (м, 1H). MS (ESI+) m/z 345,0 (M+H)+.

Пример 182

N-2,3-дигидро-1H-инден-2-ил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 2-аминоиндана вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,37 (с, 1H), 9,08 (д, J=7,46 Гц, 1H), 8,39 (с, 1H), 8,23 (с, 1H), 7,89 (д, J=8,82, 1,70 Гц, 1H), 7,69 (д, J=8,82 Гц, 1H), 7,31 (с, 1H), 7,10-7,28 (м, 4H), 4,63-4,79 (м, 1H), 3,24 (д, J=15,77, 7,63 Гц, 2H), 2,96-3,08 (м, 2H). MS (ESI+) m/z 345,0 (M+H)+.

Пример 183

5-(1H-индазол-5-ил)-N-(1-фенилпропил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием альфа-этилбензиламина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 9,18 (д, J=8,82 Гц, 1H), 8,38 (с, 1H), 8,22 (с, 1H), 7,88 (д, J=8,82, 1,36 Гц, 1H), 7,69 (д, J=8,48 Гц, 1H), 7,39-7,48 (м, 2H), 7,34 (т, J=7,29 Гц, 2H), 7,19-7,29 (м, 2H), 4,84-5,00 (м, 1H), 1,69-2,04 (м, 2H), 0,91 (т, J=7,29 Гц, 3H). MS (ESI+) m/z 347,1 (M+H)+.

Пример 184

5-{1-бензил-5-[3-(диметиламино)фенил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 173, с использованием 3-(диметиламино)фенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,52 (с, 1H), 8,17 (с, 1H), 7,22-7,35 (м, 4H), 7,08-7,15 (м, 2H), 7,03 (д, J=6,71 Гц, 2H), 6,82 (д, J=8,39, 2,29 Гц, 1H), 6,48-6,54 (м, 2H), 5,47 (с, 2H), 2,78 (с, 6H). MS (ESI+) m/z 410,2 (M+H)+.

Пример 185

5-{1-бензил-5-[4-(диметиламино)фенил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 173, с использованием 4-(диметиламино)фенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,65 (с, 1H), 8,17 (с, 1H), 7,23-7,38 (м, 3H), 7,12-7,16 (м, 2H), 7,01-7,09 (м, 4H), 6,74-6,78 (м, 2H), 5,45 (с, 2H), 2,95 (с, 6H). MS (ESI+) m/z 410,2 (M+H)+.

Пример 186

N-{3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенил}ацетамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 3-ацетамидофенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 10,05 (с, 1H), 8,14 (с, 1H), 7,69 (д, J=8,54 Гц, 1H), 7,54 (с, 1H), 7,41 (т, J=7,93 Гц, 1H), 7,24-7,32 (м, 3H), 7,08-7,16 (м, 2H), 6,93-7,04 (м, 3H), 5,48 (с, 2H), 2,01 (с, 3H). MS (ESI+) m/z 424,2 (M+H)+.

Пример 187

N-{4-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенил}ацетамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 4-ацетамидофенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 10,14 (с, 1H), 8,07 (с, 1H), 7,66 (д, J=8,85 Гц, 2H), 7,24-7,32 (м, 3H), 7,18-7,22 (м, 2H), 7,04-7,11 (м, 2H), 6,98-7,02 (м, 2H), 5,48 (с, 2H), 5,35 (с, 2H), 2,04-2,10 (м, 3H). MS (ESI+) m/z 424,1 (M+H)+.

Пример 188

5-{1-бензил-5-[3-(1H-пиразол-1-ил)фенил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 3-(1H-пиразол-1-ил)фенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,40 (с, 1H), 8,45 (д, J=2,75 Гц, 1H), 8,09 (с, 1H), 7,99 (д, J=8,24, 1,53 Гц, 1H), 7,80-7,85 (м, 1H), 7,74 (д, J=1,83 Гц, 1H), 7,56 (т, J=7,93 Гц, 1H), 7,20-7,30 (м, 3H), 7,06-7,16 (м, 3H), 6,98-7,04 (м, 2H), 6,53-6,54 (м, 1H), 5,55 (с, 2H), 5,35 (с, 2H). MS (ESI+) m/z 433,2 (M+H)+.

Пример 189

5-[1-бензил-5-(1-метил-1H-пиразол-4-ил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 1-метил-1H-пиразол-4-илбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,78 (с, 1H), 8,11 (с, 1H), 7,87 (с, 1H), 7,43 (с, 1H), 7,27-7,41 (м, 4H), 7,24 (д, J=8,54 Гц, 1H), 7,05-7,11 (м, J=7,02 Гц, 2H), 5,54 (с, 2H), 3,86 (с, 3H). MS (ESI+) m/z 370,9 (M+H)+.

Пример 190

3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]-N-фенилбензамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 3-(фенилкарбамоил)фенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,41 (с, 1H), 10,22 (с, 1H), 8,07-8,12 (м, 2H), 7,95 (с, 1H), 7,73 (д, J=7,63 Гц, 2H), 7,60 (т, J=7,78 Гц, 1H), 7,43 (д, J=7,63 Гц, 1H), 7,32-7,39 (м, 2H), 7,21-7,30 (м, 3H), 7,05-7,15 (м, 3H), 7,00 (д, J=6,71 Гц, 2H), 5,54 (с, 2H), 5,36 (с, 2H). MS (ESI+) m/z 486,2 (M+H)+.

Пример 191

3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]-N-бензилбензамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 3-(бензилкарбамоил)фенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,41 (с, 1H), 9,04 (т, J=5,95 Гц, 1H), 8,07 (с, 1H), 8,01 (д, J=7,93 Гц, 1H), 7,85 (с, 1H), 7,56 (т, J=7,78 Гц, 1H), 7,41 (д, J=7,63 Гц, 1H), 7,21-7,35 (м, 8H), 7,01-7,11 (м, 2H), 6,96 (д, J=7,32, 2,14 Гц, 2H), 5,52 (с, 2H), 5,35 (с, 2H), 4,45 (д, J=5,80 Гц, 2H). MS (ESI+) m/z 500,2 (M+H)+.

Пример 192

5-[1-бензил-5-(1-метил-1H-индол-5-ил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 173, с использованием 1-метил-1H-индол-5-илбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,35 (с, 1H), 8,14 (с, 1H), 7,54 (д, J=8,54 Гц, 1H), 7,50 (д, J=1,53 Гц, 1H), 7,42 (д, J=3,05 Гц, 1H), 7,24-7,33 (м, 3H), 6,97-7,05 (м, 5H), 6,44 (д, J=2,75 Гц, 1H), 5,46 (с, 2H), 5,33 (с, 2H), 3,83 (с, 3H). MS (ESI+) m/z 420,1 (M+H)+.

Пример 193

5-[1-бензил-5-(3-метоксифенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 3-метоксифенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,40 (с, 1H), 8,08 (с, 1H), 7,34-7,40 (м, 1H), 7,24-7,32 (м, 3H), 7,03-7,11 (м, 3H), 6,98-7,02 (м, 2H), 6,80-6,85 (м, 2H), 5,49 (с, 2H), 5,35 (с, 2H), 3,66 (с, 3H). MS (ESI+) m/z 397,1 (M+H)+.

Пример 194

5-[1-бензил-5-(3-морфолин-4-илфенил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-амин

В атмосфере аргона сосуд, содержащий соединение Примера 125B (35 мг, 0,09 ммоль), 3-морфолинофенилбороновую кислоту (21 мг, 0,09 ммоль), PdCl2(dppf).дихлорметан (7 мг, 0,009 ммоль) и карбонат калия (24 мг, 0,18 ммоль) в DME (1 мл) и воде (0,1 мл), закрывали крышкой и нагревали при 80°C в нагревательном устройстве с встряхиванием в течение 3 дней. Растворитель выпаривали при пониженном давлении и продукт очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения в форме соли ТФУ. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,52 (с, 1H), 8,14 (с, 1H), 7,26-7,34 (м, 4H), 6,98-7,12 (м, 5H), 6,67-6,75 (м, 2H), 5,47 (с, 2H), 3,57-3,73 (м, 4H), 2,91-3,03 (м, 4H). MS (ESI+) m/z 452,2 (M+H)+.

Пример 195

5-[3-(1,3-дигидро-2H-изоиндол-2-илкарбонил)изоксазол-5-ил]-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием изоиндолина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,38 (с, 1H), 8,43 (с, 1H), 8,25 (с, 1H), 7,93 (д, J=8,82, 1,36 Гц, 1H), 7,71 (д, J=8,48 Гц, 1H), 7,30-7,47 (м, 5H), 5,18 (с, 2H), 4,92 (с, 2H). MS (ESI+) m/z 331,0 (M+H)+.

Пример 196

5-{3-[(4-метил-2-фенилпиперазин-1-ил)карбонил]изоксазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 1-метил-3-фенилпиперазина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,12 (с, 1H), 8,28-8,36 (м, 1H), 8,18 (с, 1H), 7,83 (д, J=8,79, 1,46 Гц, 1H), 7,67 (д, J=8,79 Гц, 1H), 7,48 (д, J=7,69 Гц, 2H), 7,30-7,40 (м, 2H), 7,21-7,29 (м, 1H), 7,14 (с, 1H), 5,56-5,73 (м, J=5,86 Гц, 1H), 3,99-4,19 (м, J=8,42 Гц, 1H), 3,38-3,47 (м, 1H), 3,05-3,21 (м, J=7,69 Гц, 1H), 2,80 (д, J=1 1,72 Гц, 1H), 2,41 (д, J=12,08, 4,39 Гц, 1H), 2,24 (с, 3H), 2,02-2,16 (м, 1H). MS (ESI+) m/z 388,1 (M+H)+.

Пример 197

1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]карбонил}пиперидин-4-амин

Пример 197A

трет-Бутил 1-(1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбонил)пиперидин-4-илкарбамат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием соединения Примера 149C вместо соединения Примера 81B и с использованием 4-Boc-аминопиперидина вместо пиперидина. MS (ESI+) m/z 502,3 (M+H)+.

Пример 197B

1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]карбонил}пиперидин-4-амин

Соединение Примера 197A (101 мг, 0,201 ммоль) растворяли в 4 M хлористоводородной кислоты в диоксане (4 мл) и метаноле (1 мл) и перемешивали при температуре окружающей среды в течение 2 часов. Растворители удаляли при пониженном давлении с получением указанного в заголовке соединения в форме соли HCl. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,18 (с, 1H), 7,92-8,08 (м, J=1,36 Гц, 3H), 7,53-7,70 (м, 2H), 7,24-7,47 (м, 5H), 5,40-5,73 (м, J=3,39 Гц, 2H), 4,34-4,63 (м, 1H), 3,44-3,53 (м, J=3,39 Гц, 1H), 2,95-3,17 (м, 2H), 2,76-2,94 (м, J=1 1,02, 11,02 Гц, 1H), 1,87-2,03 (м, J=1 1,87 Гц, 1H), 1,30-1,52 (м, J=10,85 Гц, 2H), 0,66-0,91 (м, J=10,17 Гц, 1H). MS (ESI+) m/z 402,2 (M+H)+.

Пример 198

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид

Пример 198A

трет-бутил 3-амино-5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-карбоксилат

Соединение Примера 102B (200 мг, 0,55 ммоль) и N,N-диметилпиридин-4-амин (5 мг, 0,04 ммоль) растворяли в метиленхлориде. Смесь перемешивали при комнатной температуре, добавляя при этом по каплям раствор ди-трет-бутилдикарбоната (120 мг, 0,55 ммоль) в 5 мл метиленхлорида. Реакционную смесь оставляли для перемешивания при комнатной температуре в течение 8 часов, концентрировали в условиях вакуума, растворяли в метиленхлориде (10 мл) и промывали разбавленным водным раствором HCl (1н, 10 мл) и насыщенным водным раствором NaHCO3 (10 мл). Органический слой концентрировали и очищали при помощи обращенно-фазовой-ВЭЖХ (CH3CN/H2O/NH4OAc) с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,29 (с, 2H), 7,43-7,59 (м, 3H), 7,23-7,38 (м, 6H), 6,98 (д, J=7,17, 2,39 Гц, 2H), 6,38 (с, 2H), 5,52 (с, 2H), 1,55 (с, 9H). MS (ESI+) m/z 467 (M+H)+.

Пример 198B

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид

Соединение Примера 198A (37,5 мг, 0,08 ммоль) и пиридин (12,7 мг, 0,16 ммоль) растворяли в метиленхлориде (2 мл). Смесь оставляли для перемешивания при комнатной температуре. К смеси добавляли бензоилхлорид (14 мг, 0,1 ммоль). Реакционную смесь оставляли для перемешивания при комнатной температуре в течение ночи, концентрировали в условиях вакуума и очищали при помощи обращенно-фазовой-ВЭЖХ (CH3CN/H2O/NH4OAc) с получением Boc-защищенного предшественника. Предшественник обрабатывали смесью 1:1 ТФУ/дихлорметан (2 мл) в течение 1 часа и концентрировали в условиях вакуума с получением указанного в заголовке соединения в форме соли ТФУ. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,84 (с, 1H), 10,70 (с, 1H), 8,01 (д, J=6,99 Гц, 2H), 7,87 (с, 1H), 7,50-7,69 (м, 3H), 7,36-7,48 (м, 5H), 7,18-7,35 (м, 5H), 6,92-7,03 (м, 2H), 5,48 (с, 2H). MS (ESI+) m/z 471 (M+H)+.

Пример 199

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензолсульфонамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 198B, с использованием бензолсульфонилхлорида вместо бензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,69 (с, 1H), 10,61 (с, 1H), 7,99 (с, 1H), 7,70-7,76 (м, 2H), 7,45-7,62 (м, 6H), 7,24-7,36 (м, 7H), 6,99 (д, J=6,99, 2,21 Гц, 2H), 5,50 (с, 2H). MS (ESI+) m/z 507 (M+H)+.

Пример 200

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-(4-метоксифенил)мочевина

Соединение Примера 198A (25 мг, 0,54 ммоль) растворяли в диоксане (2 мл) и к раствору добавляли 1-изоцианато-4-метоксибензол (24 мг, 0,16 ммоль). Реакционную смесь перемешивали при 80°C в течение 12 часов, концентрировали и очищали при помощи обращенно-фазовой-ВЭЖХ (CH3CN/H2O/NH4OAc) с получением Boc-защищенного предшественника. Предшественник обрабатывали смесью 1:1 ТФУ/дихлорметан (2 мл) в течение 1 часа и концентрировали в условиях вакуума с получением указанного в заголовке соединения в форме соли ТФУ. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,54 (с, 1H), 9,51 (с, 1H), 9,42 (с, 1H), 8,28 (с, 1H), 7,45-7,51 (м, 3H), 7,36-7,42 (м, 2H), 7,24-7,35 (м, 7H), 6,98 (д, J=7,17, 2,39 Гц, 2H), 6,87-6,94 (м, 2H), 5,50 (с, 2H), 3,74 (с, 3H). MS (ESI+) m/z 516 (M+H)+.

Пример 201

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бутанамид

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 198B, с использованием бутирилхлорида вместо бензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,77-10,84 (м, 1H), 8,07 (с, 1H), 7,97 (д, J=8,82 Гц, 1H), 7,64 (д, J=8,82, 1,47 Гц, 1H), 7,43-7,57 (м, 3H), 7,22-7,38 (м, 5H), 6,91-7,06 (м, 2H), 5,50 (с, 2H), 2,33 (т, J=7,17 Гц, 2H), 1,54-1,60 (м, 2H), 0,91 (т, J=7,35 Гц, 3H). MS (ESI+) m/z 437 (M+H)+.

Пример 202

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-метилпропанамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 198B, с использованием изобутирилхлорида вместо бензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,66 (с, 1H), 10,12 (с, 1H), 7,80 (с, 1H), 7,42-7,55 (м, 4H), 7,33-7,39 (м, 1H), 7,22-7,32 (м, 5H), 6,97 (д, J=6,99, 2,57 Гц, 2H), 5,48 (с, 1H), 2,59-2,69 (м, 1H), 1,07 (д, J=6,99 Гц, 6H). MS (ESI+) m/z 437 (M+H)+.

Пример 203

N-[5-(1-бензил-5-фенил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]циклопропанкарбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 198B, с использованием циклопропанкарбонилхлорида вместо бензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,45-10,64 (с, 1H), 7,91 (с, 1H), 7,43-7,55 (м, 3H), 7,31-7,43 (м, 2H), 7,23-7,30 (м, 5H), 6,97 (д, J=7,17, 2,39 Гц, 2H), 5,48 (с, 2H), 1,77-1,91 (м, 1H), 0,69-0,87 (м, 4H). MS (ESI+) m/z 435 (M+H)+.

Пример 204

N-[1-бензоил-5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил}бензамид

Соединение Примера 89B (33 мг, 0,1 ммоль) растворяли в тетрагидрофуране (0,6 мл) в микроволновой пробирке CEM. Добавляли бензоилхлорид (28 мг, 0,2 ммоль) и смесь нагревали при 120°C в течение 15 минут в микроволновом устройстве CEM-Discover. Реакционную смесь охлаждали до комнатной температуры и концентрировали. Остаток очищали при помощи обращенно-фазовой-ВЭЖХ (CH3CN/H2O/NH4OAc) с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,35 (с, 1H), 8,55 (д, J=8,82 Гц, 1H), 8,36 (с, 1H), 8,17 (д, J=8,64, 1,65 Гц, 1H), 8,06 (д, J=7,54, 2,39 Гц, 4H), 7,51-7,72 (м, 6H), 7,26-7,45 (м, 5H), 5,71 (с, 2H), 1,76-1,87 (м, 1H), 1,11 (д, J=6,62 Гц, 2H), 0,44 (д, J=4,41 Гц, 2H). MS (ESI+) m/z 539 (M+H)+.

Пример 205

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-фторбензамид

Пример 205A

трет-Бутил 3-амино-5-(1-бензил-S-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-карбоксилат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 198A, с использованием соединения Примера 89B вместо соединения Примера 102A. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,26 (с, 1H), 7,96-8,07 (м, 1H), 7,86-7,95 (м, 1H), 7,35-7,46 (м, 3H), 7,28-7,35 (м, 2H), 6,35-6,47 (м, 2H), 5,70 (с, 2H), 1,72-1,84 (м, 1H), 1,60 (с, 9H), 0,99-1,10 (д, J=1,84 Гц, 2H), 0,38 (д, J=3,68 Гц, 2H). MS (ESI+) m/z 431 (M+H)+.

Пример 205B

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-фторбензамид

Соединение Примера 205A (25 мг, 0,058 ммоль) и пиридин (9,2 мг, 0,116 ммоль) растворяли в метиленхлориде (1 мл). Смесь оставляли для перемешивания при комнатной температуре и к смеси добавляли 3-фторбензоилхлорид (11,1 мг, 0,58 ммоль). Реакционную смесь оставляли для перемешивания при комнатной температуре в течение ночи, концентрировали и очищали при помощи обращенно-фазовой-ВЭЖХ (CH3CN/H2O/NH4OAc) с получением Boc-защищенного предшественника. Предшественник обрабатывали смесью 1:1 ТФУ/дихлорметан (2 мл) в течение 1 часа и концентрировали в условиях вакуума с получением указанного в заголовке соединения в форме соли ТФУ. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,58 (с, 1H), 7,75 (с, 1H), 7,51-7,60 (м, 1H), 7,46 (д, J=8,82, 1,47 Гц, 1H), 7,15-7,28 (м, 2H), 7,10 (д, J=2,21 Гц, 1H), 6,88-7,05 (м, 6H), 5,31 (с, 2H), 1,35-1,47 (м, J=5,15 Гц, 1H), 0,68 (д, J=8,27, 1,65 Гц, 2H), 0,03 (д, J=5,52 Гц, 2H). MS (ESI+) m/z 453 (M+H)+.

Пример 206

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 205B, с использованием бензоилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,89 (с, 1H), 10,83 (с, 1H), 8,02-8,15 (м, 3H), 7,83 (д, J=8,82, 1,47 Гц, 1H), 7,50-7,66 (м, 4H), 7,24-7,43 (м, 5H), 5,67 (с, 2H), 1,77 (м, 1H), 0,99-1,10 (м, 2H), 0,39 (м, 2H). MS (ESI+) m/z 435 (M+H)+.

Пример 207

N-бензил-5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

К раствору соединения Примера 89B (18,3 мг, 0,05 ммоль) в диметилформамиде (2 мл) добавляли уксусную кислоту (15 мг, 0,25 ммоль) и бензальдегид (6,4 мг, 0,06 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение ночи. К смеси добавляли триацетоксиборогидрид натрия (NaBH(OAc)3, 32 мг, 0,15 ммоль). Реакционную смесь перемешивали при комнатной температуре в течение 3 часов, концентрировали и очищали при помощи обращенно-фазовой-ВЭЖХ (CH3CN/H2O/NH4OAc) с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,09 (с, 1H), 9,24 (с, 1H), 8,02-8,10 (м, 3H), 7,84-7,90 (м, 1H), 7,49-7,67 (м, 4H), 7,25-7,45 (м, 5H), 5,70 (с, 2H), 3,30 (с, 2H), 1,88-1,95 (м, 1H), 1,01-1,09 (м, 2H), 0,43 (д, J=4,04 Гц, 2H). MS (ESI+) m/z 421 (M+H)+.

Пример 208

N-[(1R)-1-бензил-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (R)-(+)-2-амино-3-фенил-1-пропанола (37 мг, 0,245 ммоль) вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,36 (с, 1H), 8,46 (д, J=8,82 Гц, 1H), 8,37 (с, 1H), 8,22 (с, 1H), 7,87 (дд, J=8,82, 1,36 Гц, 1H), 7,69 (д, J=8,82 Гц, 1H), 7,12-7,35 (м, 6H), 4,89 (т, J=5,59 Гц, 1H), 4,13-4,25 (м, 1H), 3,40-3,58 (м, 2H), 2,90-2,99 (м, 1H), 2,74-2,87 (м, 1H). MS (ESI+) m/z 363,0 (M+H)+.

Пример 209

5-(1-бензил-1H-пиразол-4-ил)-1H-индазол

Пример 209A

1-(5-Бром-1H-индазол-1-ил)этанон

4-Бром-2-метиланилин (25,0 г, 134 ммоль) растворяли в хлороформе (250 мл) и смесь охлаждали до 5°C. Добавляли по каплям уксусный ангидрид (35 мл, 343 ммоль) и смеси давали нагреться до температуры окружающей среды. Добавляли ацетат калия (3,97 г, 40,4 ммоль) и изоамилнитрит (35 мл, 262 ммоль) и смесь нагревали при 70°C в течение ночи. Смесь нейтрализовали насыщенным раствором бикарбоната натрия и экстрагировали метиленхлоридомом. Объединенные органические слои концентрировали при пониженном давлении и полученный остаток растирали в порошок с метанолом с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,45 (с, 1H), 8,26 (д, J=8,82 Гц, 1H), 8,17 (д, J=1,70 Гц, 1H), 7,77 (дд, J=8,82, 2,03 Гц, 1H), 2,72 (с, 3H).

Пример 209B

5-(1-бензил-1H-пиразол-4-ил)-1H-индазол

Соединение Примера 209A (425 мг, 1,78 ммоль), 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразол (508 мг, 1,79 ммоль), дихлорбис(трифенилфосфин)палладий(II) (133 мг, 0,189 ммоль) и карбонат калия (742 мг, 5,37 ммоль) объединяли в герметично закрытом сосуде с диоксаном (10 мл) и водой (1 мл) в инертной атмосфере азота и смесь нагревали до 110°C в течение ночи. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 45-90% этилацетата в гексане, с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,00 (с, 1H), 8,25 (с, 1H), 8,02 (с, 1H), 7,92 (с, 2H), 7,55-7,61 (м, 1H), 7,48-7,54 (м, 1H), 7,25-7,40 (м, 5H), 5,35 (с, 2H). MS (ESI+) m/z 274,9 (M+H)+.

Пример 210

N-[(1R)-3-гидрокси-1-фенилпропил]-5-(3-метил-1H-индазол-5-ил)изоксазол-3-карбоксамид

Пример 210A

трет-Бутил 5-бром-3-метил-1H-индазол-1-карбоксилат

5-Бром-3-метил-1H-индазол (5,11 г, 24,2 ммоль) и каталитическое количество диметиламинопиридина (~30 мг) растворяли в метиленхлориде (100 мл). Добавляли ди-трет-бутилдикарбонат (5,9 г, 27,0 ммоль) и смесь перемешивали при температуре окружающей среды в течение 3 часов. Растворитель удаляли при пониженном давлении и полученный остаток разбавляли этилацетатом и промывали 1 н раствором гидроксида натрия (два раза), 0,1н раствором хлористоводородной кислоты и насыщенным солевым раствором. Органический слой сушили над сульфатом натрия и фильтровали. Фильтрат концентрировали при пониженном давлении с получением указанного в заголовке соединения. MS (ESI+) m/z 210,8 (M-Boc)+.

Пример 210B

трет-Бутил 3-метил-5-((триметилсилил)этинил)-1H-индазол-1-карбоксилат

Соединение Примера 210A (7,55 г, 24,3 ммоль), дихлорбис(трифенилфосфин)палладий(II) (870 мг, 1,24 ммоль) и иодид меди(I) (250 мг, 1,31 ммоль) объединяли в триэтиламине (60 мл) в инертной атмосфере азота. Добавляли триметилсилилацетилен (4,0 мл, 28,9 ммоль) и смесь нагревали при 60°C в течение ночи. Смесь разбавляли метиленхлоридом и промывали при помощи 0,1 M хлористоводородной кислоты. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-40% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 228,9 (M-Boc)+.

Пример 210C

5-Этинил-3-метил-1H-индазол

Соединение Примера 210B (7,26 г, 22,1 ммоль) растворяли в метаноле (170 мл). Добавляли 1н раствор гидроксида калия (45 мл) и смесь перемешивали при температуре окружающей среды в течение ночи. Растворитель удаляли при пониженном давлении и полученный остаток разбавляли этилацетатом и промывали водой и насыщенным солевым раствором. Органический слой сушили над сульфатом натрия и концентрировали при пониженном давлении с получением указанного в заголовке соединения. MS (ESI+) m/z 157,1 (M+H)+.

Пример 210D

этил 5-(3-метил-1H-индазол-5-ил)изоксазол-3-карбоксилат

Соединение Примера 210C (411 мг, 2,63 ммоль) растворяли в толуоле (15 мл) и триэтиламине (478 мкл) и нагревали до 90°C. Добавляли этилхлороксимидоацетат (480 мг, 3,17 ммоль), растворенный в толуоле (15 мл), медленно по каплям в течение 30 минут. После добавления смесь разбавляли этилацетатом и промывали 1 н раствором хлористоводородной кислоты. Органический слой концентрировали при пониженном давлении и полученный остаток растирали в порошок с метанолом с получением указанного в заголовке соединения. MS (ESI+) m/z 271,9 (M+H)+.

Пример 210E

5-(3-метил-1H-индазол-5-ил)изоксазол-3-карбоновая кислота

Соединение Примера 210D (325 мг, 1,20 ммоль) растворяли в тетрагидрофуране (10 мл), метаноле (1 мл) и воде (1 мл) и добавляли гидроксид калия (150 мг, 2,67 ммоль). Смесь перемешивали при температуре окружающей среды в течение 3 часов. Смесь разбавляли этилацетатом и промывали 1 н раствором хлористоводородной кислоты. Продукт осаждался в делительной воронке, и его фильтровали с получением указанного в заголовке соединения. MS (ESI+) m/z 243,9 (M+H)+.

Пример 210F

N-[(1R)-3-гидрокси-1-фенилпропил]-5-(3-метил-1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием соединения Примера 210E вместо соединения Примера 81A и с использованием (R)-3-амино-3-фенилпропан-1-ола вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,93 (с, 1H), 8,45 (д, J=8,82 Гц, 1H), 8,33 (с, 1H), 7,84 (д, J=8,82, 1,70 Гц, 1H), 7,59 (д, J=9,16 Гц, 1H), 7,21-7,29 (м, 5H), 7,13-7,21 (м, 1H), 4,89 (т, J=5,59 Гц, 1H), 4,10-4,26 (м, 1H), 3,42-3,56 (м, 2H), 2,88-3,00 (м, 1H), 2,75-2,87 (м, 1H), 2,55 (с, 3H). MS (ESI+) m/z 377,1 (M+H)+.

Пример 211

3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]фенол

В атмосфере аргона сосуд, содержащий соединение Примера 125B (35 мг, 0,09 ммоль), 3-гидроксифенилбороновую кислоту (12 мг, 0,09 ммоль), PdCl2(dppf).дихлорметан (7 мг, 0,009 ммоль) и карбонат калия (24 мг, 0,18 ммоль) в DME (1 мл) и воде (0,1 мл), закрывали крышкой и нагревали при 80°C в нагревательном устройстве с встряхиванием в течение 3 дней. Растворитель выпаривали и продукт очищали при помощи обращенно-фазовой ВЭЖХ, используя метод градиентного элюирования ацетонитрил/вода 0,1% ТФУ, с получением указанного в заголовке соединения. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,40 (с, 1H), 9,68 (с, 1H), 8,09 (с, 1H), 7,24-7,35 (м, 5H), 6,98-7,13 (м, 3H), 6,88 (д, J=8,09, 1,98 Гц, 1H), 6,73 (с, 1H), 6,60-6,66 (м, 1H), 5,47 (с, 2H), 5,35 (с, 2H). MS (ESI+) m/z 383,1 (M+H)+.

Пример 212

3-[4-(3-амино-1H-индазол-5-ил)-1-бензил-1H-1,2,3-триазол-5-ил]бензамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 3-карбамоилфенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,41 (с, 1H), 8,07 (с, 1H), 7,97-8,03 (м, 2H), 7,83-7,87 (м, 1H), 7,53 (т, J=7,78 Гц, 1H), 7,45 (с, 1H), 7,38 (д, J=7,63 Гц, 1H), 7,23-7,30 (м, 3H), 7,00-7,10 (м, 2H), 6,96 (д, J=7,48, 1,98 Гц, 2H), 5,51 (с, 2H), 5,35 (с, 2H). MS (ESI+) m/z 410,1 (M+H)+.

Пример 213

5-{1-бензил-5-[4-(метилсульфонил)фенил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 173, с использованием 4-(метилсульфонил)фенилбороновой кислоты вместо 4-метоксифенилбороновой кислоты. 1H ЯМР (500 МГц, ДМСО-d6) δ м.д. 11,44 (с, 1H), 7,94-8,01 (м, 3H), 7,58 (д, J=8,54 Гц, 2H), 7,22-7,30 (м, 3H), 7,04-7,13 (м, 2H), 6,98 (д, J=7,48, 1,98 Гц, 2H), 5,56 (с, 2H), 5,37 (с, 2H), 3,28 (с, 3H). MS (ESI+) m/z 445,2 (M+H)+.

Пример 214

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-хлорбензамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 205B, с использованием 2-хлорбензоилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,94 (с, 1H), 8,24 (с, 1H), 7,85 (д, J=8,82, 1,47 Гц, 1H), 7,65 (д, J=6,99, 1,84 Гц, 1H), 7,43-7,61 (м, 4H), 7,26-7,42 (м, 5H), 5,68 (с, 2H), 1,71-1,83 (м, 1H), 1,04-1,12 (м, 2H), 0,37-0,45 (м, 2H). MS (ESI+) m/z 469 (M+H)+.

Пример 215

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-4-хлорбензамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 205B, с использованием 4-хлорбензоилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,53 (с, 1H), 7,65-7,71 (м, 3H), 7,42 (д, J=8,82, 1,47 Гц, 1H), 7,18-7,24 (м, 2H), 7,12-7,18 (м, 1H), 6,93-7,02 (м, 3H), 6,83-6,92 (м, 3H), 5,27 (с, 2H), 1,30-1,44 (м, 1H), 0,59-0,67 (м, 2H), -0,07-0,04 (м, 2H). MS (ESI+) m/z 469 (M+H)+.

Пример 216

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]этансульфонамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 205B, с использованием этансульфонилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,19 (с, 1H), 8,15 (с, 1H), 7,82 (д, J=8,64, 1,65 Гц, 1H), 7,53 (д, J=8,82 Гц, 1H), 7,35-7,45 (м, 3H), 7,27-7,35 (м, 2H), 5,69 (с, 2H), 3,30 (кв., J=7,35 Гц, 2H), 1,74, 1,87 (м, 1H), 1,27-1,36 (м, 3H), 1,02-1,12 (м, 2H), 0,34-0,44 (м, 2H). MS (ESI+) m/z 423 (M+H)+.

Пример 217

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензолсульфонамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 205B, с использованием бензолсульфонилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,75 (с, 1H), 10,69 (с, 1H), 8,02 (с, 1H), 7,71-7,83 (м, 3H), 7,43-7,60 (м, 4H), 7,34-7,43 (м, 3H), 7,27-7,34 (м, 2H), 5,69 (с, 2H), 1,69-1,83 (м, 1H), 0,99-1,11 (м, 2H), 0,31-0,45 (м, 2H). MS (ESI+) m/z 471 (M+H)+.

Пример 218

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-хлорбензолсульфонамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 205B, с использованием 2-хлорбензол-1-сульфонилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,36 (с, 1H), 10,60 (с, 1H), 7,67 (с, 1H), 7,62 (д, J=7,91, 1,65 Гц, 1H), 7,40 (д, J=8,82, 1,47 Гц, 1H), 7,14-7,27 (м, 2H), 7,00-7,12 (м, 4H), 6,96-7,00 (м, 1H), 6,90-6,95 (м, 2H), 5,31 (с, 2H), 1,29-1,44 (м, 1H), 0,61-0,74 (м, 2H), -0,05-0,05 (м, 2H). MS (ESI+) m/z 505 (M+H)+.

Пример 219

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-хлорбензолсульфонамид

Указанное в заголовке соединение получали в форме соли HCl в соответствии с процедурой, описанной в Примере 205B, с использованием 3-хлорбензол-1-сульфонилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,84 (с, 1H), 10,86 (с, 1H), 8,00 (с, 1H), 7,82 (с, 1H), 7,72 (д, J=7,72 Гц, 1H), 7,64 (д, J=1,84 Гц, 1H), 7,57 (д, J=7,72 Гц, 1H), 7,50 (д, J=8,82 Гц, 1H), 7,34-7,45 (м, 3H), 7,28-7,34 (м, 2H), 5,69 (с, 2H), 1,71-1,83 (м, 1H), 1,06 (м, 2H), 0,37 (м, 2H). MS (ESI+) m/z 505 (M+H)+.

Пример 220

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-4-хлорбензолсульфонамид

Указанное в заголовке соединение получали в форме соли HCl в соответствии с процедурой, описанной в Примере 205B, с использованием 4-хлорбензол-1-сульфонилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,80 (с, 1H), 10,79 (с, 1H), 8,00 (с, 1H), 7,73-7,83 (м, 3H), 7,56-7,64 (м, 2H), 7,49 (д, J=8,82 Гц, 1H), 7,34-7,45 (м, 3H), 7,28-7,34 (м, 2H), 5,69 (с, 2H), 1,71-1,86 (м, 1H), 0,99-1,12 (м, 2H), 0,31-0,43 (м, 2H). MS (ESI+) m/z 505 (M+H)+.

Пример 221

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2,5-диметилфуран-3-сульфонамид

Указанное в заголовке соединение получали в форме соли HCl в соответствии с процедурой, описанной в Примере 205B, с использованием 2,5-диметилфуран-3-сульфонилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,82 (с, 1H), 10,48 (с, 1H), 8,00 (с, 1H), 7,78 (д, J=8,64, 1,65 Гц, 1H), 7,50 (д, J=9,19 Гц, 1H), 7,34-7,45 (м, 3H), 7,28-7,33 (м, 2H), 6,20 (с, 1H), 5,69 (с, 2H), 2,11 (с, 6H), 1,71-1,84 (м, 1H), 1,01-1,11 (м, 2H), 0,32-0,41 (м, 2H). MS (ESI+) m/z 489 (M+H)+.

Пример 222

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-(2-хлорбензил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 207 с использованием 2-хлорбензальдегида вместо бензальдегида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,55 (с, 1H), 8,20 (с, 1H), 7,69 (д, J=8,46, 1,47 Гц, 1H), 7,49 (д, J=8,82 Гц, 1H), 7,34-7,46 (м, 4H), 7,23-7,33 (м, 5H), 5,69 (с, 2H), 4,56 (с, 2H), 1,72-1,83 (м, 1H), 0,99-1,09 (м, 2H), 0,35-0,42 (м, 2H). MS (ESI+) m/z 455 (M+H)+.

Пример 223

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-(3-хлорбензил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 207, с использованием 3-хлорбензальдегида вместо бензальдегида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,53 (с, 1H), 8,15 (с, 1H), 7,59-7,77 (м, 1H), 7,25-7,48 (м, 10H), 5,68 (с, 2H), 4,49 (с, 2H), 1,71-1,80 (м, 1H), 1,04 (с, 2H), 0,38 (с, 2H).

Пример 224

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-хлорбензамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 205B, с использованием 3-хлорбензоилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,99 (с, 1H), 8,12 (с, 2H), 8,03 (д, J=7,72 Гц, 1H), 7,83 (д, J=8,46 Гц, 1H), 7,68 (с, 1H), 7,58 (т, J=8,09 Гц, 2H), 7,33-7,44 (м, 3H), 7,25-7,33 (м, 2H), 5,68 (с, 2H), 1,72-1,86 (м, 1H), 0,99-1,12 (м, 2H), 0,34-0,45 (м, 2H). MS (ESI+) m/z 470 (M+H)+.

Пример 225

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-фурамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 205B, с использованием фуран-2-карбонилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,36 (с, 1H), 7,71 (с, 1H), 7,42 (д, J=8,82, 1,47 Гц, 1H), 7,15 (д, J=8,82 Гц, 1H), 7,06 (д, J=3,31 Гц, 1H), 6,93-7,03 (м, 3H), 6,86-6,93 (м, 2H), 6,31 (д, J=3,49, 1,65 Гц, 1H), 5,28 (с, 1H), 1,31-1,45 (м, 1H), 0,59-0,71 (м, 2H), -0,05-0,05 (м, 2H). MS (ESI+) m/z 425 (M+H)+.

Пример 226

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-этил-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 207 с использованием ацетальдегида вместо бензальдегида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,56 (с, 1H), 8,30-8,42 (м, 1H), 7,90-8,17 (м, 2H), 7,20-7,45 (м, 5H), 5,70 (с, 2H), 1,78-1,93 (м, 2H), 1,67 (с, 1H), 1,06 (м, 3H), 0,95 (м, 2H), 0,29-0,48 (м, 2H). MS (ESI+) m/z 359 (M+H)+.

Пример 227

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-(4-хлорбензил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 207, с использованием 4-хлорбензальдегида вместо бензальдегида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,01 (с, 1H), 9,25 (с, 1H), 8,25-8,33 (м, 1H), 8,09 (д, J=8,46 Гц, 1H), 7,84-7,97 (м, 2H), 7,57-7,73 (м, 2H), 7,26-7,51 (м, 6H), 5,70 (с, 2H), 1,71-1,84 (м, 1H), 0,97-1,15 (м, 2H), 0,36-0,47 (м, 2H). MS (ESI+) m/z 455 (M+H)+.

Пример 228

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-N-(3-фурилметил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 207, с использованием фуран-3-карбальдегида вместо бензальдегида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 8,21 (с, 1H), 7,90 (с, 1H), 7,71-7,82 (м, 1H), 7,55-7,68 (м, 2H), 7,24-7,51 (м, 6H), 5,68 (с, 2H), 4,33 (с, 2H), 1,67-1,85 (м, 1H), 0,95-1,13 (м, 2H), 0,30-0,42 (м, 2H). MS (ESI+) m/z 411 (M+H)+.

Пример 229

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-[5-метил-2-(трифторметил)-3-фурил]мочевина

Соединение Примера 205A (30 мг, 0,07 ммоль) растворяли в диоксане (2 мл) и к раствору добавляли 3-изоцианато-5-метил-2-(трифторметил)фуран (40 мг, 0,21 ммоль). Реакционную смесь перемешивали при 80°C в течение 12 часов, концентрировали и очищали при помощи обращенно-фазовой-ВЭЖХ (CH3CN/H2O/NH4OAc) с получением Boc-защищенного предшественника. Предшественник растворяли в метаноле и обрабатывали избыточным количеством HCl в диоксане (4 M, 0,5 ммоль). Реакционную смесь оставляли для перемешивания в течение 5 часов и концентрировали в условиях вакуума с получением указанного в заголовке соединения в форме соли HCl. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,73 (с, 1H), 10,19 (с, 1H), 8,40 (с, 1H), 7,83 (д, J=8,82, 1,47 Гц, 1H), 7,64-7,75 (м, 1H), 7,49 (д, J=8,82 Гц, 1H), 7,35-7,45 (м, 3H), 7,27-7,35 (м, 2H), 5,69 (с, 2H), 2,33 (с, 3H), 1,73-1,84 (м, 1H), 1,02-1,11 (м, 2H), 0,35-0,43 (м, 2H). MS (ESI+) m/z 522 (M+H)+.

Пример 230

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-3-фурамид

Указанное в заголовке соединение получали в форме соли HCl в соответствии с процедурой, описанной в Примере 205B, с использованием фуран-3-карбонилхлорида вместо 3-фторбензоилхлорида. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 10,64 (с, 1H), 8,46 (с, 1H), 8,13 (с, 1H), 7,74-7,84 (м, 2H), 7,52-7,58 (м, 1H), 7,33-7,46 (м, 3H), 7,24-7,33 (м, 3H), 7,06 (с, 1H), 5,68 (с, 2H), 1,70-1,86 (м, 1H), 0,99-1,09 (м, 2H), 0,33-0,44 (м, 2H). MS (ESI+) m/z 425 (M+H)+.

Пример 231

5-(1H-индазол-5-ил)-N-[(1S)-1-фенилпропил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (S)-(-)-1-фенилпропиламина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,37 (с, 1H), 9,20 (д, J=8,48 Гц, 1H), 8,39 (с, 1H), 8,23 (с, 1H), 7,88 (д, J=8,81, 1,70 Гц, 1H), 7,69 (д, J=8,81 Гц, 1H), 7,38-7,49 (м, 2H), 7,18-7,38 (м, 4H), 4,83-5,02 (м, 1H), 1,73-1,97 (м, 2H), 0,86-0,97 (м, 3H). MS (ESI+) m/z 347,0 (M+H)+.

Пример 232

5-(1H-индазол-5-ил)-N-[(1R)-1-фенилпропил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (R)-(-)-1-фенилпропиламина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,37 (с, 1H), 9,20 (д, J=8,48 Гц, 1H), 8,39 (с, 1H), 8,23 (с, 1H), 7,88 (д, J=8,65, 1,53 Гц, 1H), 7,69 (д, J=8,81 Гц, 1H), 7,39-7,48 (м, 2H), 7,18-7,38 (м, 4H), 4,85-4,99 (м, 1H), 1,74-1,97 (м, 2H), 0,91 (т, J=7,29 Гц, 3H). MS (ESI+) m/z 347,0 (M+H)+.

Пример 233

5-(1-бензил-1H-пиразол-4-ил)-1H-индазол-3-амин

Пример 233A

5-(1-Бензил-1H-пиразол-4-ил)-2-фторбензонитрил

5-Бром-2-фторбензонитрил (484 мг, 2,42 ммоль), 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразол (736 мг, 2,59 ммоль), дихлорбис(трифенилфосфин)палладий(II) (174 мг, 0,248 ммоль) и карбонат калия (1,36 г, 9,84 ммоль) объединяли в герметично закрытом сосуде с диоксаном (10 мл) и водой (1 мл) в инертной атмосфере азота и смесь нагревали до 110°C в течение ночи. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой абсорбировали на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гексане, с получением указанного в заголовке соединения. MS (ESI+) m/z 290,0 (M+H)+.

Пример 233B

5-(1-бензил-1H-пиразол-4-ил)-1H-индазол-3-амин

Соединение Примера 233A (591 мг, 2,13 ммоль) обрабатывали гидразингидратом (4,0 мл) в этаноле (3,0 мл) и перемешивали и нагревали до 70°C в течение ночи. Смесь разбавляли метиленхлоридом и промывали водой. Органический слой концентрировали при пониженном давлении и полученный остаток растирали в порошок с метанолом с получением указанного в заголовке соединения. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 11,32 (с, 1H), 8,10 (с, 1H), 7,85 (с, 1H), 7,80 (с, 1H), 7,44 (д, J=8,48, 1,70 Гц, 1H), 7,25-7,41 (м, 5H), 7,21 (д, J=8,82 Гц, 1H), 5,35 (с, 2H), 5,24-5,30 (м, 2H). MS (ESI+) m/z 290,0 (M+H)+.

Пример 234

1-бензил-4-(1H-индазол-5-ил)-N-[(2S)-тетрагидрофуран-2-илметил]-1H-1,2,3-триазол-5-карбоксамид

В 20-мл сосуд добавляли раствор соединения Примера 149C (51 мг, 0,16 ммоль), растворенного в диметилформамиде (0,5 мл), с последующим добавлением (S)-(+)-тетрагидрофурфуриламина (18,2 мг, 0,18 ммоль), растворенного в диметилформамиде (0,9 мл). Добавляли HATU (68 мг, 0,18 ммоль), растворенный в диметилформамиде (0,5 мл), с последующим добавлением раствора диизопропилэтиламина (0,087 мл, 0,5 ммоль), растворенного в диметилформамиде (0,5 мл). Смесь встряхивали при 50°C в течение ночи. Реакционную смесь фильтровали через Si-карбонатный картридж (6 мл - 1 г), поставляемый компанией Silicycle Chemical Division, и фильтрат переносили в 20-мл сосуды. Реакционную смесь контролировали методом ЖХ/МС и концентрировали досуха. Остаток растворяли в смеси 1:1 DMSO/метанол и очищали при помощи обращенно-фазовой ВЭЖХ (Agilent, градиент 5%-100% ТФУ/вода, в течение 8 минут). 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 1,35-1,54 (м, 1H), 1,64-1,96 (м, 3H), 3,17-3,26 (м, 1H), 3,32-3,38 (м, 1H), 3,50-3,77 (м, 2H), 3,81-4,00 (м, 1H), 5,58-5,74 (м, 2H), 7,21-7,41 (м, 5H), 7,54-7,66 (м, 1H), 7,68-7,84 (м, 1H), 8,01-8,19 (м, 2H). MS (ESI-) m/z 401 (M-H)-.

Пример 235

1-бензил-4-(1H-индазол-5-ил)-N-(2-изопропоксиэтил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием 2-аминоэтилизопропилового эфира вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 0,98 (д, 6H), 3,31-3,45 (м, 4H), 3,45-3,57 (м, 1H), 5,61-5,74 (м, 2H), 7,25-7,46 (м, 5H), 7,57-7,65 (м, 1H), 7,68-7,80 (м, 1H), 8,04-8,13 (м, 2H). MS (ESI+) m/z 405 (M+H)+.

Пример 236

1-бензил-4-(1H-индазол-5-ил)-N-[(2R)-тетрагидрофуран-2-илметил]-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием (R)-(-)-тетрагидрофурфуриламина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 1,34-1,60 (м, 1H), 1,65-1,94 (м, 3H), 3,16-3,26 (м, 1H), 3,33-3,39 (м, 1H), 3,51-3,77 (м, 2H), 3,78-4,00 (м, 1H), 5,60-5,73 (м, 2H), 7,26-7,45 (м, 5H), 7,56-7,68 (м, 1H), 7,71-7,79 (м, 1H), 8,01-8,15 (м, 2H). MS (ESI-) m/z 401 (M-H)-.

Пример 237

1-бензил-4-(1H-индазол-5-ил)-N-(тетрагидрофуран-3-илметил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием 3-аминометилтетрагидрофурана вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 1,36-1,59 (м, 1H), 1,67-2,00 (м, 1H), 2,19-2,45 (м, 1H), 3,11-3,23 (м, 2H), 3,45-3,77 (м, 2H), 5,45-6,14 (м, 2H), 7,16-7,44 (м, 5H), 7,50-7,84 (м, 2H), 7,96-8,25 (м, 2H). MS (ESI+) m/z 403 (M+H)+.

Пример 238

1-бензил-N-циклопентил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием циклопентиламина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 1,19-1,63 (м, 6H), 1,71-1,99 (м, 2H), 3,99-4,37 (м, 1H), 5,52-5,77 (м, 2H), 7,22-7,45 (м, 5H), 7,55-7,83 (м, 2H), 7,95-8,20 (м, 2H). MS (ESI-) m/z 385 (M-H)-.

Пример 239

1-бензил-N-(циклопентилметил)-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием аминометилциклопентана вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 1,02-1,28 (м, 2H), 1,34-1,73 (м, 6H), 1,83-2,17 (м, 1H), 3,03-3,17 (м, 2H), 5,51-5,80 (м, 2H), 7,20-7,42 (м, 5H), 7,52-7,81 (м, 2H), 7,93-8,19 (м, 2H). MS (ESI+) m/z 401 (M+H)+.

Пример 240

1-бензил-N-этил-4-(1H-индазол-5-ил)-N-метил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием гидрохлорида N-метилэтиламина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 0,33-0,56 (м, 1H), 0,90-1,14 (м, 2H), 2,15-2,25 (м, 2H), 2,58-2,69 (м, 1H), 2,82-3,01 (м, 1H), 3,35-3,52 (м, 1H), 5,40-5,67 (м, 2H), 7,14-7,48 (м, 5H), 7,56-7,79 (м, 2H), 7,90-8,24 (м, 2H). MS (ESI+) m/z 361 (M+H)+.

Пример 241

1-бензил-4-(1H-индазол-5-ил)-N-изопропил-N-метил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием метилизопропиламина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 0,22-0,51 (м, 2H), 0,84-1,09 (м, 4H), 1,96-2,13 (м, 2H), 2,74-2,87 (м, 1H), 4,44-4,92 (м, 1H), 5,43-5,67 (м, 2H), 7,20-7,44 (м, 5H), 7,51-7,73 (м, 2H), 7,84-8,14 (м, 2H). MS (ESI+) m/z 375 (M+H)+.

Пример 242

1-бензил-4-(1H-индазол-5-ил)-N-(2-метоксиэтил)-N-метил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием N-(2-метоксиэтил)метиламина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 2,25-2,42 (м, 2H), 2,74-3,06 (м, 4H), 3,40-3,75 (м, 3H), 5,38-5,73 (м, 2H), 7,18-7,45 (м, 5H), 7,53-7,74 (м, 2H), 7,85-8,19 (м, 2H). MS (ESI+) m/z 391 (M+H)+.

Пример 243

1-бензил-4-(1H-индазол-5-ил)-N-фенил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием анилина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 5,65-5,79 (м, 2H), 7,04-7,55 (м, 10H), 7,54-7,84 (м, 2H), 7,95-8,21 (м, 2H). MS (ESI+) m/z 395 (M+H)+.

Пример 244

1-бензил-N-(4-хлорфенил)-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием 4-хлоранилина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 5,70-5,74 (м, 2H), 7,25-7,42 (м, 7H), 7,43-7,52 (м, 2H), 7,54-7,66 (м, 1H), 7,68-7,77 (м, 1H), 8,03-8,15 (м, 2H). MS (ESI-) m/z 427 (M-H)-.

Пример 245

1-бензил-4-(1H-индазол-5-ил)-N-(2-морфолин-4-илэтил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием N-(3-аминопропил)морфолина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 2,94-3,13 (м, 6H), 3,46-3,61 (м, 2H), 3,63-3,79 (м, 4H), 5,61-5,88 (м, 2H), 7,19-7,46 (м, 5H), 7,56-7,88 (м, 2H), 7,88-8,30 (м, 2H). MS (ESI-) m/z 430 (M-H)-.

Пример 246

1-бензил-N-[2-(диметиламино)этил]-4-(1H-индазол-5-ил)-N-метил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 234, с использованием N,N,N-триметилэтилендиамина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 2,28-2,42 (м, 3H), 2,73-3,00 (м, 6H), 3,07-3,19 (м, 2H), 3,56-3,80 (м, 2H), 5,55-5,68 (м, 2H), 7,24-7,47 (м, 5H), 7,56-7,78 (м, 2H), 7,91-8,02 (м, 1H), 8,10-8,17 (м, 1H). MS (ESI+) m/z 404 (M+H)+.

Пример 247

1-бензил-N-(2-гидроксиэтил)-4-(1H-индазол-5-ил)-N-пропил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием 2-(пропиламино)этанола вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 0,22-0,39 (м, 1H), 0,80-1,06 (м, 3H), 1,50-1,75 (м, 1H), 2,65-2,78 (м, 1H), 2,80-2,94 (м, 1H), 2,97-3,09 (м, 1H), 3,37-3,50 (м, 1H), 3,51-3,63 (м, 1H), 3,61-3,73 (м, 1H), 5,39-5,74 (м, 2H), 7,20-7,44 (м, 5H), 7,50-7,85 (м, 2H), 7,86-8,25 (м, 2H). MS (ESI+) m/z 405 (M+H)+.

Пример 248

1-бензил-N-[3-(диметиламино)пропил]-4-(1H-индазол-5-ил)-N-метил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 234, с использованием N,N,N-триметил-1,3-пропандиамина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,06-8,23 (м, 1H), 7,85-8,05 (м, 1H), 7,57-7,73 (м, 2H), 7,19-7,48 (м, 5H), 5,41-5,74 (м, 2H), 3,36-3,45 (м, 2H), 2,88-3,10 (м, 3H), 2,60-2,86 (м, 5H), 2,24-2,42 (м, 4H), 1,73-1,91 (м, 1H). MS (ESI+) m/z 418 (M+H)+.

Пример 249

1-бензил-N-[2-(диэтиламино)этил]-4-(1H-индазол-5-ил)-N-метил-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 234, с использованием N,N-диэтил-N-метилэтилендиамина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 7,82-8,24 (м, 2H), 7,56-7,76 (м, 2H), 7,15-7,49 (м, 5H), 5,54-5,71 (м, 2H), 3,60-3,77 (м, 2H), 3,20-3,24 (м, 2H), 3,13-3,18 (м, 2H), 3,03-3,11 (м, 2H), 2,32-2,44 (м, 3H), 0,63-1,41 (м, 6H). MS (ESI+) m/z 432 (M+H)+.

Пример 250

N,1-дибензил-N-этил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием N-этилбензиламина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 7,81-8,20 (м, 2H), 7,49-7,71 (м, 2H), 7,24-7,51 (м, 9H), 6,39-7,18 (м, 2H), 5,41-5,74 (м, 2H), 4,53-4,84 (м, 1H), 3,82-4,00 (м, 1H), 3,37-3,54 (м, 1H), 2,61-2,78 (м, 1H), 0,91-1,08 (м, 1H), 0,27-0,45 (м, 2H). MS (ESI+) m/z 437 (M+H)+.

Пример 251

N,1-дибензил-N-(2-гидроксиэтил)-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием N-бензилэтаноламина вместо (S)-(+)-тетрагидрофурфуриламина. MS (ESI+) m/z 453 (M+H)+.

Пример 252

(3R)-1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]карбонил}пиперидин-3-ол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием гидрохлорида (R)-(+)-3-гидроксипиперидина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 7,83-8,22 (м, 2H), 7,51-7,78 (м, 2H), 7,23-7,45 (м, 5H), 5,46-5,75 (м, 2H), 3,80-4,31 (м, 1H), 3,40-3,68 (м, 1H), 2,58-3,15 (м, 2H), 2,19-2,49 (м, 1H), 0,31-2,14 (м, 4H). MS (ESI+) m/z 403 (M+H)+.

Пример 253

1-{[1-бензил-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-ил]карбонил}пиперидин-4-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием изонипекотамида вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 7,86-8,24 (м, 2H), 7,53-7,70 (м, 2H), 7,22-7,46 (м, 5H), 5,42-5,77 (м, 2H), 4,19-4,48 (м, 1H), 2,65-3,10 (м, 2H), 2,27-2,47 (м, 1H), 2,05-2,24 (м, 1H), 1,65-1,89 (м, 1H), 1,29-1,55 (м, 1H), 0,98-1,27 (м, 1H), 0,52-0,87 (м, 1H). MS (ESI+) m/z 430 (M+H)+.

Пример 254

5-{1-бензил-5-[(2,6-диметилморфолин-4-ил)карбонил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием 2,6-диметилморфолина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 7,87-8,27 (м, 2H), 7,50-7,76 (м, 2H), 7,12-7,45 (м, 5H), 5,46-5,68 (м, 2H), 4,16-4,43 (м, 1H), 2,61-2,98 (м, 1H), 2,16-2,41 (м, 2H), 1,77-2,13 (м, 1H), 0,86-1,39 (м, 3H), 0,38-0,83 (м, 3H). MS (ESI+) m/z 417 (M+H)+.

Пример 255

5-{5-[(4-ацетилпиперазин-1-ил)карбонил]-1-бензил-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием 1-ацетилпиперазина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 7,89-8,41 (м, 2H), 7,55-7,86 (м, 2H), 7,07-7,51 (м, 5H), 5,44-5,82 (м, 2H), 3,46-3,70 (м, 3H), 3,35-3,49 (м, 2H), 2,57-2,93 (м, 3H), 1,61-2,03 (м, 3H). MS (ESI+) m/z 430 (M+H)+.

Пример 256

5-{1-бензил-5-[(4-фенилпиперазин-1-ил)карбонил]-1H-1,2,3-триазол-4-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием 1-фенилпиперазина вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (SOO МГЦ, ДМСО-d6/D2O) δ м.д. 7,79-8,38 (м, 2H), 7,53-7,73 (м, 2H), 7,22-7,46 (м, 5H), 7,05-7,19 (м, 2H), 6,64-6,79 (м, 3H), 5,54-5,68 (м, 2H), 3,50-3,90 (м, 2H), 2,93-3,15 (м, 2H), 2,62-2,89 (м, 2H), 2,19-2,43 (м, 2H). MS (ESI-) m/z 462 (M-H)-.

Пример 257

1-бензил-N-[(1R)-1-(гидроксиметил)-2-метилпропил]-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием (R)-(+)-2-амино-3-метил-1-бутанола вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 7,95-8,31 (м, 2H), 7,52-7,96 (м, 2H), 7,18-7,46 (м, 5H), 5,42-5,86 (м, 2H), 3,68-3,94 (м, 1H), 3,38-3,59 (м, 2H), 1,49-2,08 (м, 1H), 0,50-1,20 (м, 6H). MS (ESI+) m/z 405 (M+H)+.

Пример 258

1-бензил-N-[(1S)-1-(гидроксиметил)-2-метилпропил]-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием (S)-(-)-2-амино-3-метил-1-бутанола вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 7,94-8,36 (м, 2H), 7,52-7,84 (м, 2H), 7,18-7,51 (м, 5H), 5,57-5,76 (м, 2H), 3,75-3,94 (м, 1H), 3,35-3,54 (м, 2H), 1,70-1,94 (м, 1H), 0,54-1,09 (м, 6H). MS (ESI+) m/z 405 (M+H)+.

Пример 259

1-бензил-N-[3-(1H-индазол-1-ил)пропил]-4-(1H-индазол-5-ил)-1H-1,2,3-триазол-5-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 234, с использованием 1-(3-аминопропил)индазола вместо (S)-(+)-тетрагидрофурфуриламина. 1H ЯМР (300 МГц, ДМСО-d6/D2O) δ м.д. 8,57-8,85 (м, 1H), 7,92-8,16 (м, 2H), 7,60-7,80 (м, 2H), 7,47-7,55 (м, 2H), 7,19-7,40 (м, 5H), 5,54-5,75 (м, 2H), 3,83-4,21 (м, 2H), 3,19-3,26 (м, 2H), 1,79-2,06 (м, 2H). MS (ESI+) m/z 427 (M+H)+.

Пример 260

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-этилмочевина

Указанное в заголовке соединение получали в форме соли хлористоводородной кислоты в соответствии с процедурой, описанной в Примере 229, с использованием изоцианатоэтана вместо 3-изоцианато-5-метил-2-(трифторметил)фурана. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,38 (с, 1H), 9,47 (с, 1H), 8,38 (с, 1H), 7,85-7,97 (м, 1H), 7,78 (д, J=8,82, 1,47 Гц, 1H), 7,34-7,50 (м, 4H), 7,24-7,33 (м, 2H), 5,69 (с, 2H), 3,17-3,29 (м, 2H), 1,70-1,83 (м, 1H), 1,12 (т, J=7,17 Гц, 3H), 1,00-1,08 (м, 2H), 0,37 (д, J=3,68 Гц, 2H). MS (ESI+) m/z 402 (M+H)+.

Пример 261

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-фенилмочевина

Указанное в заголовке соединение получали в форме соли хлористоводородной кислоты в соответствии с процедурой, описанной в Примере 229, с использованием изоцианатобензола вместо 3-изоцианато-5-метил-2-(трифторметил)фурана. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,47-12,78 (м, 1H), 9,64 (с, 1H), 8,39 (с, 1H), 7,70-7,95 (м, 1H), 7,45-7,60 (м, 3H), 7,27-7,45 (м, 7H), 7,02 (м, 1H), 5,69 (с, 2H), 1,79 (м, 1H), 1,07 (м, 2H), 0,40 (м, 2H). MS (ESI+) m/z 450 (M+H)+.

Пример 262

N-бензил-N'-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]мочевина

Указанное в заголовке соединение получали в форме соли хлористоводородной кислоты в соответствии с процедурой, описанной в Примере 229, с использованием (изоцианатометил)бензола вместо 3-изоцианато-5-метил-2-(трифторметил)фурана. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,42 (с, 1H), 9,61 (с, 1H), 8,37 (с, 1H), 8,23-8,33 (м, 1H), 7,79 (д, J=8,82, 1,47 Гц, 1H), 7,36-7,50 (м, 4H), 7,28-7,36 (м, 6H), 7,21-7,27 (м, 1H), 5,69 (с, 2H), 4,45 (д, J=5,88 Гц, 2H), 1,65-1,79 (т, J=8,27, 8,27 Гц, 1H), 0,99-1,08 (м, 2H), 0,30-0,43 (м, 2H). MS (ESI+) m/z 464 (M+H)+.

Пример 263

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-(2-хлорфенил)мочевина

Указанное в заголовке соединение получали в форме соли хлористоводородной кислоты в соответствии с процедурой, описанной в Примере 229, с использованием 1-хлор-2-изоцианатобензола вместо 3-изоцианато-5-метил-2-(трифторметил)фурана. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,74 (с, 1H), 10,23 (с, 1H), 8,44 (с, 1H), 8,34 (д, J=8,09 Гц, 1H), 7,83 (д, J=8,82, 1,47 Гц, 1H), 7,46-7,55 (м, 2H), 7,35-7,45 (м, 3H), 7,28-7,35 (м, 3H), 7,03-7,12 (м, 1H), 5,70 (с, 2H), 1,70-1,86 (м, 1H), 1,00-1,12 (м, 2H), 0,33-0,45 (м, 2H). MS (ESI+) m/z 484 (M+H)+.

Пример 264

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-(3-хлорфенил)мочевина

Указанное в заголовке соединение получали в форме соли хлористоводородной кислоты в соответствии с процедурой, описанной в Примере 229, с использованием 1-хлор-3-изоцианатобензола вместо 3-изоцианато-5-метил-2-(трифторметил)фурана. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,66 (с, 1H), 10,02 (с, 1H), 9,71 (с, 1H), 8,22-8,48 (м, 1H), 7,71-7,91 (м, 2H), 7,51 (д, J=8,46 Гц, 1H), 7,37-7,46 (м, 2H), 7,26-7,37 (м, 5H), 7,02-7,11 (м, 1H), 5,69 (с, 2H), 1,73-1,89 (м, 1H), 0,99-1,11 (м, 2H), 0,33-0,48 (м, 2H). MS (ESI+) m/z 484 (M+H)+.

Пример 265

N-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-(4-хлорфенил)мочевина

Указанное в заголовке соединение получали в форме соли хлористоводородной кислоты в соответствии с процедурой, описанной в Примере 229, с использованием 1-хлор-4-изоцианатобензола вместо 3-изоцианато-5-метил-2-(трифторметил)фурана. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,65 (с, 1H), 9,96 (с, 1H), 9,68 (с, 1H), 8,37 (с, 1H), 7,81 (д, J=8,82, 1,47 Гц, 1H), 7,53-7,60 (м, 2H), 7,50 (д, J=8,82 Гц, 1H), 7,39-7,44 (м, 1H), 7,33-7,40 (м, 4H), 7,27-7,32 (м, 2H), 5,69 (с, 2H), 1,71-1,87 (м, 1H), 1,00-1,12 (м, 2H), 0,34-0,44 (м, 2H). MS (ESI+) m/z 484 (M+H)+.

Пример 266

N-[5-(1-бензил-5-иод-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид

Пример 266A

трет-бутил 3-амино-5-(1-бензил-5-иод-1H-1,2,3-триазол-4-ил)-1H-индазол-1-карбоксилат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 198A, с использованием соединения Примера 125B вместо соединения Примера 102B. Продукт использовали непосредственно в последующих реакциях без определения его характеристик.

Пример 266B

N-[5-(1-бензил-5-иод-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]бензамид

Указанное в заголовке соединение получали в форме соли ТФУ в соответствии с процедурой, описанной в Примере 205B, с использованием соединения Примера 266A вместо соединения Примера 205A. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 12,97 (с, 1H), 10,89 (с, 1H), 8,28 (с, 1H), 8,05-8,14 (м, 2H), 7,88 (д, J=8,82, 1,47 Гц, 1H), 7,58-7,67 (м, 2H), 7,54 (т, J=7,35 Гц, 2H), 7,29-7,45 (м, 3H), 7,23 (д, J=6,99 Гц, 2H), 5,73 (с, 2H). MS (ESI+) m/z 521 (M+H)+.

Пример 267

3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]пропаннитрил

Пример 267A

3-(4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразол-1-ил)пропаннитрил

К раствору 4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола (5,00 г, 25,8 ммоль) в ацетонитриле (50 мл) добавляли акрилонитрил (3,4 мл, 52 ммоль) с последующим добавлением 1,8-диазабицикло[5.4.0]ундец-7-ена (1,94 мл, 12,9 ммоль). Примерно через 2 часа реакционную смесь концентрировали при пониженном давлении. Неочищенное вещество затем растворяли в минимальном количестве дихлорметана и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 10-50% этилацетата в гептане, с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,03 (с, 1H), 7,64 (с, 1H), 4,40 (т, J=6,4 Гц, 2H), 3,06 (т, J=6,4 Гц, 2H), 1,26 (с, 12H). MS (ESI+) m/z 247,3 (M+H)+.

Пример 267B

3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]пропаннитрил

В микроволновой сосуд добавляли 5-бром-1H-индазол-3-амин (0,14 г, 0,66 ммоль), тетракис(трифенилфосфин)палладий(0) (0,076 г, 0,066 ммоль) и карбонат натрия (0,147 г, 1,39 ммоль) с последующим добавлением раствора соединения Примера 267A (0,212 г, 0,858 ммоль) в 1,2-диметоксиэтане (2,50 мл) и затем воды (1,25 мл). Смесь нагревали в микроволновом устройстве CEM при около 150°C в течение около 20 минут (максимальное давление 275 ф/кв.дюйм (19 кг/см2), время повышения температуры до заданного уровня около 2 минут, максимальная мощность 200 ватт) и затем смесь концентрировали при пониженном давлении. Добавляли метанол (20 мл) и полученную смесь перемешивали около 1 часа. Нерастворимое вещество удаляли фильтрованием. Фильтрат концентрировали при пониженном давлении на силикагеле и очищали при помощи хроматографии на силикагеле, используя для элюирования ступенчатый градиент дихлорметан/метанол/гидроксид аммония (990:9:1→985:13,5:1,5→980:18:2), с получением твердого вещества. Это твердое вещество растворяли в минимальном количестве горячего ацетонитрила (~2 мл), фильтровали для удаления минорных количеств нерастворимых веществ, промывая при этом метанолом (<0,5 мл), и оставляли для осаждения при температуре окружающей среды. Полученное твердое вещество, которое образовалось в течение ночи, собирали фильтрованием, промывая при этом дополнительным количеством ацетонитрила, и сушили в вакуумной печи при около 60°C в течение около 2 часов с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,35 (с, 1H), 8,10 (с, 1H), 7,86 (с, 1H), 7,84 (с, 1H), 7,44 (дд, J=8,54, 1,26 Гц, 1H), 7,23 (д, J=8,62 Гц, 1H), 5,32 (с, 2H), 4,42 (т, J=6,36 Гц, 2H), 3,10 (т, J=6,43 Гц, 2H). MS (ESI+) m/z 253,2 (M+H)+.

Пример 268

2-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]ацетамид

Пример 268A

2-(4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразол-1-ил)ацетамид

Суспензию 4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола (2,00 г, 10,3 ммоль), 2-бромацетамида (2,14 г, 15,5 ммоль) и карбоната калия (2,14 г, 15,5 ммоль) в ацетоне (60 мл) нагревали при около 50°C в течение около 3,5 дней. Реакционную смесь затем охлаждали до температуры окружающей среды, фильтровали через диатомовую землю, промывая при этом дополнительным количеством ацетона, и затем концентрировали при пониженном давлении. Неочищенное вещество затем растворяли в минимальном количестве дихлорметана и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 80-100% этилацетата в гептане, с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 7,88 (с, 1H), 7,57 (с, 1H), 7,46 (с, 1H), 7,24 (с, 1H), 4,77 (с, 2H), 1,26 (с, 12H). MS (ESI+) m/z 252,2 (M+H)+.

Пример 268B

2-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]ацетамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 267B, с использованием соединения Примера 268A вместо соединения Примера 267A и с использованием нагревания при около 120°C в течение около 10 минут. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,32 (с, 1H), 7,98 (с, 1H), 7,87 (с, 1H), 7,77 (с, 1H), 7,48 (с, 1H), 7,45 (д, J=8,6 Гц, 1H), 7,26 (с, 1H), 7,22 (д, J=8,7 Гц, 1H), 5,28 (с, 2H), 4,78 (с, 2H). MS (ESI+) m/z 257,2 (M+H)+.

Пример 269

метил 3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил}пропаноат

Пример 269A

метил 3-(4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразол-1-ил)пропаноат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 267A, с использованием метилакрилата вместо акрилонитрила. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 7,91 (с, 1H), 7,57 (с, 1H), 4,35 (т, J=6,73 Гц, 2H), 2,87 (т, J=6,75 Гц, 2H), 3,59 (с, 3H), 1,24 (с, 12H). MS (ESI+) m/z 281,2 (M+H)+.

Пример 269B

метил 3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]пропаноат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 267B, с использованием соединения Примера 269A вместо соединения Примера 267A и с использованием нагревания при около 120°C в течение около 20 минут. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,32 (с, 1H), 8,00 (с, 1H), 7,85 (с, 1H), 7,76 (с, 1H), 7,42 (д, J=8,50 Гц, 1H), 7,21 (д, J=8,61 Гц, 1H), 5,28 (с, 2H), 4,37 (т, J=6,71 Гц, 2H), 3,61 (с, 3H), 2,92 (т, J=6,69 Гц, 2H). MS (ESI+) m/z 286,2 (M+H)+.

Пример 270

3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]пропанамид

Пример 270A

3-(4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразол-1-ил)пропанамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 267A, с использованием акриламида вместо акрилонитрила (0,72 г, 53%). 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 7,84 (с, 1H), 7,56 (с, 1H), 7,37 (с, 1H), 6,88 (с, 1H), 4,30 (т, J=6,80 Гц, 2H), 2,60 (т, J=6,79 Гц, 2H), 1,24 (с, 12H). MS (ESI+) m/z 266,2 (M+H)+.

Пример 270B

3-[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил]пропанамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 267B, с использованием соединения Примера 270A вместо соединения Примера 267A и с использованием нагревания при около 120°C в течение около 15 минут (0,056 г, 22%). 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,32 (с, 1H), 7,94 (д, J=0,53 Гц, 1H), 7,84 (с, 1H), 7,75 (д, J=0,54 Гц, 1H), 7,42 (м, 2H), 7,20 (д, J=8,26 Гц, 1H), 6,89 (с, 1H), 5,27 (с, 2H), 4,32 (т, J=6,89 Гц, 2H), 2,65 (т, J=6,89 Гц, 2H). MS (ESI+) m/z 271,0 (M+H)+.

Пример 271

[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил}ацетонитрил

Пример 271A

2-(4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразол-1-ил)ацетонитрил

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 268A, с использованием 2-бромацетонитрила вместо 2-бромацетамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 7,99 (с, 1H), 7,66 (с, 1H), 5,45 (с, 2H), 1,25 (с, 12H).

Пример 271B

трет-бутил 3-(бис(трет-бутоксикарбонил)амино)-5-бром-1H-индазол-1-карбоксилат

К 5-бром-1H-индазол-3-амину (2,00 г, 9,43 ммоль) в тетрагидрофуране (20 мл) добавляли 4-(диметиламино)пиридин (0,230 г, 1,886 ммоль) и ди-трет-бутилдикарбонат (6,18 г, 28,3 ммоль). Реакционную смесь нагревали при 50°C в течение около 2 часов, охлаждали до температуры окружающей среды и концентрировали при пониженном давлении. Остаток растворяли в диэтиловом эфире (100 мл) и затем промывали последовательно 1 н раствором хлористоводородной кислоты (2×25 мл), 1 н раствором гидроксида натрия (2×25 мл) и насыщенным солевым раствором (25 мл). Органический слой затем сушили над сульфатом натрия, фильтровали, концентрировали при пониженном давлении и сушили в вакуумной печи при около 60°C с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) 8,05 (д, J=8,95 Гц, 1H), 7,99 (д, J=1,90 Гц, 1H), 7,81 (дд, J=8,94, 1,89 Гц, 1H), 1,65 (с, 9H), 1,40 (с, 18H). MS (ESI+) m/z 512,2 (M+H)+.

Пример 271C

трет-бутил 3-(бис(трет-бутоксикарбонил)амино)-5-(1-(цианометил)-1H-пиразол-4-ил)-1H-индазол-1-карбоксилат

В сосуд загружали соединение Примера 271A (0,682 г, 2,93 ммоль), соединение Примера 271B (1,25 г, 2,44 ммоль), карбонат цезия (1,99 г, 6,10 ммоль), 1,4-диоксан (12,5 мл) и воду (2,50 мл). После цикла вакуум/продувка азотом через мембранную перегородку, добавляли трис(дибензилиденацетон)дипалладий(0) (0,112 г, 0,122 ммоль) и тетрафторборат три-трет-бутилфосфония (0,085 г, 0,29 ммоль) и сосуд закрывали крышкой после продувки азотом. Примерно через 6 часов при температуре окружающей среды реакционную смесь распределяли между насыщенным водным раствором бикарбоната натрия и дихлорметаном (каждый по 50 мл). Слои разделяли и водный слой экстрагировали дополнительным количеством дихлорметана (2×50 мл). Объединенные органические слои промывали насыщенным солевым раствором, сушили над сульфатом магния, фильтровали и концентрировали при пониженном давлении. Неочищенное масло растворяли в минимальном количестве дихлорметана и очищали при помощи хроматографии на силикагеле, используя для элюирования градиент 20-60% этилацетата в гептане, с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,43 (с, 1H), 8,19 (с, 1H), 8,08 (д, J=9,22 Гц, 1H), 7,93 (м, 2H), 5,53 (с, 2H), 1,67 (с, 9H), 1,39 (с, 18H). MS (ESI+) m/z 539,3 (M+H)+.

Пример 271D

[4-(3-амино-1H-индазол-5-ил)-1H-пиразол-1-ил}ацетонитрил

К раствору трет-бутил 3-(бис(трет-бутоксикарбонил)амино)-5-(1-(цианометил)-1H-пиразол-4-ил)-1H-индазол-1-карбоксилата (0,30 г, 0,557 ммоль) в дихлорметане (4,0 мл) добавляли трифторуксусную кислоту (2,0 мл). Примерно через 45 минут реакционную смесь медленно гасили насыщенным водным раствором бикарбоната натрия. Полученную смесь экстрагировали дихлорметаном (3×25 мл). Объединенные органические слои промывали насыщенным солевым раствором, сушили над сульфатом магния, фильтровали и концентрировали при пониженном давлении с получением неочищенного твердого вещества. Белый осадок, который был суспендирован как в исходном водном слое, так и в слое насыщенного солевого раствора, фильтровали и добавляли к неочищенному твердому веществу. Полученное твердое вещество растирали в порошок с дихлорметаном/метанолом (19:1). Оставшееся твердое вещество собирали фильтрованием под вакуумом и сушили в вакуумной печи при около 70°C с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,37 (с, 1H), 8,12 (с, 1H), 7,92 (с, 1H), 7,89 (с, 1H), 7,49-7,41 (м, 1H), 7,24 (д, J=8,71 Гц, 1H), 5,52 (с, 2H), 5,31 (с, 2H). MS (ESI+) m/z 239,1 (M+H)+.

Пример 272

4-(3-амино-1H-индазол-5-ил)-N,N-диметил-1H-имидазол-1-сульфонамид

3-Циано-4-фторфенилбороновую кислоту (0,083 г, 0,503 ммоль), 4-иод-N,N-диметил-1H-имидазол-1-сульфонамид (0,167 г, 0,554 ммоль), карбонат натрия (0,128 г, 1,208 ммоль) и тетракис(трифенилфосфин)палладий(0) (0,035 г, 0,030 ммоль) объединяли в диметоксиэтане (4 мл) и воде (1,5 мл). Реакционную смесь нагревали в микроволновом устройстве (CEM-Discover) при около 150°C в течение около 25 минут. Органический слой отделяли и растворитель удаляли при пониженном давлении. К остатку добавляли этанол (0,7 мл) и гидразинмоногидрат (1 мл). Реакционную смесь нагревали при около 80°C в течение около 20 часов. Реакционную смесь распределяли между водой (5 мл) и дихлорметаном (100 мл). Органический слой отделяли и концентрировали при пониженном давлении. Остаток очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,42 (с, 1H), 8,25 (с, 1H), 8,21 (д, J=1,36 Гц, 1H), 7,92 (д, J=1,37 Гц, 1H), 7,74 (дд, J=8,66, 1,58 Гц, 1H), 7,23 (д, J=8,68 Гц, 1H), 5,35 (с, 2H), 2,87 (с, 6H). MS (ESI+) m/z 307,2 (M+H)+.

Пример 273

5-пиразин-2-ил-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 2-иодпиразина вместо 4-иод-N,N-диметил-1H-имидазол-1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,61 (с, 1H), 9,18 (д, 1H, J=1,6), 8,66 (дд, 1H, J=1,7, 2,4), 8,59 (д, 1H, J=1,0), 8,51 (д, 1H, J=2,5), 8,04 (дд, 1H, J=1,8, 8,8), 7,35 (д, 1H, J=9,2), 5,54 (с, 2H). MS (ESI+) m/z 212,2 (M+H)+.

Пример 274

5-тиен-2-ил-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 2-иодтиофена вместо 4-иод-N,N-диметил-1H-имидазол-1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,47 (с, 1H), 7,99 (д, 1H, J=1,4), 7,55 (дд, 1H, J=1,8, 8,8), 7,43 (дд, 1H, J=1,0, 5,1), 7,35 (дд, 1H, J=1,1, 3,6), 7,26 (д, 1H, J=8,6), 7,10 (дд, 1H, J=3,5, 5,1), 5,42 (д, 2H, J=8,8). MS (ESI+) m/z 216,1 (M+H)+.

Пример 275

5-(2-аминопиримидин-4-ил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 5-иодпиримидин-2-амина вместо 4-иод-N,N-диметил-1H-имидазол-1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,40 (с, 1H), 8,53 (с, 2H), 7,91 (дд, 1H, J=0,7, 1,5), 7,47 (дд, 1H, J=1,8, 8,6), 7,28 (дд, 1H, J=0,7, 8,7), 6,64 (с, 2H), 5,36 (с, 2H), 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,41 (с, 1H), 8,53 (с, 2H), 7,92 (м, 1H), 7,47 (дд, J=8,66, 1,74 Гц, 1H), 7,28 (дд, J=8,63, 0,65 Гц, 1H), 6,64 (с, 2H), 5,36 (с, 2H). MS (ESI+) m/z 227,2 (M+H)+.

Пример 276

5-(2-метоксипиридин-3-ил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 3-иод-2-метоксипиридина вместо 4-иод-N,N-диметил-1H-имидазол-1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,43 (с, 1H), 8,14 (дд, 1H, J=1,9, 5,0), 7,86 (с, 1H), 7,71 (дд, 1H, J=2,0, 7,2), 7,42 (дд, 1H, J=1,7, 8,7), 7,26 (д, 1H, J=8,6), 7,09 (дд, 1H, J=5,0, 7,3), 5,38 (с, 2H), 3,89 (с, 3H). MS (ESI+) m/z 241,2 (M+H)+.

Пример 277

5-имидазо[1,2-a]пиридин-3-ил-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 3-бромимидазо[1,2-a]пиридина вместо 4-иод-N,N-диметил-1H-имидазол 1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,52 (дт, 1H, J=1,2, 7,0), 7,99 (дд, 1H, J=0,7, 1,7), 7,68 (с, 1H), 7,65 (дт, 2H, J=1,2, 9,0), 7,46 (дд, 1H, J=1,8, 8,6), 7,39 (дд, 1H, J=0,8, 8,6), 7,28 (ддд, 1H, J=1,2, 6,6, 9,2), 6,96 (тд, 1H, J=1,3, 6,7), 5,47 (с, 2H). MS (ESI+) m/z 250,2 (M+H)+.

Пример 278

N2,N2-диметил-N1-[5-(1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]глицинамид

Соединение Примера 65 (257 мг, 0,685 ммоль) растворяли в этаноле (15 мл). Реакционную смесь гидрировали в аппарате H-Cube с использованием гидроксида палладия (20%) на углероде при температуре около 80°C и давлении около 60 ф/кв.дюйм (4,29 кг/см2) в течение около 8 часов. Растворитель удаляли при пониженном давлении и остаток очищали при помощи обращенно-фазовой ВЭЖХ, с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,16-8,37 (м, 1H), 7,10-7,46 (ушир.с, 2H), 7,00-7,34 (ушир.с, 2H), 6,87-7,24 (ушир.с, 2H), 3,33-3,34 (м, 2H). MS (ESI+) m/z 286,2 (M+H)+.

Пример 279

5-(1H-пиразол-5-ил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 5-иод-1H-пиразола вместо 4-иод-N,N-диметил-1H-имидазол-1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 7,87-7,94 (м, 3H), 7,60-7,63 (м, 1H), 7,48 (дд, J=8,55, 1,62 Гц, 1H), 7,19-7,32 (м, 2H), 5,25-5,28 (м, 2H). MS (ESI+) m/z 200,1 (M+H)+.

Пример 280

5-(4-метил-1H-имидазол-5-ил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 5-иод-4-метил-1H-имидазола вместо 4-иод-N,N-диметил-1H-имидазол-1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 7,85 (с, 1H), 7,52 (д, 2H, J=6,6), 7,22 (м, 1H), 5,3 2 (ушир.с, 2H), 2,37 (с, 3H). MS (ESI+) m/z 214,1 (M+H)+.

Пример 281

5-(1H-имидазол-4-ил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 4-иод-1H-имидазола вместо 4-иод-N,N-диметил-1H-имидазол-1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,07 (с, 1H), 7,66 (с, 1H), 7,63 (д, 1H, J=8,6), 7,37 (с, 1H), 7,20 (д, 1H, J=8,8), 5,28 (с, 2H). MS (ESI+) m/z 200,1 (M+H)+.

Пример 282

N2,N2-диметил-N1-{5-[1-(3-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}глицинамид

Пример 282A

5-бром-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 62D, с использованием 5-бром-2-фторбензонитрила вместо соединения Примера 62C. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,55 (с, 1H), 7,92 (д, J=1,87 Гц, 1H), 7,30 (дд, J=8,79, 1,89 Гц, 1H), 7,19 (д, J=8,78 Гц, 1H), 5,41 (с, 2H).

Пример 282B

трет-бутил 3-амино-5-бром-1H-индазол-1-карбоксилат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 64A, с использованием соединения Примера 282A вместо соединения Примера 62D. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,12 (д, J=1,93 Гц, 1H), 7,95-7,81 (м, 1H), 7,65 (дд, J=8,85, 1,96 Гц, 1H), 6,39 (д, J=4,44 Гц, 1H), 1,58 (м, 9H).

Пример 282C

трет-бутил 5-бром-3-(2-(диметиламино)ацетамидо)-1H-индазол-1-карбоксилат

К смеси соединения Примера 282B (24,43 г, 78 ммоль), карбоната калия (81 г, 587 ммоль) и гидрохлорида 2-(диметиламино)ацетилхлорида (43,3 г, 274 ммоль) добавляли тетрагидрофуран (200 мл). Реакционную смесь перемешивали при комнатной температуре в течение около 2 часов. Реакционную смесь фильтровали и фильтрат промывали водой (50 мл). Органический слой отделяли и водный слой экстрагировали дихлорметаном (3×100 мл). Объединенные органические экстракты сушили над сульфатом магния, фильтровали и концентрировали при пониженном давлении. Остаток очищали при помощи хроматографии на силикагеле, элюируя метанолом в дихлорметане (5%), с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,72 (с, 1H), 8,19 (д, 1H, J=1,6), 8,03 (д, 1H, J=9,0), 7,76 (дд, 1H, J=2,0, 9,0), 3,22 (с, 2H), 2,32 (с, 6H), 1,63 (с, 9H).

Пример 282D

трет-бутил 3-(2-(диметиламино)ацетамидо)-5-((триметилсилил)этинил)-1H-индазол-1-карбоксилат

К смеси соединения Примера 282C (2,56 г, 6,44 ммоль), хлорида бис(трифенилфосфин)палладия(II) (0,225 г, 0,321 ммоль) и иодида меди(I) (0,073 г, 0,383 ммоль) добавляли триэтиламин (20 мл, 144 ммоль) с последующим добавлением этинилтриметилсилана (0,760 г, 7,73 ммоль). Реакционную смесь нагревали при около 60°C в течение около 3 часов. Реакционную смесь разбавляли дихлорметаном (100 мл), промывали водой (20 мл) и насыщенным солевым раствором (20 мл), сушили над сульфатом магния, фильтровали и концентрировали при пониженном давлении. Остаток очищали при помощи хроматографии на силикагеле, используя для элюирования этилацетат в дихлорметане (10%), с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,69 (с, 1H), 8,08 (с, 1H), 8,04 (д, 1H, J=9,0), 7,62 (д, 1H, J=8,8), 3,21 (с, 2H), 2,30 (с, 6H), 1,61 (с, 9H), 0,23 (с, 9H).

Пример 282E

2-(диметиламино)-N-(5-этинил-1H-индазол-3-ил)ацетамид

К соединению Примера 282D (0,303 г, 0,731 ммоль) в метаноле (5 мл) добавляли водный раствор гидроксида калия (1,46 мл, 1,46 ммоль, 1,0 н раствор). Реакционную смесь перемешивали при комнатной температуре в течение около 1 часа. Растворитель удаляли при пониженном давлении и остаток растворяли в этилацетате (80 мл). Органический слой отделяли и промывали водой (10 мл) и насыщенным солевым раствором (10 мл), сушили над сульфатом магния, фильтровали и концентрировали при пониженном давлении с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,89 (с, 1H), 10,14 (с, 1H), 8,00 (д, 1H, J=12,1), 7,44 (с, 2H), 7,38 (д, 1H, J=8,6), 4,02 (с, 1H), 3,17 (с, 2H), 2,33 (с, 6H).

Пример 282F

N2,N2-диметил-N1-{5-[1-(3-метилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}глицинамид

К суспензии соединения Примера 282E (0,16 г, 0,660 ммоль) в трет-бутаноле (1,2 мл) добавляли 1-(азидометил)-3-метилбензол (0,098 г, 0,667 ммоль), затем воду (1,2 мл). Добавляли раствор (R)-2-((S)-1,2-дигидроксиэтил)-4-гидрокси-5-оксо-2,5-дигидрофуран-3-олата натрия (0,057 мл, 0,066 ммоль, 1,6 M в воде) и водный раствор сульфата меди (II) пентагидрата (0,019 мл, 6,6 мкмоль, 0,34M). Реакционную смесь нагревали при около 60°C в течение около 2 часов. Растворитель удаляли при пониженном давлении и остаток очищали при помощи обращенно-фазовой ВЭЖХ, с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,77 (с, 1H), 10,05 (с, 1H), 8,56 (с, 1H), 8,24 (с, 1H), 7,82 (д, 1H, J=8,6), 7,50 (д, 1H, J=8,8), 7,28 (т, 1H, J=7,6), 7,16 (м, 4H), 5,59 (с, 2H), 3,18 (с, 2H), 2,34 (с, 6H), 2,30 (с, 3H). MS (ESI+) m/z 390,3 (M+H)+.

Пример 283

5-(1-бензил-1H-имидазол-4-ил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 272, с использованием 1-бензил-4-иод-1H-имидазола вместо 4-иод-N,N-диметил-1H-имидазол-1-сульфонамида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,29 (с, 1H), 8,07 (с, 1H), 7,79 (с, 1H), 7,61 (д, 1H, J=8,6), 7,46 (с, 1H), 7,36 (м, 5H), 7,17 (д, 1H, J=8,8), 5,28 (с, 2H), 5,22 (с, 2H). MS (ESI+) m/z 290,2 (M+H)+.

Пример 284

N1-{5-[1-(4-трет-бутилбензил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}-N2,N2-диметилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 282F, с использованием 1-(азидометил)-4-трет-бутилбензола вместо 1-(азидометил)-3-метилбензола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,88 (с, 1H), 10,05 (с, 1H), 8,57 (с, 1H), 8,23 (с, 1H), 7,81 (д, 1H, J=8,8), 7,50 (д, 1H, J=8,8), 7,41 (д, 2H, J=8,2), 7,30 (д, 2H, J=8,2), 3,18 (с, 2H), 2,34 (с, 6H), 1,26 (с, 9H). MS (ESI+) m/z 432,2 (M+H)+.

Пример 285

N2,N2-диметил-N1-{5-[1-(2-пиперидин-1-илэтил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 282F, с использованием 1-(2-азидоэтил)пиперидина вместо 1-(азидометил)-3-метилбензола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,91 (с, 1H), 10,07 (с, 1H), 8,47 (с, 1H), 8,22 (с, 1H), 7,80 (дд, 1H, J=1,2, 8,7), 7,52 (д, 1H, J=8,8), 4,49 (т, 2H, J=6,4), 3,19 (с, 2H), 2,76 (т, 2H, J=6,4), 2,41 (с, 4H), 2,35 (с, 6H), 1,69 (с, 3H), 1,47 (м, 4H), 1,37 (дд, 2H, J=5,2, 10,2). MS (ESI-) m/z 395,3 (M-H)-.

Пример 286

N2,N2-диметил-N1-{5-[1-(2-морфолин-4-илэтил)-1H-1,2,3-триазол-4-ил]-1H-индазол-3-ил}глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 282F, с использованием 4-(2-азидоэтил)морфолина вместо 1-(азидометил)-3-метилбензола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,83 (с, 1H), 10,07 (с, 1H), 8,49 (с, 1H), 8,23 (с, 1H), 7,81 (дд, 1H, J=1,3, 8,7), 7,52 (д, 1H, J=8,8), 4,53 (т, 2H, J=6,3), 3,55 (м, 4H), 3,19 (с, 2H), 2,80 (т, 2H, J=6,3), 2,45 (м, 4H), 2,35 (с, 6H). MS (ESI-) m/z 397,3 (M-H)-.

Пример 287

N1-(5-{1-[2-(3,5-диметилизоксазол-4-ил)этил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-ил)-N2,N2-диметилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 282F, с использованием 4-(2-азидоэтил)-3,5-диметилизоксазола вместо 1-(азидометил)-3-метилбензола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,90 (с, 1H), 10,07 (с, 1H), 8,44 (с, 1H), 8,21 (с, 1H), 7,78 (дд, 1H, J=1,3, 8,7), 7,52 (д, 1H, J=8,8), 4,51 (т, 2H, J=6,7), 3,19 (с, 2H), 2,93 (т, 2H, J=6,7), 2,35 (с, 6H), 2,08 (д, 6H, J=4,3). MS (ESI-) m/z 407,2 (M-H)-.

Пример 288

N1-(5-{1-[2-(3,5-диметил-1H-пиразол-4-ил)этил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-ил)-N2,N2-диметилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 282F, с использованием 4-(2-азидоэтил)-3,5-диметил-1H-пиразола вместо 1-(азидометил)-3-метилбензола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,85 (с, 1H), 10,06 (с, 1H), 8,37 (с, 1H), 8,21 (с, 1H), 7,78 (д, 1H, J=8,8), 7,51 (д, 1H, J=8,8), 4,42 (т, 2H, J=6,9), 3,19 (с, 2H), 2,89 (т, 2H, J=7,0), 2,35 (с, 6H), 1,97 (с, 6H). MS (ESI-) m/z 406,2 (M-H)-.

Пример 289

2-(4-{3-[(N,N-диметилглицил)амино]-1H-индазол-5-ил}-1H-1,2,3-триазол-1-ил)-2-метилпропановая кислота

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 282F, с использованием 2-азидо-2-метилпропановой кислоты вместо 1-(азидометил)-3-метилбензола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,77 (с, 1H), 10,03 (с, 1H), 8,47 (с, 1H), 8,22 (с, 1H), 7,85 (дд, 1H, J=0,9, 8,7), 7,49 (д, 1H, J=8,6), 3,21 (с, 2H), 2,36 (с, 6H), 1,77 (с, 6H). MS (ESI-) m/z 370,2 (M-H)-.

Пример 290

этил (4-{3-[(N,N-диметилглицил)амино]-1H-индазол-5-ил}-1H-1,2,3-триазол-1-ил)ацетат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 282F, с использованием этил 2-азидоацетата вместо 1-(азидометил)-3-метилбензола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,87 (с, 1H), 10,08 (с, 1H), 8,51 (с, 1H), 8,26 (с, 1H), 7,82 (дд, 1H, J=1,4, 8,7), 7,53 (д, 1H, J=8,8), 5,44 (с, 2H), 4,21 (кв., 2H, J=7,0), 3,19 (с, 2H), 2,35 (с, 6H), 1,24 (т, 3H, J=7,1). MS (ESI+) m/z 372,2 (M+H)+.

Пример 291

N2,N2-диметил-N1-(5-{1-[(триметилсилил)метил]-1H-1,2,3-триазол-4-ил}-1H-индазол-3-ил)глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 282F, с использованием (азидометил)триметилсилана вместо 1-(азидометил)-3-метилбензола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 13,04 (с, 1H), 10,20 (с, 1H), 8,46 (с, 1H), 8,36 (с, 1H), 7,94 (дд, 1H, J=1,3, 8,7), 7,65 (д, 1H, J=8,8), 4,18 (с, 2H), 3,33 (с, 2H), 2,49 (с, 6H), 0,25 (м, 9H). MS (ESI+) m/z 372,2 (M+H)+.

Пример 292

N1-[5-(3-фурил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием фуран-3-илбороновой кислоты вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,70 (с, 1H), 9,98 (с, 1H), 8,08 (с, 1H), 7,90 (с, 1H), 7,72 (т, 1H, J=1,6), 7,59 (дд, 1H, J=1,4, 8,7), 7,45 (д, 1H, J=8,8), 6,87 (с, 1H), 3,17 (с, 2H), 2,33 (с, 6H). MS (ESI+) m/z 285,2 (M+H)+.

Пример 293

N2,N2-диметил-N1-[5-1H-пиразол-5-ил)-1H-индазол-3-ил]глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием 1H-пиразол-5-илбороновой кислоты вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,68 (с, 1H), 10,01 (с, 1H), 8,12 (с, 1H), 7,80 (д, 1H, J=9,0), 7,69 (с, 1H), 7,46 (д, 1H, J=8,6), 6,60 (д, 1H, J=2,0), 3,17 (д, 2H, J=6,4), 2,34 (с, 6H). MS (ESI+) m/z 285,2 (M+H)+.

Пример 294

N2,N2-диметил-N1-(5-пиримидин-5-ил-1H-индазол-3-ил)глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием пиримидин-5-илбороновой кислоты вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,87 (с, 1H), 10,11 (с, 1H), 9,16 (с, 1H), 9,09 (с, 2H), 8,16 (с, 1H), 7,75 (дд, 1H, J=1,5, 8,8), 7,60 (д, 1H, J=8,8), 3,18 (с, 2H), 2,33 (с, 6H). MS (ESI+) m/z 297,2 (M+H)+.

Пример 295

N1-[5-(2,1,3-бензоксадиазол-5-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием бензо[c][1,2,5]оксадиазол-5-илбороновой кислоты вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,87 (с, 1H), 10,15 (с, 1H), 8,29 (с, 1H), 8,21 (с, 1H), 8,16 (д, 1H, J=9,4), 7,99 (дд, 1H, J=1,1, 9,4), 7,85 (м, 1H), 7,59 (д, 1H, J=8,8), 3,19 (с, 2H), 2,34 (с, 6H). MS (ESI+) m/z 337,2 (M+H)+.

Пример 296

N2,N2-диметил-N1-[5-(1H-пиразол-4-ил)-1H-индазол-3-ил]глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием 4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,62 (с, 1H), 9,94 (с, 1H), 7,95 (с, 2H), 7,87 (с, 1H), 7,58 (д, 1H, J=8,8), 7,42 (д, 1H, J=8,8), 3,16 (с, 2H), 2,34 (с, 6H). MS (ESI+) m/z 285,2 (M+H)+.

Пример 297

N2,N2-диметил-N1-[5-(1-метил-1H-пиразол-4-ил)-1H-индазол-3-ил]глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием 1-метил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,64 (с, 1H), 9,98 (с, 1H), 8,04 (с, 1H), 7,86 (с, 1H), 7,76 (с, 1H), 7,55 (дд, 1H, J=1,6, 8,6), 7,43 (д, 1H, J=8,8), 3,87 (с, 3H), 3,17 (с, 2H), 2,35 (с, 6H). MS (ESI+) m/z 299,2 (M+H)+.

Пример 298

N1-[5-(3,5-диметил-1H-пиразол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием 3,5-диметил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,63 (с, 1H), 10,02 (с, 1H), 7,63 (с, 1H), 7,46 (м, 1H), 7,27 (дд, 1H, J=1,6, 8,6), 3,16 (с, 2H), 2,32 (с, 6H), 2,18 (с, 6H). MS (ESI+) m/z 323,2 (M+H)+.

Пример 299

N1-{5-[2-(диметиламино)пиримидин-5-ил]-1H-индазол-3-ил}-N2,N2-диметилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием N,N-диметил-5-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)пиримидин-2-амина вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,72 (с, 1H), 10,03 (с, 1H), 8,62 (с, 2H), 7,91 (с, 1H), 7,58 (дд, 1H, J=1,6, 8,6), 7,51 (д, 1H, J=8,5), 3,16 (с, 8H), 2,33 (с, 6H). MS (ESI+) m/z 340,2 (M+H)+.

Пример 300

N2,N2-диметил-N1-[5-(2-морфолин-4-илпиримидин-5-ил)-1H-индазол-3-ил]глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием 4-(5-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)пиримидин-2-ил)морфолина вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,74 (с, 1H), 10,03 (с, 1H), 8,67 (с, 2H), 7,94 (с, 1H), 7,60 (дд, 1H, J=1,8, 8,8), 7,52 (д, 1H, J=8,5), 3,74 (м, 4H), 3,67 (м, 4H), 3,17 (с, 2H), 2,33 (с, 6H). MS (ESI+) m/z 382,2 (M+H)+.

Пример 301

N2,N2-диметил-N1-{5-[1-(2-морфолин-4-илэтил)-1H-пиразол-4-ил]-1H-индазол-3-ил}глицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 233A, с использованием соединения Примера 282C вместо 5-бром-2-фторбензонитрила и с использованием 4-(2-(4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразол-1-ил)этил)морфолина вместо 1-бензил-4-(4,4,5,5-тетраметил-1,3,2-диоксаборолан-2-ил)-1H-пиразола. 1H ЯМР (600 МГц, ДМСО-d6) δ м.д. 12,63 (с, 1H), 9,96 (с, 1H), 8,09 (с, 1H), 7,85 (с, 1H), 7,77 (с, 1H), 7,54 (дд, 1H, J=1,5, 8,8), 7,43 (д, 1H, J=8,5), 4,24 (т, 2H, J=6,6), 3,54 (м, 4H), 3,16 (с, 2H), 2,73 (т, 2H, J=6,6), 2,41 (с, 4H), 2,34 (с, 6H). MS (ESI+) m/z 398,3 (M+H)+.

Пример 302

N1-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид

Пример 302A

1-бензил-5-циклопропил-4-(трибутилстаннил)-1H-1,2,3-триазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 142A, с использованием толуола вместо гексана и с использованием (азидометил)бензола вместо соединения Примера 80A. Неочищенный продукт использовали на следующей стадии без очистки.

Пример 302B

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-2-фторбензонитрил

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 142B, с использованием соединения Примера 302A вместо соединения Примера 142A и с использованием 2-фтор-5-иодбензонитрила вместо соединения Примера 87A. MS (ESI+) m/z 319,2 (M+H)+.

Пример 302C

5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-амин

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 62D, с использованием соединения Примера 302B вместо соединения Примера 62C. MS (ESI-) m/z 299,2 (M-H)-.

Пример 302D

трет-бутил 3-амино-5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-карбоксилат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 64A, с использованием соединения Примера 302C вместо соединения Примера 62D.

Пример 302E

N1-[5-(1-бензил-5-циклопропил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 64B, с использованием соединения Примера 302D вместо соединения Примера 64A и с использованием гидрохлорида диметиламиноацетилхлорида вместо метоксиацетилхлорида. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,76 (с, 1H), 10,06 (с, 1H), 8,18 (с, 1H), 7,79 (д, 1H, J=8,8), 7,50 (д, 1H, J=8,8), 7,34 (м, 5H), 5,68 (с, 2H), 3,16 (с, 2H), 2,32 (с, 6H), 1,76 (м, 1H), 1,05 (кв., 2H, J=6,1), 0,39 (кв., 2H, J=5,4). MS (ESI+) m/z 416,3 (M+H)+. MS (ESI+) m/z 416,3 (M+H)+.

Пример 303

N1[5-(1-бензил-1H-пиразол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид

Пример 303A

трет-бутиловый эфир 3-амино-5-(1-бензил-1H-пиразол-4-ил)-индазол-1-карбоновой кислоты

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 64A, с использованием соединения Примера 233B вместо соединения Примера 62D (0,925 г, 100%). 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,19 (с, 1H), 8,04 (с, 1H), 7,90-7,95 (м, 1H), 7,87 (с, 1H), 7,74 (д, J=1,6 Гц, 1H), 7,28-7,36 (м, 5H), 6,27 (с, 2H), 5,37 (с, 2H), 1,58 (с, 9H). MS (ESI+) m/z 390 (M+H)+.

Пример 303B

N1-[5-(1-бензил-1H-пиразол-4-ил)-1H-индазол-3-ил]-N2,N2-диметилглицинамид

Суспензию 2-(диметиламино)уксусной кислоты (32 мг, 0,308 ммоль) и оксалилхлорида (0,31 мл, 0,61 ммоль) в дихлорметане (5 мл) и диметилформамиде (2 капли) перемешивали при температуре окружающей среды в течение около 1 часа, затем концентрировали при пониженном давлении. Остаток суспендировали в тетрагидрофуране (3 мл) и добавляли к суспензии соединения Примера 303A (40 мг, 0,103 ммоль) и карбоната калия (43 мг, 0,308 ммоль) в тетрагидрофуране (5 мл). Реакционную смесь перемешивали при температуре окружающей среды в течение около 30 минут, затем добавляли трифторуксусную кислоту (4 мл) и реакционную смесь нагревали при около 60°C в течение около 20 часов. Реакционную смесь охлаждали до температуры окружающей среды и концентрировали при пониженном давлении, разбавляли дихлорметаном (20 мл) и промывали 15% водным раствором гидроксид натрия (20 мл). Органический экстракт отделяли, сушили над сульфатом магния, фильтровали и концентрировали при пониженном давлении. Неочищенное вещество очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения ацетата соли. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 9,97 (с, 1H), 8,21 (с, 1H), 7,83 (с, 1H), 7,82 (с, 1H), 7,56 (д, J=8,7 Гц, 1H), 7,43 (д, J=8,6 Гц, 1H), 7,32-7,40 (м, 2H), 7,25-7,32 (м, 3H), 5,35 (с, 2H), 3,16 (с, 2H), 2,33 (с, 6H), 1,91 (с, 3H). MS (ESI+) m/z 375 (M+H)+.

Пример 304

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-метилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 303B, с использованием 2-(трет-бутоксикарбонил(метил)амино)уксусной кислоты вместо 2-(диметиламино)уксусной кислоты и с использованием соединения Примера 64A вместо соединения Примера 303A. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,56 (с, 1H), 8,28 (с, 1H), 7,78-7,88 (м, 1H), 7,45-7,56 (м, 1H), 7,28-7,45 (5H, m), 5,64 (2H, s), 2,37 (с, 2H), 1,89 (с, 3H). MS (ESI+) m/z 362 (M+H)+.

Пример 305

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-пирролидин-1-илацетамид

Пример 305A

трет-бутил 5-(1-бензил-1H-1,2,3-триазол-4-ил)-3-(2-бромацетамидо)-1H-индазол-1-карбоксилат

К суспензии соединения Примера 64A (500 мг, 1,28 ммоль) в тетрагидрофуране (12 мл) добавляли диизопропилэтиламин (0,22 мл, 1,28 ммоль). Реакционную смесь перемешивали при температуре окружающей среды в течение около 15 минут, затем добавляли 2-бромацетилхлорид (0,11 мл, 1,2 ммоль). Реакционную смесь перемешивали при температуре окружающей среды в течение около 16 часов, затем добавляли дополнительное количество 2-бромацетилхлорида (0,11 мл, 1,2 ммоль). Реакционную смесь перемешивали еще в течение 15 минут, затем концентрировали при пониженном давлении с получением указанного в заголовке соединения в виде коричневого твердого вещества. Это вещество использовали без дополнительной очистки.

Пример 305B

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-пирролидин-1-илацетамид

К раствору соединения Примера 305A (44 мг, 0,086 ммоль) и диизопропилэтиламина (0,015 мл, 0,086 ммоль) в ацетонитриле (1 мл) добавляли пирролидин (0,021 мл, 0,25 ммоль) и реакционную смесь нагревали при около 60°C в течение около 15 минут. Реакционную смесь охлаждали до температуры окружающей среды и добавляли трифторуксусную кислоту (1 мл). Реакционную смесь нагревали при около 60°C в течение около 48 часов. Реакционную смесь концентрировали при пониженном давлении, разбавляли дихлорметаном (20 мл) и промывали 15% водным раствором гидроксида натрия (20 мл). Органический слой отделяли, сушили над сульфатом магния, фильтровали и концентрировали при пониженном давлении. Неочищенное вещество очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,58 (с, 1H), 8,24 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,50 (д, J=8,7 Гц, 1H), 7,27- 7,45 (м, 5H), 5,64 (с, 2H), 3,35 (с, 2H), 2,65 (с, 4H), 1,76 (с, 4H). MS (ESI+) m/z 402 (M+H)+.

Пример 306

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-циклопентилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 305B, с использованием циклопентанамина вместо пирролидина (0,004 г, 12%). 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,56 (с, 1H), 8,31 (с, 1H), 7,73-7,86 (д, J=8,8 Гц, 1H), 7,49 (д, J=8,7 Гц, 1H), 7,29-7,45 (м, 5H), 5,64 (с, 2H), 3,37 (с, 2H), 2,99-3,14 (м, 1H), 1,60-1,80 (м, 4H), 1,30-1,50 (м, 4H). MS (ESI+) m/z 416 (M+H)+.

Пример 307

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-циклопропилглицинамид

К раствору соединения Примера 305 A (100 мг, 0,196 ммоль) и диизопропилэтиламин (0,034 мл, 0,19 ммоль) в ацетонитриле (1 мл) добавляли циклопропанамин (11 мг, 0,19 ммоль) и реакционную смесь нагревали при около 60°C в течение около 1 часа. Реакционную смесь охлаждали до температуры окружающей среды и добавляли хлористоводородную кислоту (раствор 4 н в диоксане, 1 мл). Реакционную смесь перемешивали при температуре окружающей среды в течение около 16 часов. Реакционную смесь концентрировали при пониженном давлении и неочищенное вещество очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения ацетата соли. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,18 (с, 1H), 8,28 (с, 1H), 8,56 (с, 1H), 7,81 (д, J=8,6 Гц, 1H), 7,49 (д, J=8,7 Гц, 1H), 7,30-7,45 (м, 5H), 5,64 (с, 2H), 3,45 (с, 2H), 2,18-2,26 (м, 1H), 1,89 (с, 3H), 0,37-0,45 (м, 2H), 0,29-0,37 (м, 2H). MS (ESI+) m/z 388 (M+H)+.

Пример 308

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-тетрагидро-2H-пиран-4-илглицинамид

Указанное в заголовке соединение получали в форме соли ацетата в соответствии с процедурой, описанной в Примере 307, с использованием тетрагидро-2H-пиран-4-амина вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,56 (с, 1H), 8,31 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,50 (д, J=8,7 Гц, 1H), 7,31-7,45 (м, 5H), 5,64 (с, 2H), 3,84 (д, J=11,2 Гц, 2H), 3,43 (с, 2H), 3,30 (т, J=10,8 Гц, 2H), 2,62-2,74 (м, 1H), 1,88 (с, 3H), 1,75-1,85 (м, 2H), 1,24-1,39 (м, 2H). MS (ESI+) m/z 432 (M+H)+.

Пример 309

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-(3-гидрокси пирролидин-1-ил)ацетамид

Указанное в заголовке соединение получали в форме соли диацетата в соответствии с процедурой, описанной в Примере 307, с использованием пирролидин-3-ола вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,09 (с, 1H), 8,22 (с, 1H), 8,58 (с, 1H), 7,82 (д, J=8,7 Гц, 1H), 7,50 (д, J=8,7 Гц, 1H), 7,28-7,45 (м, 5H), 5,64 (с, 2H), 4,16-4,26 (м, 1H), 3,34 (с, 2H), 2,77-2,93 (м, 2H), 2,52-2,65 (м, 2H), 1,98-2,13 (м, 1H), 1,87 (с, 6H), 1,56-1,69 (м, 1H). MS (ESI+) m/z 418 (M+H)+.

Пример 310

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-(3-гидрокси пиперидин-1-ил)ацетамид

Указанное в заголовке соединение получали в форме соли ацетата в соответствии с процедурой, описанной в Примере 307, с использованием пиперидин-3-ола вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,05 (с, 1H), 8,56 (с, 1H), 8,23 (с, 1H), 7,82 (д, J=8,7 Гц, 1H), 7,50 (д, J=8,7 Гц, 1H), 7,29-7,44 (м, 5H), 5,64 (с, 2H), 3,55-3,67 (м, 1H), 3,20 (с, 2H), 2,77-2,88 (м, 1H), 2,60-2,70 (м, 1H), 2,22-2,35 (м, 1H), 2,12-2,23 (м, 1H), 1,88 (с, 3H), 1,66-1,78 (м, 2H), 1,43-1,59 (м, 1H), 1,13-1,27 (м, 1H). MS (ESI+) m/z 432 (M+H)+.

Пример 311

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N3,N3-диметил-бета-аланинамид

Указанное в заголовке соединение получали в форме соли ацетата в соответствии с процедурой, описанной в Примере 307, с использованием диметиламина вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,48 (с, 1H), 8,54 (с, 1H), 8,26 (с, 1H), 7,80 (д, J=8,7 Гц, 1H), 7,48 (д, J=8,7 Гц, 1H), 7,30-7,44 (м, 5H), 5,64 (с, 2H), 2,60 (д, J=6,1 Гц, 2H), 2,54 (д, J=6,3 Гц, 2H), 2,21 (с, 6H), 1,90 (с, 3H). MS (ESI+) m/z 390 (M+H)+.

Пример 312

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-морфолин-4-илацетамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 307, с использованием морфолина вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,10 (с, 1H), 8,57 (с, 1H), 8,23 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,50 (д, J=8,7 Гц, 1H), 7,29-7,46 (м, 5H), 5,64 (с, 2H), 3,59-3,71 (м, 4H), 3,22-3,28 (м, 2H), 2,54-2,64 (м, 4H). MS (ESI+) m/z 418 (M+H)+.

Пример 313

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-(4-метилпиперазин-1-ил)ацетамид

Указанное в заголовке соединение получали в форме диацетатной соли в соответствии с процедурой, описанной в Примере 307, с использованием 1-метилпиперазина вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,57 (с, 1H), 8,25 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,50 (д, J=8,7 Гц, 1H), 7,32-7,43 (м, 5H), 5,64 (с, 2H), 3,22 (с, 2H), 2,53-2,65 (м, 4H), 2,31-2,45 (м, 4H), 2,17 (с, 3H), 1,85 (с, 6H). MS (ESI+) m/z 431 (M+H)+.

Пример 314

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-(3-оксопиперазин-1-ил)ацетамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 307, с использованием пиперазин-2-она вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,21 (с, 1H), 8,57 (с, 1H), 8,22 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,50 (д, J=8,7 Гц, 1H), 7,31-7,46 (м, 5H), 5,64 (с, 2H), 3,36 (с, 2H), 3,24 (с, 2H), 3,17 (с, 2H), 2,78 (с, 2H). MS (ESI+) m/z 431 (M+H)+.

Пример 315

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-изопропилглицинамид

Указанное в заголовке соединение получали в форме ацетатной соли в соответствии с процедурой, описанной в Примере 307, с использованием пропан-2-амина вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,56 (с, 1H), 8,31 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,49 (д, J=8,7 Гц, 1H), 7,31-7,44 (м, 5H), 5,64 (с, 2H), 3,39 (с, 2H), 2,73-2,86 (м, 1H), 1,90 (с, 3H), 1,04 (д, J=6,1 Гц, 6H). MS (ESI+) m/z 390 (M+H)+.

Пример 316

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-циклогексилглицинамид

Указанное в заголовке соединение получали в форме ацетатной соли в соответствии с процедурой, описанной в Примере 307, с использованием циклогексанамина вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,55 (с, 1H), 8,31 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,49 (д, J=8,7 Гц, 1H), 7,30-7,44 (м, 5H), 5,64 (с, 2H), 3,40 (с, 2H), 1,90 (с, 3H), 1,80-1,88 (м, 2H), 1,63- 1,73 (м, 2H), 1,50-1,60 (м, 1H), 1,02-1,29 (м, 5H). MS (ESI+) m/z 430 (M+H)+.

Пример 317

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]ацетамид

К смеси соединения Примера 64A (20 мг, 0,051 ммоль) и диизопропилэтиламина (0,063 мл, 0,35 ммоль) в тетрагидрофуране (1,5 мл) добавляли ацетилхлорид (0,013 мл, 0,17 ммоль) и реакционную смесь перемешивали при температуре окружающей среды в течение около 1,5 часов. Добавляли хлористоводородную кислоту (раствор 4 н в диоксане, 1,5 мл) и смесь перемешивали при температуре окружающей среды в течение около 16 часов. Растворитель удаляли при пониженном давлении и неочищенное вещество очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения в виде ацетатной соли. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,35 (с, 1H), 8,57 (с, 1H), 8,22 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,48 (д, J=8,7 Гц, 1H), 7,33-7,42 (м, 5H), 5,64 (с, 2H), 2,13 (с, 3H). MS (ESI-) m/z 331 (M-H)-.

Пример 318

N1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N2-циклобутилглицинамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 307, с использованием циклобутанамина вместо циклопропанамина. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 8,56 (с, 1H), 8,29 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,49 (д, J=8,7 Гц, 1H), 7,31-7,45 (м, 5H), 5,64 (с, 2H), 3,31 (с, 2H), 2,01-2,20 (м, 2H), 1,48-1,83 (м, 5H). MS (ESI+) m/z 402 (M+H)+.

Пример 319

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-пропилмочевина

К раствору соединения Примера 64A (75 мг, 0,19 ммоль) в пиридине (2 мл) добавляли 1-изоцианатопропан (16 мг, 0,19 ммоль) и реакционную смесь перемешивали при температуре окружающей среды в течение около 3 часов. Добавляли дополнительное количество изоцианата (0,1 мл) добавляли и смесь нагревали при около 80°C в течение около 16 часов. Реакционную смесь охлаждали до температуры окружающей среды и добавляли воду (5 мл). Полученный осадок собирали фильтрованием, затем обрабатывали хлористоводородной кислотой (4 н раствор в диоксане, 3 мл) и перемешивали при комнатной температуре в течение около 4,5 часов. Добавляли диэтиловый эфир (5 мл) и осадок собирали фильтрованием. Неочищенное вещество очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения в виде ацетатной соли. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 9,34 (с, 1H), 8,50 (с, 1H), 8,42 (с, 1H), 7,80 (д, J=8,7 Гц, 1H), 7,38 (д, J=8,7 Гц, 1H), 7,31-7,48 (м, 5H), 5,65 (с, 2H), 3,18 (дд, J=6,6, 12,7 Гц, 2H), 1,51 (дд, J=7,1, 14,3 Гц, 2H), 0,91 (т, J=7,3 Гц, 3H). MS (ESI+) m/z 376 (M+H)+.

Пример 320

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]этансульфонамид

К раствору соединения Примера 64A (75 мг, 0,19 ммоль) в пиридине (2 мл) добавляли этансульфонилхлорид (25 мг, 0,19 ммоль) и реакционную смесь перемешивали при комнатной температуре в течение около 3 часов. Добавляли дополнительное количество сульфонилхлорида (25 мг, 0,19 ммоль) и реакционную смесь перемешивали в течение около 48 часов. Реакционную смесь концентрировали при пониженном давлении и остаток растворяли в дихлорметане (10 мл) и промывали 1 н водным раствором хлористоводородной кислоты (10 мл). Органическую часть отделяли, сушили при пониженном давлении и обрабатывали хлористоводородной кислотой (4 н раствор в диоксане, 5 мл) и перемешивали при комнатной температуре в течение около 12 часов. Реакционную смесь концентрировали при пониженном давлении и неочищенное вещество очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения в виде ацетатной соли. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,12 (с, 1H), 8,61 (с, 1H), 8,24 (с, 1H), 7,83 (д, J=8,7 Гц, 1H), 7,52 (д, J=8,7 Гц, 1H), 7,29-7,48 (м, 5H), 5,64 (с, 2H), 3,29 (д, J=9,2 Гц, 2H), 1,31 (т, J=7,3 Гц, 3H). MS (ESI+) m/z 383 (M+H)+.

Пример 321

5-(1-бензил-1H-1,2,3-триазол-4-ил)-N-(циклопропилметил)-1H-индазол-3-амин

Смесь соединения Примера 64A (100 мг, 0,256 ммоль), циклопропанкарбальдегида (0,057 мл, 0,76 ммоль), триацетоксиборогидрида натрия (163 мг, 0,76 ммоль) и уксусной кислоты (0,044 мл, 0,76 ммоль) в 1,2-дихлорэтане (5 мл) перемешивали при температуре окружающей среды в течение около 2,5 часов. Добавляли хлористоводородную кислоту (4 н раствор в диоксане, 4 мл) и реакционную смесь перемешивали в течение около 16 часов. Осадок собирали фильтрованием, промывая простым эфиром (10 мл). Твердое вещество растворяли в дихлорметане (10 мл) и обрабатывали трифторуксусной кислотой (0,1 мл) и реакционную смесь перемешивали при комнатной температуре в течение около 2 часов. Реакционную смесь нейтрализовали добавлением 15% водного раствора гидроксида натрия (около 15 мл) и органический слой отделяли, сушили над сульфатом магния, фильтровали и концентрировали при пониженном давлении. Неочищенное вещество очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения в виде ацетатной соли. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 11,43 (с, 1H), 8,41 (с, 1H), 8,28 (с, 1H), 7,68 (д, J=8,7 Гц, 1H), 7,32-7,45 (м, 5H), 7,26 (д, J=8,6 Гц, 1H), 6,08 (т, J=5,7 Гц, 1H), 5,64 (с, 2H), 3,12 (т, J=6,2 Гц, 2H), 1,04-1,22 (м, 1H), 0,35-0,53 (м, 2H), 0,17-0,32 (м, 2H). MS (ESI+) m/z 345 (M+H)+.

Пример 322

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-N'-этилмочевину

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 319, с использованием изоцианатоэтана вместо 1-изоцианатопропана. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 9,32 (с, 1H), 8,49 (с, 1H), 8,42 (с, 1H), 7,81 (д, J=8,7 Гц, 1H), 7,70 (д, J=8,7 Гц, 1H), 7,31-7,49 (м, 5H), 5,65 (с, 2H), 3,23 (д, J=6,9 Гц, 2H), 1,12 (т, J=7,1 Гц, 3H). MS (ESI+) m/z 362 (M+H)+.

Пример 323

1-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]пирролидин-2-он

Суспензию соединения Примера 64A (200 мг, 0,51 ммоль) и диизопропилэтиламина (0,089 мл, 0,51 ммоль) в тетрагидрофуране (5 мл) перемешивали в течение около 15 минут при температуре окружающей среды, затем добавляли 4-бромбутаноилхлорид (0,059 мл, 0,51 ммоль). Реакционную смесь перемешивали в течение около 16 часов. Осадок удаляли фильтрованием и фильтрат концентрировали при пониженном давлении. Остаток поглощали в ацетонитрил (5 мл) и обрабатывали диизопропилэтиламином (0,089 мл, 0,51 ммоль) и нагревали при около 60°C в течение около 16 часов. Реакционную смесь охлаждали до комнатной температуры и концентрировали при пониженном давлении. Остаток обрабатывали хлористоводородной кислотой (4 н раствор в диоксане, 5 мл) и реакционную смесь перемешивали при комнатной температуре в течение около 2 часов. Реакционную смесь концентрировали при пониженном давлении и неочищенное вещество очищали при помощи обращенно-фазовой ВЭЖХ с использованием метода градиентного элюирования ацетонитрил/вода (0,05 M ацетата аммония) с получением указанного в заголовке соединения в виде ацетатной соли. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 12,84 (с, 1H), 8,56 (с, 1H), 8,49 (с, 1H), 7,84 (д, J=8,6 Гц, 1H), 7,51 (д, J=8,7 Гц, 1H), 7,29-7,46 (м, 5H), 5,64 (с, 2H), 3,96 (т, J=6,9 Гц, 2H), 2,56 (т, J=7,9 Гц, 2H), 2,25-2,12 (м, 2H). MS (ESI+) m/z 359 (M+H)+.

Пример 324

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-4-(диметиламино)бутанамид

Указанное в заголовке соединение получали в форме диацетатной соли в соответствии с процедурой, описанной в Примере 303B, с использованием 4-(диметиламино)бутановой кислоты вместо 2-(диметиламино)уксусной кислоты и с использованием соединения Примера 64A вместо соединения Примера 303A. 1H ЯМР (400 МГц, ДМСО-d6) δ м.д. 10,34 (с, 1H), 8,53 (с, 1H), 8,22 (с, 1H), 7,78 (д, J=8,7 Гц, 1H), 7,47 (д, J=8,7 Гц, 1H), 7,30-7,41 (м, 5H), 5,62 (с, 2H), 2,41 (т, J=7,2 Гц, 2H), 2,28 (т, J=6,8 Гц, 2H), 2,14 (с, 6H), 1,84 (с, 6H), 1,74-1,77 (м, 2H). MS (ESI-) m/z 462 (M-H)-.

Пример 325

N-3,4-дигидро-1H-изохромен-4-ил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 3,4-дигидро-1H-изохромен-4-амина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,02 (д, 1H), 8,4 (м, 1H), 8,22 (м, 1H), 7,75 (м, 2H), 7,2-7,4 (м, 5H), 5,24 (м, 1H), 4,75 (м, 2H), 4,02 (м, 1H), 3,8 (м, 1H). MS m/z (ESI+) 361 (M+H)+.

Пример 326

N-(циклогексилметил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

5-(1H-Индазол-5-ил)изоксазол-3-карбоновую кислоту (35 мг, 0,15 ммоль, Пример 71A) растворяли в N,N-диметилформамиде (0,8 мл) с последующим добавлением HATU (60 мг, 0,15 ммоль), растворенного в N,N-диметилформамиде (0,8 мл). Затем добавляли раствор 1-циклогексилметанамина (17 мг, 0,17 ммоль), растворенного в N,N-диметилформамиде (0,8 мл), с последующим добавлением диизопропилэтиламина (56 мкл, 0,31 ммоль), растворенного в N,N-диметилформамиде (0,8 мл). Полученную смесь встряхивали в течение 3 часов при 40°C. Реакционную смесь фильтровали, контролировали методом ЖХ/МС и концентрировали досуха. Остатки растворяли в смеси 1:1 диметилсульфоксид/метанол и очищали при помощи обращенно-фазовой ВЭЖХ (колонка Phenomenex® Luna® C8 (2) 5 мкм 100Å AXIA™ (30 мм × 75 мм), 50 мл/мин, 10-100% ацетонитрила/0,1% трифторуксусной кислоты в воде) с получением указанного в заголовке продукта. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 0,91-0,97 (м, 2H), 1,12-1,27 (м, 4H), 1,61-1,75 (м, 5H), 3,08-3,16 (м, 2H), 7,22-7,24 (м, 1H), 7,71-7,75 (м, 1H), 7,87-7,92 (м, 1H), 8,23-8,27 (м, 1H), 8,38-8,41 (м, 1H). MS (ESI+) m/z 325 (M+H)+; (ESI-) m/z 323 (M-H)-.

Пример 327

N-(3-хлорбензил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-(3-хлорфенил)метанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,47-4,52 (м, 2H), 7,27-7,29 (м, 1H), 7,30-7,42 (м, 4H), 7,72-7,75 (м, 1H), 7,89-7,93 (м, 1H), 8,25-8,28 (м, 1H), 8,41-8,42 (м, 1H). MS (ESI+) m/z 353 (M+H)+; (ESI-) m/z 351 (M-H)-.

Пример 328

5-(1H-индазол-5-ил)-N-(2-метоксибензил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-(2-метоксифенил)метанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 3,82-3,86 (м, 3H), 4,45-4,50 (м, 2H), 6,92-6,97 (м, 1H), 7,01-7,04 (м, 1H), 7,19-7,24 (м, 1H), 7,26-7,31 (м, 2H), 7,69-7,77 (м, 1H), 7,88-7,93 (м, 1H), 8,24-8,28 (м, 1H), 8,38-8,44 (м, 1H). MS (ESI+) m/z 349 (M+H)+; (ESI-) m/z 347 (M-H)-.

Пример 329

5-(1H-индазол-5-ил)-N-[2-(трифторметил)бензил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-[2-(трифторметил)фенил]метанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,66-4,73 (м, 2H), 7,29-7,33 (м, 1H), 7,49-7,60 (м, 2H), 7,67-7,79 (м, 3H), 7,91-7,94 (м, 1H), 8,26-8,28 (м, 1H), 8,41-8,45 (м, 1H). MS (ESI+) m/z 387 (M+H)+; (ESI-) m/z 385 (M-H)-.

Пример 330

5-(1H-индазол-5-ил)-N-[3-(трифторметил)бензил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-[3-(трифторметил)фенил]метанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,57-4,61 (м, 2H), 7,28-7,31 (м, 1H), 7,59-7,77 (м, 5H), 7,90-7,94 (м, 1H), 8,27-8,28 (м, 1H), 8,40-8,43 (м, 1H). MS (ESI-) m/z 385 (M-H)-.

Пример 331

5-(1H-индазол-5-ил)-N-[4-(трифторметил)бензил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-[4-(трифторметил)фенил]метанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,55-4,60 (с, 2H), 7,27-7,30 (м, 1H), 7,54-7,59 (м, 2H), 7,70-7,76 (м, 3H), 7,88-7,94 (м, 1H), 8,24-8,28 (м, 1H), 8,40-8,44 (м, 1H). MS (ESI+) m/z 387 (M+H)+; (ESI-) m/z 385 (M-H)-.

Пример 332

5-(1H-индазол-5-ил)-N-(пиридин-2-илметил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-пиридин-2-илметанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,74-4,84 (с, 2H), 7,30-7,34 (м, 1H), 7,68-7,81 (м, 3H), 7,89-7,97 (м, 1H), 8,22-8,33 (м, 2H), 8,40-8,45 (м, 1H), 8,67-8,76 (м, 1H). MS (ESI+) m/z 320 (M+H)+; (ESI-) m/z 318 (M-H)-.

Пример 333

5-(1H-индазол-5-ил)-N-(пиридин-3-илметил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-пиридин-3-илметанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,61-4,68 (с, 2H), 7,27-7,31 (м, 1H), 7,70-7,75 (м, 1H), 7,83-7,94 (м, 2H), 8,24-8,28 (м, 1H), 8,31-8,37 (м, 1H), 8,40-8,44 (м, 1H), 8,69-8,74 (м, 1H), 8,77-8,82 (м, 1H). MS (ESI+) m/z 320 (M+H)+; (ESI-) m/z 318 (M-H)-.

Пример 334

5-(1H-индазол-5-ил)-N-(пиридин-4-илметил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-пиридин-4-илметанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,73-4,80 (с, 2H), 7,30-7,33 (м, 1H), 7,73-7,78 (м, 1H), 7,89-7,97 (м, 3H), 8,25-8,30 (м, 1H), 8,40-8,46 (м, 1H), 8,76-8,83 (м, 2H). MS (ESI-) m/z 318 (M-H)-.

Пример 335

N-(2-хлорбензил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-(2-хлорфенил)метанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,54-4,58 (с, 2H), 7,27-7,32 (м, 1H), 7,33-7,42 (м, 3H), 7,47-7,49 (м, 1H), 7,71-7,77 (м, 1H), 7,88-7,98 (м, 1H), 8,24-8,27 (м, 1H), 8,41-8,44 (м, 1H). MS (ESI+) m/z 353 (M+H)+; (ESI-) m/z 351 (M-H)-.

Пример 336

N-(4-хлорбензил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-(4-хлорфенил)метанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,42-4,49 (м, 2H), 7,22-7,31 (м, 1H), 7,34-7,49 (м, 4H), 7,70-7,76 (м, 1H), 7,84-7,92 (м, 1H), 8,17-8,30 (м, 1H), 8,35-8,47 (м, 1H). MS (ESI-) m/z 351 (M-H)-.

Пример 337

5-(1H-индазол-5-ил)-N-(1-фенил-2-пиперидин-1-илэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 1-фенил-2-пиперидин-1-илэтанамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,12 (д, 1H), 8,4 (с, 1H), 8,22 (с, 1H), 7,9 (д, 1H), 7,7 (д, 1H), 7,2-7,4 (м, 6H), 5,2 (м, 1H), 3,2 (м, 2H), 2,3 (м, 4H), 1,2-1,4 (м, 6H). MS (ESI+) m/z 416 (M+H)+.

Пример 338

N-[2-(1H-индазол-1-ил)-1-фенилэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 2-(1H-индазол-1-ил)-1-фенилэтанамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,5 (д, 1H), 8,4 (с, 1H), 8,22 (с, 1H), 7,78 (м, 1H), 7,52 (д, 2H), 7,72 (д, 2H), 7,2-7,4 (м, 5H), 6,85 (с, 1H), 5,44 (м, 1H), 4,44 (м, 2H). MS (ESI+) m/z 399 (M+H)+.

Пример 339

5-(1H-индазол-5-ил)-N-(2-морфолин-4-ил-1-фенилэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 2-морфолин-4-ил-1-фенилэтанамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,2 (д, 1H), 8,4 (с, 1H), 8,22 (с, 1H), 7,9 (д, 1H), 7,7 (д, 1H), 7,2-7,4 (м, 6H), 5,2 (м, 1H), 3,6 (м, 4H), 3,4 (м, 2H), 2,4 (м, 4H). MS (ESI+) m/z 418 (M+H)+.

Пример 340

5-(1H-индазол-5-ил)-N-[2-(4-метилпиперазин-1-ил)-1-фенилэтил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 2-(4-метилпиперазин-1-ил)-1-фенилэтанамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,6 (ушир.с, 1H), 9,14 (д, 1H), 8,4 (с, 1H), 8,22 (с, 1H), 7,9 (д, 1H), 7,7 (д, 1H), 7,2-7,4 (м, 6H), 5,2 (м, 1H), 3,2 (м, 2H), 2,4 (м, 4H), 2,2 (м, 4H), 2,1 (м, 3H). MS (ESI+) m/z 432 (M+H)+.

Пример 341

5-(1H-индазол-5-ил)-N-(1-фенил-2-пирролидин-1-илэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 1-фенил-2-пирролидин-1-илэтанамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,14 (д, 1H), 8,4 (с, 1H), 8,22 (с, 1H), 7,9 (д, 1H), 7,7 (д, 1H), 7,2-7,4 (м, 6H), 5,18 (м, 1H), 3,2 (м, 2H), 2,4 (м, 4H), 1,8 (м, 3H). MS (ESI+) m/z 402,5 (M+H)+.

Пример 342

трет-бутил 2-({[5-(1H-индазол-5-ил)изоксазол-3-ил]карбонил} амино)-2-фенилэтилкарбамат

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием трет-бутил 2-амино-2-фенилэтилкарбамата вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,14 (д, 1H), 8,4 (с, 1H), 8,22 (с, 1H), 7,9 (д, 1H), 7,7 (д, 1H), 7,2-7,4 (м, 6H), 7,00 (т, 1H), 5,18 (м, 1H), 3,2 (м, 2H), 1,4 (с, 9H). MS (ESI+) m/z 449 (M+H)+.

Пример 343

5-(1H-индазол-5-ил)-N-(1-нафтилметил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1-(1-нафтил)метанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 4,93-4,99 (м, 2H), 7,28-7,32 (м, 1H), 7,48-7,66 (м, 4H), 7,70-7,76 (м, 1H), 7,86-7,92 (м, 2H), 7,96-8,00 (м, 1H), 8,18-8,23 (м, 1H), 8,24-8,27 (м, 1H), 8,38-8,44 (м, 1H). MS (ESI-) m/z 367 (M-H)-.

Пример 344

5-(1H-индазол-5-ил)-N-(2-фенилэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 2-фенилэтанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,84-2,92 (т, 2H), 3,47-3,57 (т, 2H), 7,18-7,35 (м, 6H), 7,69-7,77 (м, 1H), 7,86-7,91 (м, 1H), 8,22-8,29 (м, 1H), 8,37-8,44 (м, 1H). MS (ESI+) m/z 333 (M+H)+; (ESI-) m/z 331 (M-H)-.

Пример 345

5-(1H-индазол-5-ил)-N-(2-пиридин-2-илэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 2-пиридин-2-илэтанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 3,22-3,29 (т, 2H), 3,71-3,75 (т, 2H), 7,14-7,26 (м, 1H), 7,70-7,75 (м, 1H), 7,81-7,94 (м, 3H), 8,23-8,29 (м, 1H), 8,35-8,44 (м, 2H), 8,71-8,83 (м, 1H). MS (ESI+) m/z 334 (M+H)+; (ESI-) m/z 332 (M-H)-.

Пример 346

5-(1H-индазол-5-ил)-N-(2-пиридин-3-илэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 2-пиридин-3-илэтанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 3,01-3,13 (т, 2H), 3,55-3,70 (т, 2H), 7,14-7,26 (м, 1H), 7,70-7,77 (м, 1H), 7,84-7,95 (м, 2H), 8,25-8,29 (м, 1H), 8,36-8,45 (м, 2H), 8,69-8,75 (м, 1H), 8,77-8,84 (м, 1H). MS (ESI+) m/z 334 (M+H)+; (ESI-) m/z 332 (M-H)-.

Пример 347

5-(1H-индазол-5-ил)-N-(2-пиридин-4-илэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 2-пиридин-4-илэтанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 3,12-3,23 (т, 2H), 3,67-3,71 (т, 2H), 7,20-7,21 (м, 1H), 7,69-7,76 (м, 1H), 7,86-7,91 (м, 3H), 8,25-8,27 (м, 1H), 8,38-8,41 (м, 1H), 8,70-8,77 (м, 2H). MS (ESI+) m/z 334 (M+H)+; (ESI-) m/z 332 (M-H)-.

Пример 348

N-[2-(2-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 2-(2-хлорфенил)этанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,99-3,05 (т, 2H), 3,54-3,61 (т, 2H), 7,21-7,23 (м, 1H), 7,26-7,33 (м, 2H), 7,35-7,40 (м, 1H), 7,41-7,47 (м, 1H), 7,70-7,75 (м, 1H), 7,87-7,93 (м, 1H), 8,23-8,31 (м, 1H), 8,37-8,44 (м, 1H). MS (ESI+) m/z 367 (M+H)+; (ESI-) m/z 365 (M-H)-.

Пример 349

N-[2-(3-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 2-(3-хлорфенил)этанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,89 (т, 2H), 3,54 (т, 2H), 7,19-7,42 (м, 5H), 7,69-7,77 (м, 1H), 7,86-7,94 (м, 1H), 8,22-8,29 (м, 1H), 8,38-8,42 (м, 1H). MS (ESI-) m/z 365 (M-H)-.

Пример 350

N-[2-(4-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 2-(4-хлорфенил)этанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,86 (т, 2H), 3,50 (т, 2H), 7,17-7,24 (м, 1H), 7,27-7,41 (м, 4H), 7,71-7,76 (м, 1H), 7,85-7,91 (м, 1H), 8,21-8,29 (м, 1H), 8,34-8,44 (м, 1H). MS (ESI-) m/z 365 (M-H)-.

Пример 351

N-бензил-N-этил-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали N-бензил-N-этиламин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,06-1,19 (м, 3H), 3,37-3,49 (м, 2H), 4,69-4,76 (м, 2H), 7,21-7,28 (м, 1H), 7,28-7,49 (м, 5H), 7,69-7,78 (м, 1H), 7,83-7,97 (м, 1H), 8,24-8,32 (м, 1H), 8,36-8,46 (м, 1H). MS (ESI+) m/z 347 (M+H)+; (ESI-) m/z 345 (M-H)-.

Пример 352

5-(1H-индазол-5-ил)-N-метил-N-(1-нафтилметил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали N-метил-N-(1-нафтилметил)амин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 3,04-3,11 (м, 3H), 5,20-5,35 (м, 2H), 7,20-7,31 (м, 1H), 7,33-7,66 (м, 4H), 7,66-7,77 (м, 1H), 7,81-8,18 (м, 4H), 8,20-8,28 (м, 1H), 8,31-8,45 (м, 1H). MS (ESI+) m/z 383 (M+H)+; (ESI-) m/z 381 (M-H)-.

Пример 353

5-(1H-индазол-5-ил)-N-метил-N-(2-фенилэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали N-метил-N-(2-фенилэтил)амин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,86-2,97 (м, 2H), 3,06-3,13 (м, 3H), 3,70-3,74 (м, 2H), 6,64-7,39 (м, 6H), 7,69-7,92 (м, 2H), 8,24-8,44 (м, 2H). MS (ESI+) m/z 347 (M+H)+; (ESI-) m/z 345 (M-H)-.

Пример 354

5-(1H-индазол-5-ил)-N-метил-N-(2-пиридин-2-илэтил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали N-метил-N-(2-пиридин-2-илэтил)амин вместо 1-циклогексилметанамин. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 3,07-3,22 (м, 3H), 3,26-3,39 (м, 2H), 3,92-4,04 (м, 2H), 6,85-7,14 (м, 1H), 7,65-8,05 (м, 4H), 8,23-8,56 (м, 3H), 8,65-8,86 (м, 1H). MS (ESI+) m/z 348 (M+H)+; (ESI-) m/z 346 (M-H)-.

Пример 355

5-(1H-индазол-5-ил)-N-[(1R)-1-фенилэтил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали (1R)-1-фенилэтанамин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,49-1,54 (м, 3H), 5,12-5,20 (м, 1H), 7,23-7,29 (м, 2H), 7,33-7,46 (м, 4H), 7,71-7,75 (м, 1H), 7,87-7,91 (м, 1H), 8,22-8,28 (м, 1H), 8,37-8,42 (м, 1H). MS (ESI+) m/z 333 (M+H)+; (ESI-) m/z 331 (M-H)-.

Пример 356

5-(1H-индазол-5-ил)-N-1,2,3,4-тетрагидронафталин-1- илизоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 326, за исключением того, что использовали 1,2,3,4-тетрагидронафталин-1-амин вместо 1-циклогексилметанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,72-2,09 (м, 4H), 2,68-2,85 (м, 2H), 5,19-5,26 (м, 1H), 7,12-7,24 (м, 4H), 7,29-7,35 (м, 1H), 7,69-7,77 (м, 1H), 7,86-7,93 (м, 1H), 8,25-8,30 (м, 1H), 8,38-8,43 (м, 1H). MS (ESI-) m/z 357 (M-H)-.

Пример 357

5-(1H-индазол-5-ил)-N-[(1S)-1-(1-нафтил)этил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (1S)-1-(1-нафтил)этанамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,4 (д, 1H), 8,4 (с, 1H), 8,25 (с, 1H), 8,22 (ушир.с, 1H), 7,95 (д, 1H), 7,85 (м, 2H), 7,65 (м, 2H), 7,5 (м, 3H), 7,3 (с, 1H), 5,9 (м, 1H), 1,65 (д, 3H). MS (ESI+) m/z 382,9 (M+H)+.

Пример 358

5-(1H-индазол-5-ил)-N-[(1R)-1-(1-нафтил)этил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (1R)-1-(1-нафтил)этанамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,4 (д, 1H), 8,4 (с, 1H), 8,25 (с, 1H), 8,22 (ушир.с, 1H), 7,95 (д, 1H), 7,85 (м, 2H), 7,65 (м, 2H), 7,5 (м, 3H), 7,3 (с, 1H), 5,9 (м, 1H), 1,65 (д, 3H). MS (ESI+) m/z 382,9 (M+H)+.

Пример 359

N-[3-(диметиламино)-1-фенилпропил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием N3,N3-диметил-1-фенилпропан-1,3-диамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,4 (д, 1H), 8,4 (с, 1H), 8,25 (с, 1H), 7,92 (м, 1H), 7,7 (м, 1H), 7,3-7,5 (м, 6H), 5,15 (м, 1H), 3,2 (м, 2H), 7,75 (с, 6H), 2,35 (м, 1H), 2,15 (м, 1H). MS (ESI+) m/z 390 (M+H)+.

Пример 360

Ν-(2,3-дигидро-1,4-бензодиоксин-5-илметил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 1-(2,3-дигидро-1,4-бензодиоксин-5-ил)метанамина вместо пиперидина. 1H ЯМР (SOO МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,24 (т, 1H), 8,4 (с, 1H), 8,25 (с, 1H), 7,92 (д, 1H), 7,7 (д, 1H), 7,24 (с, 1H), 6,9 (м, 3H), 4,4 (д, 2H), 4,3 (д, 2H), 4,25 (д, 2H). MS (ESI+) m/z 377 (M+H)+.

Пример 361

N-(3,4-дигидро-2H-1,5-бензодиоксепин-6-илметил)-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 1-(3,4-дигидро-2H-1,5-бензодиоксепин-6-ил)метанамина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,2 (т, 1H), 8,4 (с, 1H), 8,25 (с, 1H), 7,92 (д, 1H), 7,7 (д, 1H), 7,24 (с, 1H), 6,9 (м, 3H), 4,42 (д, 2H), 4,15 (м, 4H), 2,2 (м, 2H). MS (ESI+) m/z 391 (M+H)+.

Пример 362

5-(1H-индазол-5-ил)-N-[(1-метил-1H-индол-4-ил)метил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием (1-метил-1H-индол-4-ил)метиламина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 9,24 (т, 1H), 8,4 (с, 1H), 8,25 (с, 1H), 7,92 (д, 1H), 7,7 (д, 1H), 7,38 (м, 3H), 7,18 (м, 1H), 7,0 (д, 1H), 6,6 (с, 1H), 4,7 (д, 2H), 3,8 (с, 3H). MS (ESI+) m/z 372 (M+H)+.

Пример 363

5-{3-[(3-фенилпирролидин-1-ил)карбонил]изоксазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 3-фенилпирролидина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 8,4 (м, 1H), 8,25 (с, 1H), 7,92 (д, 1H), 7,8 (д, 1H), 7,24 (м, 6H), 4,4 (м, 1H), 3,4 (м, 2H), 2,4 (м, 2H), 2,0 (м, 2H). MS (ESI+) m/z 359 (M+H)+.

Пример 364

5-{3-[(2-фенилпирролидин-1-ил)карбонил]изоксазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 2-фенилпирролидина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 8,4 (м, 1H), 8,25 (с, 1H), 7,92 (д, 1H), 7,8 (д, 1H), 7,24 (м, 6H), 5,6 (м, 0,3H), 5,2 (м, 0,7H), 4,0 (м, 2H), 1,8-2,0 (м, 4H). MS (ESI+) m/z 390 (M+H)+.

Пример 365

5-{3-[(2-фенилпиперидин-1-ил)карбонил]изоксазол-5-ил}-1H-индазол

Указанное в заголовке соединение получали в соответствии с процедурой, описанной в Примере 81B, с использованием 2-фенилпиперидина вместо пиперидина. 1H ЯМР (300 МГц, ДМСО-d6) δ м.д. 13,4 (ушир.с, 1H), 8,4 (м, 1H), 8,25 (с, 1H), 7,92 (д, 1H), 7,8 (д, 1H), 7,24 (м, 6H), 5,6 (м, 0,3H), 5,2 (м, 0,7H), 4,0 (м, 2H), 1,8-2,0 (м, 6H). MS (ESI+) m/z 373 (M+H)+.

Пример 366

5-(1H-индазол-5-ил)-N-[(1S)-1-фенилэтил]изоксазол-3-карбоксамид

5-(1H-Индазол-5-ил)изоксазол-3-карбоновую кислоту (36 мг, 0,16 ммоль, Пример 71A) растворяли в N,N-диметилформамиде (1,0 мл) с последующим добавлением HATU (60 мг, 0,16 ммоль), растворенного в N,N-диметилформамиде (0,5 мл). Затем добавляли раствор (S)-1-фенилэтанамина (22 мг, 0,18 ммоль), растворенного в N,N-диметилформамиде (0,6 мл) с последующим добавлением диизопропилэтиламина (56 мкл, 0,32 ммоль), растворенного в N,N-диметилформамиде (0,2 мл). Полученную смесь встряхивали в течение 3 часов при 40°C. Реакционную смесь фильтровали, контролировали методом ЖХ/МС и концентрировали досуха. Остатки растворяли в смеси 1:1 диметилсульфоксид/метанол и очищали при помощи обращенно-фазовой ВЭЖХ (колонка Phenomenex® Luna® C8(2) 5 мкм 100Å AXIA™ (30 мм × 75 мм), 50 мл/мин, 10-100% ацетонитрила/0,1% трифторуксусной кислоты в воде) с получением указанного в заголовке продукта. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,50 (д, 3H), 5,06-5,22 (м, 1H), 7,23-7,29 (м, 2H), 7,34-7,38 (м, 2H), 7,40-7,45 (м, 2H), 7,70-7,75 (м, 1H), 7,87-7,92 (м, 1H), 8,25-8,27 (м, 1H), 8,39-8,41 (м, 1H), 9,28 (д, 1H). MS (ESI+) m/z 333 (M+H)+; (ESI-) m/z 331 (M-H)-.

Пример 367

5-(1H-индазол-5-ил)-Ν-[(1R)-1-(4-метилфенил)этил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1R)-1-(4-метилфенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,49 (д, 3H), 2,25-2,31 (м, 3H), 5,09-5,18 (м, 1H), 7,14-7,18 (м, 2H), 7,23-7,24 (м, 1H), 7,28-7,32 (м, 2H), 7,70-7,75 (м, 1H), 7,86-7,92 (м, 1H), 8,22-8,29 (м, 1H), 8,37-8,42 (м, 1H), 9,19 (д, 1H). MS (ESI+) m/z 347 (M+H)+; (ESI-) 345 (M-H)-.

Пример 368

5-(1H-индазол-5-ил)-N-[(1S)-1-(4-метилфенил)этил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1S)-1-(4-метилфенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,48 (д, 3H), 2,26-2,30 (м, 3H), 5,05-5,23 (м, 1H), 7,15-7,17 (м, 2H), 7,22-7,25 (м, 1H), 7,28-7,32 (м, 2H), 7,67-7,79 (м, 1H), 7,86-7,93 (м, 1H), 8,22-8,30 (м, 1H), 8,38-8,41 (м, 1H), 9,21 (д, 1H). MS (ESI-) m/z 345(M-H)-.

Пример 369

N-[(1R,2S)-2-гидрокси-2,3-дигидро-1H-инден-1-ил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1R,2S)-1-аминоиндан-2-ол вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,89-2,96 (м, 1H), 3,13-3,21 (м, 1H), 4,55-4,61 (м, 1H), 5,40-5,47 (м, 1H), 7,21-7,34 (м, 4H), 7,39-7,42 (м, 1H), 7,72-7,77 (м, 1H), 7,91-7,95 (м, 1H), 8,25-8,29 (м, 1H), 8,42-8,45 (м, 1H). MS (ESI-) m/z 359 (M-H)-.

Пример 370

N-[(1R,2R)-2-гидрокси-2,3-дигидро-1H-инден-1-ил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1R,2R)-1-аминоиндан-2-ол вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,72-2,83 (м, 1H), 3,13-3,30 (м, 1H), 4,44-4,53 (м, 1H), 5,24-5,32 (м, 1H), 7,10-7,18 (м, 1H), 7,20-7,27 (м, 3H), 7,30-7,33 (м, 1H), 7,72-7,78 (м, 1H), 7,91-7,93 (м, 1H), 8,24-8,29 (м, 1H), 8,41-8,45 (м, 1H), 9,17 (д, 1H). MS (ESI-) m/z 359 (M-H)-.

Пример 371

N-[(1R)-1-(4-бромфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1R)-1-(4-бромфенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,50 (д, 3H), 5,08-5,18 (м, 1H), 7,21-7,27 (м, 1H), 7,36-7,41 (м, 2H), 7,50-7,59 (м, 2H), 7,70-7,76 (м, 1H), 7,86-7,93 (м, 1H), 8,23-8,29 (м, 1H), 8,38-8,41 (м, 1H), 9,32 (д, 1H). MS (ESI+) m/z 411 (M+H)+.

Пример 372

N-[(1S)-1-(4-бромфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (lS)-1-(4-бромфенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,49 (д, 3H), 5,09-5,19 (м, 1H), 7,23-7,25 (м, 1H), 7,37-7,40 (м, 2H), 7,53-7,57 (м, 2H), 7,71-7,75 (м, 1H), 7,87-7,92 (м, 1H), 8,25-8,27 (м, 1H), 8,38-8,41 (м, 1H), 9,32 (д, 1H). MS (ESI) отрицательный ион 409 (M-H)-.

Пример 373

N-[(1R)-1-(4-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1R)-1-(4-хлорфенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,50 (д, 3H), 5,10-5,21 (м, 1H), 7,22-7,26 (м, 1H), 7,38-7,47 (м, 4H), 7,70-7,75 (м, 1H), 7,87-7,92 (м, 1H), 8,20-8,28 (м, 1H), 8,38-8,41 (м, 1H), 9,33 (д, 1H). MS (ESI-) m/z 365 (M-H)-.

Пример 374

N-[(1S)-1-(4-хлорфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1S)-1-(4-хлорфенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,49 (д, 3H), 5,12-5,19 (м, 1H), 7,23-7,25 (м, 1H), 7,39-7,47 (м, 4H), 7,71-7,74 (м, 1H), 7,87-7,91 (м, 1H), 8,25-8,27 (м, 1H), 8,37-8,43 (м, 1H), 9,32 (д, 1H). MS (ESI-) m/z 365 (M-H)-.

Пример 375

5-(1H-индазол-5-ил)-N-[(1S)-1-(2-нафтил)этил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1S)-1-(2-нафтил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,61 (д, 3H), 5,30-5,38 (м, 1H), 7,25-7,26 (м, 1H), 7,48-7,55 (м, 2H), 7,60-7,63 (м, 1H), 7,72-7,75 (м, 1H), 7,88-7,95 (м, 5H), 8,25-8,28 (м, 1H), 8,39-8,43 (м, 1H), 9,39 (д, 1H). MS (ESI-) m/z 381 (M-H)-.

Пример 376

N-[1-(4-этоксифенил)-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали 2-амино-2-(4-этоксифенил)этанол вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,32 (т, 3H), 3,62-3,67 (м, 1H), 3,70-3,73 (м, 1H), 3,96-4,06 (м, 2H), 4,98-5,06 (м, 1H), 6,87-6,91 (м, 2H), 7,23-7,36 (м, 3H), 7,70-7,75 (м, 1H), 7,88-7,91 (м, 1H), 8,25-8,27 (м, 1H), 8,39-8,42 (м, 1H). MS (ESI-) m/z 391 (M-H)-.

Пример 377

N-[2-гидрокси-1-(4-изопропилфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали 2-амино-2-(4-изопропилфенил)этанол вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,18 (д, 6H), 2,81-2,91 (м, 1H), 3,65-3,70 (м, 1H), 3,72-3,74 (м, 1H), 5,01-5,09 (м, 1H), 7,20-7,28 (м, 3H), 7,29-7,35 (м, 2H), 7,72-7,80 (м, 1H), 7,87-7,95 (м, 1H), 8,24-8,29 (м, 1H), 8,38-8,44 (м, 1H). MS (ESI-) m/z 389 (M-H)-.

Пример 378

N-[1-(3,4-диметилфенил)-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали 2-амино-2-(3,4-диметилфенил)этанол вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,30 (д, 6H), 3,56-3,63 (м, 1H), 3,65-3,73 (м, 1H), 5,32-5,42 (м, 1H), 7,06-7,08 (м, 2H), 7,23-7,28 (м, 2H), 7,69-7,76 (м, 1H), 7,87-7,95 (м, 1H), 8,25-8,28 (м, 1H), 8,39-8,43 (м, 1H). MS (ESI-) m/z 375 (M-H)-.

Пример 379

N-[2-гидрокси-1-(2-метоксифенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали 2-амино-2-(2-метоксифенил)этанол вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 3,60-3,66 (м, 2H), 3,84-3,88 (м, 3H), 5,37-5,48 (м, 1H), 6,95 (т, 1H), 7,00-7,06 (м, 1H), 7,24-7,31 (м, 2H), 7,32-7,36 (м, 1H), 7,71-7,77 (м, 1H), 7,85-7,97 (м, 1H), 8,24-8,28 (м, 1H), 8,40-8,45 (м, 1H). MS (ESI+) m/z 379 (M+H)+; отрицательный ион 377 (M-H)-.

Пример 380

N-[2-гидрокси-1-(4-метилфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали 2-амино-2-(4-метилфенил)этанол вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 2,26-2,32 (м, 3H), 3,65-3,70 (м, 1H), 3,72-3,75 (м, 1H), 5,01-5,08 (м, 1H), 7,10-7,21 (м, 2H), 7,25-7,35 (м, 3H), 7,70-7,77 (м, 1H), 7,86-7,95 (м, 1H), 8,26-8,28 (м, 1H), 8,39-8,46 (м, 1H). MS (ESI+) m/z 363 (M+H)+; (ESI-) m/z 361 (M-H)-.

Пример 381

5-(1H-индазол-5-ил)-N-[(1R)-1-(2-метоксифенил)этил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1R)-1-(2-метоксифенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,43 (д, 3H), 3,82-3,86 (м, 3H), 5,41-5,50 (м, 1H), 6,95 (т, 1H), 7,00-7,05 (м, 1H), 7,23-7,29 (м, 2H), 7,35-7,39 (м, 1H), 7,71-7,76 (м, 1H), 7,88-7,92 (м, 1H), 8,25-8,27 (м, 1H), 8,37-8,43 (м, 1H). MS (ESI+) m/z 363 (M+H)+; (ESI-) m/z 361 (M-H)-.

Пример 382

N-[(1S)-1-(3,4-дифторфенил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1S)-1-(3,4-дифторфенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,50 (д, 3H), 5,09-5,24 (м, 1H), 7,21-7,30 (м, 2H), 7,35-7,44 (м, 1H), 7,44-7,53 (м, 1H), 7,68-7,82 (м, 1H), 7,86-7,94 (м, 1H), 8,26-8,27 (м, 1H), 8,39-8,42 (м, 1H). MS (ESI-) m/z 367 (M-H)-.

Пример 383

5-(1H-индазол-5-ил)-N-[(1R)-1-(3-метоксифенил)этил]изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1R)-1-(3-метоксифенил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,50 (д, 3H), 3,75-3,77 (м, 3H), 5,01-5,19 (м, 1H), 6,80-6,87 (м, 1H), 6,97-7,02 (м, 2H), 7,21-7,32 (м, 2H), 7,70-7,75 (м, 1H), 7,87-7,95 (м, 1H), 8,22-8,31 (м, 1H), 8,37-8,43 (м, 1H). MS (ESI-) m/z 361 (M-H)-.

Пример 384

5-(1H-индазол-5-ил)-N-{(1R)-1-[3-(трифторметил)фенил]этил} изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали (1R)-1-[3-(трифторметил)фенил]этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,54 (д, 3H), 5,22-5,29 (м, 1H), 7,23-7,27 (м, 1H), 7,58-7,69 (м, 2H), 7,71-7,75 (м, 2H), 7,77-7,83 (м, 1H), 7,87-7,92 (м, 1H), 8,24-8,29 (м, 1H), 8,38-8,42 (м, 1H). MS (ESI-) m/z 399 (M-H)-.

Пример 385

N-[1-(2,3-дигидро-1,4-бензодиоксин-6-ил)этил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали 1-(2,3-дигидро-1,4-бензодиоксин-6-ил)этанамин вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 1,46 (д, 3H), 4,18-4,25 (м, 4H), 5,01-5,10 (м, 1H), 6,80-6,95 (м, 3H), 7,22-7,24 (м, 1H), 7,70-7,74 (м, 1H), 7,87-7,91 (м, 1H), 8,26-8,27 (м, 1H), 8,39-8,41 (м, 1H). MS (ESI-) m/z 389 (M-H)-.

Пример 386

N-[1-(3,5-дихлорфенил)-2-гидроксиэтил]-5-(1H-индазол-5-ил)изоксазол-3-карбоксамид

Указанное в заголовке соединение получали, с использованием процедуры, описанной в Примере 366, за исключением того, что использовали 2-амино-2-(3,5-дихлорфенил)этанол вместо (S)-1-фенилэтанамина. 1H ЯМР (500 МГц, ДМСО-d6/D2O) δ м.д. 3,68-3,72 (м, 1H), 3,76-3,78 (м, 1H), 5,02-5,10 (м, 1H), 7,26-7,29 (м, 1H), 7,47-7,52 (м, 3H), 7,72-7,75 (м, 1H), 7,89-7,93 (м, 1H), 8,25-8,28 (м, 1H), 8,39-8,44 (м, 1H). MS (ESI-) m/z 415 (M-H)-.

Пример 387

трет-бутил 5-(1-бензил-1H-1,2,3-триазол-4-ил)-3-[({[6-(трифторметил)пиридин-2-ил]амино}карбонил)амино]-1H-индазол-1-карбоксилат

Раствор трифосгена в дихлорметане охлаждали до 0°C в атмосфере азота. Затем медленно по каплям добавляли смесь триэтиламина (0,426 мл, 3,07 ммоль) и соединения Примера 64A (150 мг, 0,384 ммоль) в дихлорметане (2 мл). Полученную смесь перемешивали при комнатной температуре в течение 1 часа. Затем добавляли 6-(трифторметил)пиридин-2-амин (62,3 мг, 0,384 ммоль) с последующим перемешиванием в течение ночи при комнатной температуре. Осадок отфильтровывали и промывали дихлорметаном и водой. Продукт сушили в условиях вакуума с получением указанного в заголовке соединения. MS m/z 579,3 (M+Η)+.

Пример 388

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1-[(1-метилпиперидин-2-ил)карбонил]-1H-индазол-3-амин

Гидрохлорид 1-метилпиперидин-3-карбоновой кислоты объединяли со смесью диметилформамида и дихлорметана в атмосфере азота и перемешивали в течение 15 минут. Затем добавляли по порциям карбонилдиимидазол. Полученный раствор перемешивали при комнатной температуре в течение 1 часа. Затем добавляли соединение Примера 62 с последующим добавлением перемешиванием при 60°C в течение 2 часов и затем при комнатной температуре в течение ночи. Реакционную смесь выливали в ледяную водау и добавляли насыщенный солевой раствор. Охлажденный раствор декантировали и остаток поглощали в дихлорметан и промывали водой (2×). Органический слой сушили при помощи сульфата магния и летучие вещества удаляли при пониженном давлении. Декантированный раствор экстрагировали этилацетатом (3×). Объединенные органические слои промывали насыщенным солевым раствором (2×), сушили при помощи сульфата магния и концентрировали. Остаток поглощали в небольшое количество ацетона и затем добавляли по каплям в дистиллированную воду. Осадок собирали фильтрованием, промывали водой и сушили с получением указанного в заголовке соединения. MS m/z 579,3 (M+Η)+.

Пример 389

5-(1-бензил-1H-1,2,3-триазол-4-ил)-1-[(диметиламино)-ацетил]-1H-индазол-3-амин

2-(Диметиламино)уксусную кислоту растворяли в диметилформамиде и пиридине в атмосфере азота при комнатной температуре в течение 15 минут. Добавляли по порциям карбонилдиимидазол. Полученную смесь перемешивали при комнатной температуре в течение 1 часа. Затем добавляли соединение Примера 62 и смесь перемешивали в течение ночи при комнатной температуре. Летучее вещество удаляли при пониженном давлении и остаток добавляли в ледяную воду. Добавляли хлорид натрия, и происходило осаждение густого масла из охлажденного раствора. Раствор декантировали. Остаток промывали водой (3×) и затем сушили. Из декантированного раствора в течение ночи происходило выделение осадка из смеси вода/диметилформамид. Оказалось, что это исходное вещество, которое отфильтровывали и сливали. Остаток, содержащий продукт, кристаллизовали в дихлорметане, собирали фильтрованием, промывали небольшим количеством дихлорметана и простого эфира. Продукт сушили с получением указанного в заголовке соединения. MS m/z 376,3 (M+Η)+.

Пример 390

трет-бутил 3-амино-5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-1-карбоксилат

Пример 62 суспендировали в дихлорметане вместе с каталитическим количеством диметиламинопиридина. Добавляли раствор ди-трет-бутилдикарбоната в дихлорметане (160 мл) в течение 1 часа. Реакционную смесь перемешивали приблизительно в течение 40 часов. Добавляли силикагель и смесь концентрировали. Эту содержащую диоксид кремния смесь вносили в колонку с силикагелем и вещество элюировали сначала дихлорметаном, а затем смесью 1% метанола/дихлорметан и в завершение смесью 2% метанола/дихлорметан. Фракции, содержащие желаемый продукт, объединяли и концентрировали с получением указанного в заголовке соединения. MS m/z 391,3 (M+Η)+.

Пример 391

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-пиперидин-1-илацетамид

2-(Пиперидин-1-ил)уксусную кислоту объединяли с диметилформамидом и пиридином. Смесь перемешивали в течение 15 минут при комнатной температуре и затем добавляли по порциям карбонилдиимидазол. Продолжали перемешивание при комнатной температуре в течение 1 часа и затем добавляли соединение Примера 64A, продолжая перемешивание в течение 24 часов. Реакционную смесь нагревали до 60°C в течение 14 часов. Получали небольшое количество указанного в заголовке соединения. MS m/z 416,3 (M+Η)+.

Пример 392

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-2-морфолин-4-илацетамид

2-Морфолиноуксусную кислоту объединяли с диметилформамидом и пиридином. Смесь перемешивали в течение 15 минут при комнатной температуре затем добавляли по порциям карбонилдиимидазол. Продолжали перемешивание при комнатной температуре в течение 1 часа и затем добавляли соединение Примера 64A, продолжая перемешивание в течение 28 часов. Реакционную смесь нагревали до 60°C в течение 4 часов и затем продолжали перемешивание в течение ночи при комнатной температуре. Реакционную смесь снова нагревали до 60°C в течение 7 часов. Получали небольшое количество указанного в заголовке соединения. MS m/z 418,3 (M+Η)+.

Пример 393

N-[5-(1-бензил-1H-1,2,3-триазол-4-ил)-1H-индазол-3-ил]-1-метилпиперидин-2-карбоксамид

Гидрохлорид 1-метилпиперидин-3-карбоновой кислоты объединяли с диметилформамидом и пиридином. Смесь перемешивали в течение 15 минут при комнатной температуре и затем добавляли по порциям карбонилдиимидазол. Продолжали перемешивание при комнатной температуре в течение 1 часа и затем добавляли соединение Примера 64A, продолжая перемешивание в течение 28 часов. Реакционную смесь нагревали до 60°C в течение 4,25 часов и затем продолжали перемешивание в течение ночи при комнатной температуре. Реакционную смесь снова нагревали до 60°C в течение 7 часов. Получали небольшое количество указанного в заголовке соединения. MS m/z 416,3 (M+H)+.

Биологические данные

Анализ ингибирования ROCK-2

Соединения формулы (I) испытывали на их способность ингибировать His6-меченный по N-концу рекомбинантный человеческий ROCK-2, остатки 11-552, экспрессируемый бакуловирусом в Sf21 клетках (Upstate). В 384-луночных, имеющих v-образное дно полипропиленовых планшетах (Axygen) 1 нМ (конечная концентрация) в 10 мкл рекомбинантного His6-меченного по N-концу рекомбинантного человеческого ROCK-2, остатки 11-552, экспрессируемого бакуловирусом в Sf21 клетках (Upstate), смешивали с 2 мкМ (конечная концентрация) в 10 мкл биотинилированного пептидного субстрата (биотин-Aha-KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK (SEQ ID NO:I)) (Genemed) и различными концентрациями ингибитора (2% DMSO конечная концентрация) в реакционном буфере (25 мМ HEPES, pH 7,5, 0,5 мМ DTT, 10 мМ MgCl2, 100 мкМ Na3VO4, 0,075 мг/мл Triton X-100) и реакцию инициировали путем добавления 5 мкМ немеченного АТФ, содержащего 0,01 мкКи [33P]-АТФ (Perkin Elmer). Реакцию гасили через 1 час путем добавления 50 мкл стоп-буфера (50 мМ EDTA, 2M NaCl конечная концентрация). 80 мкл реакционных смесей после остановки реакции переносили в 384-луночные покрытые стрептавидином планшеты FlashPlates (Perkin Elmer), инкубировали в течение 10 минут при комнатной температуре, промывали 3 раза при помощи 0,05% Tween-20/PBS, с использованием автоматического устройства для промывки планшетов ELX-405 (BioTek) и подсчитывали с использованием сцинтилляционного устройства для считывания планшетов TopCount (Packard).

Анализ ингибирования ROCK-1

Соединения формулы (I) испытывали на их способность ингибировать His6-меченный по N-концу рекомбинантный человеческий ROCK-1, аминокислоты 17-535, экспрессируемый бакуловирусом в Sf21 клетках (Upstate). В 384-луночных, имеющих v-образное дно полипропиленовых планшетах (Axygen) 2 нМ (конечная концентрация) в 10 мкл рекомбинантного His6-меченного по N-концу рекомбинантного человеческого ROCK-1, аминокислоты 17-535, экспрессируемого бакуловирусом в Sf21 клетках (Upstate), смешивали с 2 мкМ (конечная концентрация) биотинилированного пептидного субстрата (биотин-Aha-VRRLRRLTAREAA (SEQ ID NO:2)) (Genemed) и различными концентрациями ингибитора (2% DMSO конечная концентрация) в 10 мкл реакционного буфера (25 мМ HEPES, pH 7,5, 0,5 мМ DTT, 10 мМ MgCl2, 100 мкМ Na3VO4, 0,075 мг/мл Triton X-100) и реакцию инициировали путем добавления 5 мкМ немеченного АТФ, содержащего 0,01 мкКи [33P]-АТФ (Perkin Elmer). Реакцию гасили через 1 час путем добавления 50 мкл стоп-буфера (50 мМ EDTA, 2M NaCl конечная концентрация). 80 мкл реакционных смесей после остановки реакции переносили в 384-луночные покрытые стрептавидином планшеты FlashPlates (Perkin Elmer), инкубировали в течение 10 минут при комнатной температуре, промывали 3 раза при помощи 0,05% Tween-20/PBS, с использованием автоматического устройства для промывки планшетов ELX-405 (BioTek) и подсчитывали с использованием сцинтилляционного устройства для считывания планшетов TopCount (Packard).

Анализ ингибирования GSK

Соединения формулы (I) испытывали на их способность ингибировать His6-меченный по N-концу GSK-3, экспрессируемый бакуловирусом в Sf21 клетках (Upstate). В 384-луночных, имеющих v-образное дно полипропиленовых планшетах (Axygen) 10 мкл рекомбинантного His-меченного по N-концу GSK3, экспрессируемого бакуловирусом в Sf21 клетках (Upstate), смешивали с 10 мкл биотинилированного пептидного субстрата (биотин-ahx-YRRAAVPPSPSLSRHSSPHQS(p)EDEEE (SEQ ID NO:3)), 2 мкМ конечная концентрация (Genemed), и различными концентрациями ингибитора (2% DMSO конечная концентрация) в реакционном буфере (20 мМ HEPES, pH 7,5, 1 мМ DTT, 10 мМ MgCl2 100 мкМ Na3VO4, 0,075 мг/мл Triton X-100) и реакцию инициировали путем добавления 20 мкМ [33P]-АТФ, 5 мкМ конечная концентрация, 2 мКи/ мкмоль (Perkin Elmer). Реакцию гасили через 1 час путем добавления 50 мкл стоп-буфера (50 мМ EDTA, 2M NaCl конечная концентрация). 80 мкл реакционных смесей после остановки реакции переносили в 384-луночные покрытые стрептавидином планшеты FlashPlates (Perkin Elmer), инкубировали в течение 10 минут при комнатной температуре, промывали 3 раза при помощи 0,05% Tween-20/PBS, с использованием автоматического устройства для промывки планшетов ELX-405 (BioTek) и подсчитывали с использованием сцинтилляционного устройства для считывания планшетов TopCount (Packard).

Анализ ингибирования GSK-3β человека

Соединения испытывали на их способность ингибировать человеческую гликогенсинтаза-киназу-3 бета (hGSK-3β), что касается ее способности фосфорилировать биотин-YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE. Соединения инкубировали с 0,5 мкКи 33P-АТФ, 10 мкМ АТФ, 0,0125U hGSK-3β (растворы для определения клеточной сигнальной активности от Upstate) и 1 мкМ субстрата (биотин-YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE (SEQ ID NO:3)) в 50 мМ HEPES, 10 мМ MgCl2, 100 мкМ Na3VO4, 1 мМ DTT, 0,0075% Triton, 2% ДМСО (общий объем 50 мкл) в течение 30 минут при комнатной температуре. Инкубацию останавливали путем добавления равного объема 100 мМ EDTA, 4 M NaCl2. 80 мкл этой смеси добавляли в покрытые стрептавидином планшеты FlashPlates (PerkinElmer). После стадии промывки, 33P включение определяли с использованием жидкостного сцинтилляционного счетчика для микропланшетов MicroBeta (PerkinElmer). Значения ИК50 определяли путем подгонки сигмоидальной кривой доза-ответ к счету при различных концентрациях в GraphPad Prism.

Анализ ингибирования GSK-3α человека

Соединения испытывали на их способность ингибировать человеческую гликогенсинтаза-киназу-3 альфа (hGSK-3α), 0,5 нМ конечная концентрация, в отношении фосфорилирования биотин-YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE (SEQ ID NO:3). Соединения инкубировали с 0,5 Ки 33P-АТФ, 10 M АТФ, 0,0125U hGSK-3 (растворы для определения клеточной сигнальной активности от Upstate) и 2 мкМ субстрата (биотин-YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE) в 50 мМ HEPES, 10 мМ MgCl2, 100 мкМ Na3VO4, 1 мМ DTT, 0,0075% Triton, 2% DMSO (общий объем 50 мкл) в течение 30 минут при комнатной температуре. Инкубацию останавливали путем добавления равного объема 100 мМ EDTA, 4M NaCl2. 80 мкл этой смеси добавляли в покрытые стрептавидином планшеты FlashPlates (PerkinElmer). После стадии промывки определяли 33P включение с использованием жидкостного сцинтилляционного счетчика для микропланшетов (PerkinElmer). Значения ИК50 определяли путем подгонки сигмоидальной кривой доза-ответ к числу импульсов при различных концентрациях в GraphPad Prism.

Анализ ингибирования JAK2

Активность в отношении Jak2 киназы определяли при помощи гомогенного, с разрешением по времени, флуоресцентного (HTRF) киназного анализа in vitro (Mathis, G., HTRF(R) Technology. J Biomol Screen, 1999. 4(6):p. 309-314). Конкретно, 10 мкл His6-меченного по C-концу, рекомбинантного человеческого JAK2, аминокислоты 808-конец, экспрессируемого бакуловирусом в Sf21 клетках (Upstate), смешивали с 10 мкл ингибитора (различные концентрации, конечная концентрация DMSO 2%) и 10 мкл АТФ (5 мкМ конечная концентрация) в реакционном буфере (50 мМ HEPES, pH 7,5, 10 мМ MgCl2, 2 мМ MnCl2, 0,1% BSA и 1 мМ DTT, конечный объем 40 мкл). Реакционную смесь инициировали путем добавления 10 мкл Bio-PDK пептиад (Биотин-Ahx[protein fragment, 39 aa] (SEQ ID NO:4), конечная концентрация 0,5 мкМ) в черном 384-луночном планшете (Packard). После 60 минут инкубации при комнатной температуре реакцию гасили путем добавления 60 мкл стоп/проявляющего буфера с получением 30 мМ EDTA, 1 мкг/мл стрептавидин-APC (Prozyme), 50 нг/мл анти-фосфотирозинового mAb PT66-K криптат европия, 30 мМ HEPES, pH 7,5, 120 мМ BCF, 0,005% Tween-20, 0,05% BSA). Гашеную реакционную смесь оставляли выстаиваться при комнатной температуре в течение 1 часа и затем считывали в детекторе флуоресценции с разрешением по времени (Envision, Perkin Elmer) при 615 нм и 665 нм одновременно. Отношение между сигналами 615 нм и 665 нм использовали для расчета значения ИК50.

Методы - анализ репортерного гена β-катенина

Соединения испытывали на их способность модулировать β-катенин-модулируемую генную транскрипцию в LEF/TCF(T-клеточный фактор) анализе репортерного гена. Клетки нейробластомы человека SY-SY5Y нестабильно трансфицировали при помощи 80 нг/лунка плазмиды TOPFLASH (растворы для определения клеточной сигнальной активности от Upstate), содержащей два набора из трех копий TCF связывающего сайта, расположенного выше от тимидинкиназного минимального промотора, и открытую рамку считывания люциферазы мотылька, или при помощи 80 нг/лунка плазмиды FOPFLASH (растворы для определения клеточной сигнальной активности от Upstate), содержащей три копии мутированного TCF связывающего сайта, расположенного выше от тимидинкиназного минимального промотора, и открытую рамку считывания люциферазы мотылька. Кроме того, все клетки были нестабильно трансфицированы при помощи 20 нг/лунка pRL-TK плазмиды (Promega), содержащей тимидинкиназный промотор вируса простого герпеса, для обеспечения уровней экспрессии люциферазы Renilla от низкого до среднего. Среду для трансфекции заменяли бессывороточной средой, содержащей испытываемое вещество, и инкубировали в течение 24 часов при 370C. Инкубацию останавливали и количественные определения осуществляли с использованием анализа Dual Glo Luciferase Assay (Promega), как указано, и для подсчета использовали считывающее устройство Pherastar (BMG).

Активность люциферазы мотылька нормализовали к активности люциферазы Renilla на лунку. Затем нормализованный TOPFLASH ответ сравнивали с нормализованным FOPFLASH ответом, таким образом, получая специфический сигнал LEF/TCF. Максимальный ответ представляет собой максимальное отношение между нормализованными сигналами TOPFLASH и FOPFLASH. Сигмоидальные кривые доза-ответ строили с использованием программы Graphpad Prism.

Мышиная модель острой астмы

Самок мышей Balb/c закупали у компании Taconic и помещали в Abbott Bioresearch Center. Животных использовали в возрасте 8-12 недель. Все протоколы были одобрены Institutional Animal Care and Use Committee (IACUC). Дексаметазон (Dex) и овальбумин (OVA) закупали у компании Sigma. Эндотоксин удаляли из овальбумина с использованием DetoxiGel (Pierce), в соответствии протоколом изготовителя, и конечное вещество содержало менее чем 0,1 EU/мг белка. Alum Imject закупали у компании Pierce.

Животных сенсибилизировали к OVA в день 0 и 7 путем интраперитонеальной инъекции 8 мкг OVA в 2 мг alum. В дни 14 и 16 животные получали интраназальную стимуляцию 0,3 мкг OVA в 50 мкл стерильного PBS. Животным интраперитонеально вводили репрезентативное соединение формулы (I) (растворенное с 0,5% HMPC, 0,02% Tween 80 в воде) два раза в день при дозах 3, 10 и 30 мг/кг/доза, начиная в день 13 в дневное время. Конечную дозу соединения вводили за 30 минут до измерение гиперреактивности дыхательных путей (AHR). Дексаметазон вводили перорально раз в день в дни 13-17 при дозе 3 мг/кг. Все конечные результаты анализировали в день 17 через 24 часа после второй OVA стимуляции. AHR анализировали с использованием плетизмографии всего тела находящихся в бессознательном состоянии обездвиженных животных. Вкратце, хирургический уровень наркоза обеспечивали путем интраперитонеальной инъекции кетамина и ксилазина. Хирургическим путем вставляли трахеальную канюлю между третьим и четвертым трахеальными кольцами. Самопроизвольное дыхание предотвращали путем внутривенной (в/в) инъекции в яремную вену панкуронийбромида. Животных помещали в плетизмограф для исследования всего организма (Buxco) и осуществляли искусственную вентиляцию легких с 0,2 мл комнатного воздуха при 150 вдохов в минуту с использованием автоматического аппарата искусственного дыхания с контролируемым объемом (Harvard Apparatus). Давление в легком и поток в плетизмографе измеряли с использованием датчиков и сопротивление легких рассчитывали в виде отношения давление/поток с использованием программы Biosystem Xa. Измеряли сопротивление на базовой линии, а также сопротивление после стимуляции метахолином (3, 10 или 30 мг/мл), доставку которого осуществляли при помощи встроенного в линию ультразвукового ингалятора. После завершения испытания функции легких, легкие промывали 4 раза при помощи 0,5 мл стерильного PBS. Промывочную жидкость анализировали на IL-13, AMCазу, Muc5ac и клеточные инфильтраты. Эффективность испытываемого соединения испытывали при дозах 3, 10 и 30 мг/кг b.i.d (6, 20, 60 мг/кг/день). Стимуляция при помощи OVA вызывала повышение сопротивления легких до 6,90 см H2O/мл/сек против 4,65 см H2O/мл/сек у животных, которых стимулировали при помощи PBS. Обработка мышей испытываемым соединением существенно ингибировала (p<0,001) метахолин-индуцированное сопротивление дыхательных путей до 4,55 см H2O/мл/сек и 4,77 см H2O/мл/сек при дозах в пределах от 1 до 100 мг/кг. Для предпочтительных соединений необходима доза менее чем 50 мг/кг для проявления указанного ответа. Для наиболее предпочтительных соединений необходима доза менее чем 30 мг/кг для проявления указанного ответа. Это ингибирование было эквивалентным измерениям, полученным в группе с PBS-стимуляцией (4,65 см H2O/мл/сек) и в группе обработки 3 мг/кг дексаметазоном (4,76 см H2O/мл/сек).

Измерение IL-13: концентрации IL-13 в бронхоальвеолярной промывочной жидкости (BAL) измеряли при помощи анализа ELISA (R & D Systems), в соответствии с инструкциями изготовителя. Концентрации IL-13 в BAL жидкости были существенным образом индуцированы до 102,5 пг/мл у OVA-стимулированных мышей по сравнению с уровнем ниже определяемого у PBS-стимулированной группы. Существенное ингибирование этой индукции (p<0,05) на 60% наблюдали после введения испытываемых соединений при дозе 30 мг/кг. Не было никакого заметного ингибирования в группах введения дозы 3 мг/кг или 10 мг/кг.

Измерение AMCазы: активность кислотной хитиназы млекопитающих (AMCазы) определяли в 1:10 разведении BAL жидкости с 0,01% BSA, 30 мМ цитрата натрия, 60 мМ фосфата натрия, pH 5,2, в присутствии 80 мкМ 4-метилумбеллиферил β-D-N,N'-диацетилхитобиозида. Реакционные смеси инкубировали в течение 15 минут при комнатной температуре и реакции гасили путем добавления 100 мкл 1 M глицин/NaOH pH 10,6. Образование продукта определяли методом эмиссии флуоресценции при 460 нм с возбуждением при 385 нм, с использованием флуорометра Fluorskan Ascent. Индукцию активности AMCазы до 28,5U наблюдали у OVA-стимулированных животных, по сравнению с 2,17U у PBS-стимулированных животных. Существенное ингибирование этой индукции (p<0,01) на 35% наблюдали после введения испытываемых соединений в группе введения дозы 30 мг/кг.

Измерение MUC5AC: Концентрации гена муцина MUC5AC определяли в формате анализа ELISA. Вкратце, образцы BAL разбавляли 1:2 в буфере (2% BSA в PBS) и высевали в 96-луночные планшеты для высокого связывания белка (Costar) и сушили. После серии промывок в течение 1 часа добавляли 1:100 разведение биотинилированного MUC5AC антитела (Clone 45M, Lab Vision). Планшеты промывали и добавляли в планшет 1:3000 разведение стрептавидин-HRP (Southern Biotech) в течение 15 минут. Планшеты затем проявляли с использованием TMB субстрата (Sigma) в течение 30 минут. Реакцию останавливали при помощи 1M H2SO4 и затем планшеты считывали в спектрофотометре при OD 450 нм. Уровни MUC5AC снижались более чем на 50% после введения испытываемых соединений.

Определение антиноцицептивного эффекта: Модели невропатической боли

Модель невропатической боли, вызванной лигированием спинального нерва (L5/L6). Как было подробно описано ранее Kim и Chung (Kim S. H.; Chung J.M. An experimental model for peripheral neuropathy produced by segmental spinal nerve ligation in the rat. Pain 1992, 50, 355-363), делали 1,5 см разрез дорсально к люмбосакральному сплетению. У анестезированных крыс параспинальные мышцы (с левой стороны) отделяли от остистых отростков, L5 и L6 спинальные нервы выделяли и плотно лигировали 3-0 шелковыми нитями. После гемостаза рану сшивали и смазывали мазью на основе антибиотика. Крысам давали выздороветь и затем помещали в клетку с мягкой подстилкой на 14 дней перед поведенческим испытанием на механическую аллодинию.

Модель невропатической боли, вызванной лигированием седалищного нерва. Как было подробно описано ранее Bennett и Xie (Bennett G. J.; Xie Y-K. A peripheral mononeuropathy in rat that produces disorders of pain sensation like those seen in man. Pain 1988, 33, 87-107), анестезированным крысам делали 1,5 см разрез 0,5 см ниже области таза и высвобождали бедренные двуглавые мышцы и ягодичные наружные мышцы (правая сторона). Седалищный нерв обнажали, выделяли и накладывали вокруг него четыре неплотные лигатуры (5-0 хромовый кетгут) с разделением в 1 мм. Крысам давали выздороветь и затем помещали в клетку с мягкой подстилкой на 14 дней перед поведенческим испытанием на механическую аллодинию, как описано выше. Кроме того, животных также испытывали на холодную аллодинию, окуная их заднюю лапу в ванну с холодной водой (4,5°C) и определяя латентность отдергивания лапы.

Выбранные аналоги соединений формулы (I), которые вводили либо интраперитонеально либо перорально, показали более чем 30% ингибирование тактильной аллодинии в моделях невропатической боли Chung и Bennett, описанных в настоящей заявке, при дозах в пределах 1-150 мг/кг.

Обобщая вышесказанное, репрезентативное соединение формулы (I) в мышиной модели острой астмы было эффективным в ингибировании сопротивления дыхательных путей при дозе в пределах от 1 до 100 мг/кг. Обработка с использованием высокой дозы (30 мг/кг) также ингибировала IL-13 индукцию, а также активность AMCазы и уровни MUC5AC в BAL жидкости.

Репрезентативные соединения формулы (I) в крысиных моделях невропатической боли были эффективными, как было продемонстрировано более чем 30% ингибированием тактильной аллодинии при дозах в пределах 1-150 мг/кг.

Соединения формулы (I), как было обнаружено, ингибируют человеческий ROCK-2, His-меченный по N-концу GSK-3β, человеческий GSK-3β, His6-меченный рекомбинантный человеческмй JAK2 и люциферазу мотылька, демонстрируя значение ИК50 от около 1,0 мкМ до около 10 мкМ, предпочтительно, от около 100 нМ до около 1,0 мкМ. Более предпочтительно, соединения формулы (I), как было обнаружено, ингибируют человеческий ROCK-2, His-меченный по N-концу GSK-3β, человеческий GSK-3β, His6-меченный, рекомбинантный человеческмй JAK2 и люциферазу мотылька, демонстрируя значение ИК50 от около 10 нМ до около 100 нМ и, наиболее предпочтительно, менее чем 10 нМ. Кроме того, некоторые соединения формулы (I) продемонстрировали ингибирование человеческого ROCK-2 с селективностью более чем в 10 раз большей по сравнению с панелью из 50 киназных мишеней. Некоторые соединения формулы (I) продемонстрировали ингибирование человеческого GSK-3β с селективностью более чем в 10 раз большей по сравнению с панелью из 50 киназных мишеней. Некоторые соединения формулы (I) продемонстрировали ингибирование His6-меченного рекомбинантного человеческого JAK2 с селективностью более чем в 10 раз большей по сравнению с панелью из 50 киназных мишеней.

Способы введения

Настоящее изобретение также обеспечивает фармацевтические композиции, которые включают соединения по настоящему изобретению. Фармацевтические композиции включают соединения по настоящему изобретению, сформулированные вместе с одним или несколькими нетоксичными фармацевтически приемлемыми носителями.

Фармацевтические композиции по настоящему изобретению можно вводить человеку и другим млекопитающим перорально, ректально, парентерально, интрацистернально, интравагинально, местным путем (например, в виде порошков, мазей или капель), буккально или в виде перорального или назального спрея. Термин "парентерально", как он используется в настоящей заявке, относится к способам введения, которые включают внутривенную, внутримышечную, интраперитонеальную, интрастернальную, подкожную и внутрисуставную инъекцию и инфузию.

Термин "фармацевтически приемлемый носитель", как он используется в настоящей заявке, означает нетоксичный инертный твердый, полутвердый или жидкий наполнитель, разбавитель, инкапсулирующее вещество или вспомогательное вещество для формулирования любого типа. Некоторые примеры веществ, которые могут служить в качестве фармацевтически подходящих носителей, включают сахара, такие как, но не ограничиваясь этим, лактоза, глюкоза и сахароза; крахмалы, такие как, но не ограничиваясь этим, кукурузный крахмал и картофельный крахмал; целлюлозу и ее производные, такие как, но не ограничиваясь этим, натриевая соль карбоксиметилцеллюлозы, этилцеллюлоза и ацетат целлюлозы; порошкообразный трагакант; солод; желатин; тальк; эксципиенты, такие как, но не ограничиваясь этим, масло какао и воски для суппозиториев; масла, такие как, но не ограничиваясь этим, арахисовое масло, масло семян хлопчатника, саффлоровое масло, кунжутное масло, оливковое масло, кукурузное масло и соевое масло; гликоли; такие как пропиленгликоль; сложные эфиры, такие как, но не ограничиваясь этим, этилолеат и этиллаурат; агар; буферные вещества, такие как, но не ограничиваясь этим, гидроксид магния и гидроксид алюминия; альгиновую кислоту; апирогенную воду; изотонический солевой раствор; раствор Рингера; этиловый спирт и фосфатно-буферные растворы, а также другие нетоксичные совместимые лубриканты, такие как, но не ограничиваясь этим, лаурилсульфат натрия и стеарат магния, а также красители, агенты высвобождения, агенты покрытия, подсластители, отдушки и ароматизаторы, консерванты и антиоксиданты также могут присутствовать в композиции, по усмотрению специалиста, составляющего композицию.

Фармацевтические композиции по настоящему изобретению для парентеральной инъекции включают фармацевтически приемлемые стерильные водные или неводные растворы, дисперсии, суспензии или эмульсии, а также стерильные порошки для восстановления в стерильные растворы или дисперсии для инъекций непосредственно перед использованием. Примеры подходящих водных и неводных носителей, разбавителей, растворителей или наполнителей включают воду, этанол, полиолы (такие как глицерин, пропиленгликоль, полиэтиленгликоли и подобные), растительные масла (такие как оливковое масло), органические сложные эфиры для инъекций (такие как этилолеат) и подходящие смеси из таких веществ. Подходящую текучесть можно поддерживать, например, путем использования материалов покрытия, таких как лецитин, путем поддержания нужного размера частиц, в случае дисперсий, и путем использования поверхностно-активных веществ.

Эти композиции также могут содержать адъюванты, такие как консерванты, смечивающие вещества, эмульгаторы и диспергирующие вещества. Предотвращение действия микроорганизмов можно обеспечить путем включения различных антибактериальных и противогрибковых средств, например, парабена, хлорбутанола, фенолсорбиновой кислоты и подобных. Также может быть желательным включение изотонических веществ, таких как сахара, хлорид натрия и подобные. Пролонгированную абсорбцию фармацевтического препарата для инъекций можно обеспечить путем включения веществ, которые замедляют абсорбцию, таких как моностеарат алюминия и желатин.

В некоторых случаях, для пролонгирования действия лекарственного средства желательно замедлить абсорбцию лекарственного средства из подкожной или внутримышечной инъекции. Это можно осуществить путем использования жидкой суспензии кристаллического или аморфного вещества с плохой водорастворимостью. Скорость абсорбции лекарственного средства тогда будет зависеть от скорости его растворения, которая, в свою очередь, может зависеть от размера кристаллов и кристаллической формы. Альтернативно, замедленную абсорбцию парентерально вводимой лекарственной формы обеспечивают путем растворения или суспендирования лекарственного средства в масляном носителе.

Депо препараты для инъекций получают путем образования микроинкапсулирующих матриц лекарственного средства в биоразлагаемых полимерах, таких как полилактид-полигликолид. В зависимости от отношения лекарственного средства к полимеру и природы конкретного используемого полимера, можно контрлировать скорость высвобождения лекарственного средства. Примеры других биоразлагаемых полимеров включают поли(ортоэфиры) и поли(ангидриды). Депо препараты для инъекций также получают путем захвата лекарственного средства в липосомы или микроэмульсии, которые являются совместимыми с тканями организма.

Композиции для инъекций можно стерилизовать, например, фильтрованием через удерживающий бактерии фильтр или путем включения стерилизующих веществ в форме стерильных твердых композиций, которые можно растворять или диспергировать в стерильной воде или другой стерильной среде для инъекций непосредственно перед использованием.

Твердые дозированные формы для перорального введения включают капсулы, таблетки, пилюли, порошки и гранулы. В таких твердых дозированных формах активное соединение может быть смешано с, по меньшей мере, одним инертным, фармацевтически подходящим носителем или эксципиентом, таким как цитрат натрия или дикальцийфосфат и/или a) наполнителями или создающими объем веществами, такими как крахмалы, лактоза, сахароза, глюкоза, маннит и кремневая кислота; b) связующими, такими как карбоксиметилцеллюлоза, альгинаты, желатин, поливинилпирролидон, сахароза и аравийская камедь; c) увлажнителями, такими как глицерин; d) дезинтегрантами, такими как агар-агар, карбонат кальция, картофельный или тапиоковый крахмал, альгиновая кислота, некоторые силикаты и карбонат натрия; e) замедляющими растворение веществами, такими как парафин; f) ускорителями абсорбции, такими как четвертичные аммониевые соединения; g) смечивающими веществами, такими как цетиловый спирт и глицеринмоностеарат; h) абсорбентами, такими как каолиновая и бентонитовая глина, и i) лубрикантами, такими как тальк, стеарат кальция, стеарат магния, твердые полиэтиленгликоли, лаурилсульфат натрия, и смесями таких веществ. В случае капсул, таблеток и пилюль, дозированная форма также может включать буферные вещества.

Твердые композиции подобного типа также можно использовать в качестве наполнителей в желатиновых капсулах с мягким и твердым наполнением, с использованием таких носителей как лактоза или молочный сахар, а также высокомолекулярных полиэтиленгликолей и подобных веществ.

Твердые дозированные формы, такие как таблетки, драже, капсулы, пилюли и гранулы, можно получить с покрытиями и оболочками, такими как энтеросолюбильные покрытия и другие покрытия, хорошо известные в области формулирования фармацевтических композиций. Они, необязательно, могут содержать вещества, делающие препарат непрозрачным, и могут также иметь такую композицию, которая позволяет им высвобождать активный ингредиент(ингредиенты) только, или преимущественно, в определенной части кишечного тракта, необязательно, отсроченным образом. Примеры композиций для заливки препарата, которые можно использовать, включают полимерные вещества и воски.

Активные соединения также могут быть в микроинкапсулированной форме, если это является подходящим, с одним или несколькими из указанных выше носителей.

Жидкие дозированные формы для перорального введения включают фармацевтически приемлемые эмульсии, растворы, суспензии, сиропы и эликсиры. Помимо активных соединений, жидкие дозированные формы могут содержать инертные разбавители, традиционно используемые в данной области, такие как, например, вода или другие растворители, солюбилизирующие вещества и эмульгаторы, такие как этиловый спирт, изопропиловый спирт, этилкарбонат, этилацетат, бензиловый спирт, бензилбензоат, пропиленгликоль, 1,3-бутиленгликоль, диметилформамид, масла (в частности, масло семян хлопчатника, арахисовое масло, кукурузное масло, масло из зародышей масличных семян, оливковое масло, касторовое масло и кунжутное масло), глицерин, тетрагидрофурфуриловый спирт, полиэтиленгликоли и сложные эфиры жирных кислот сорбитана, и смеси таких веществ.

Помимо инертных разбавителей, пероральные композиции также могут включать адъюванты, такие как смечивающие вещества, эмульгаторы и суспендирующие вещества, подсластители, отдушки и ароматизаторы.

Суспензии, помимо активных соединений, могут содержать суспендирующие вещества, например, этоксилированные изостеариловые спирты, полиоксиэтиленсорбит и сложные эфиры сорбитана, микрокристаллическую целлюлозу, метагидроксид алюминия, бентонит, агар-агар, трагакант и смеси таких веществ.

Композиции для ректального или вагинального введения, предпочтительно, представляют собой суппозитории, которые можно получить путем смешивания соединений по настоящему изобретению с подходящими нераздражающими носителями или наполнителями, такими как масло какао, полиэтиленгликоль или воск для суппозиториев, которые являются твердыми при комнатной температуре, но жидкими при температуре тела, и поэтому расплавляются в прямой кишке или влагалище и высвобождают активное соединение.

Соединения по настоящему изобретению также можно вводить в форме липосом. Как это известно из уровня техники, липосомы, как правило, получают из фосфолипидов или других липидных веществ. Липосомы образуют из одно- или многослойных гидратированных жидких кристаллов, которые диспергируют в водной среде. Можно использовать любой нетоксичный, физиологически приемлемый и метаболизируемый липид, способный образовывать липосомы. Композиции по настоящему изобретению в форме липосом могут содержать, помимо соединения по настоящему изобретению, стабилизаторы, консерванты, эксципиенты и подобные вещества. Предпочтительными липидами являются природные и синтетические фосфолипиды и фосфатидилхолины (лецитины), которые используют по отдельности или вместе.

Способы образования липосом известны из уровня техники. Смотри, например, Prescott, Ed., Methods in Cell Biology, Volume XIV, Academic Press, New York, N.Y. (1976), p. 33 et seq.

Дозированные формы для местного введения соединений по настоящему изобретению включают порошки, спреи, мази и препараты для ингаляций. Активное соединение можно смешивать в стерильных условиях с фармацевтически приемлемым носителем и любыми необходимыми консервантами, буферными веществами или пропеллентами, которые могут потребоваться. Препараты для введения в глаз, глазные мази, порошки и растворы также предусматриваются как входящие в объем настоящего изобретения.

Фактические уровни доз активных ингредиентов в фармацевтических композициях по настоящему изобретению могут варьировать так, чтобы получить количество активного соединения(соединений), которое является эффективным для достижения желаемого терапевтического ответа для конкретного пациента, композиций и способа введения. Выбор уровня дозы будет зависеть от активности конкретного соединения, пути введения, тяжести состояния, подлежащего лечению, и состояния и предшествующей истории болезни пациента, подлежащего лечению.

При использовании в указанных выше или других лечениях, терапевтически эффективное количество одного из соединений по настоящему изобретению можно использовать в чистой форме, когда такие формы существуют, в форме фармацевтически приемлемой соли, сложного эфира или пролекарства. Фраза "терапевтически эффективное количество" соединения по настоящему изобретению означает количество соединения, достаточное для лечения расстройств, при разумном отношении польза/риск, применимом к любому медицинскому лечению. Однако должно быть понятно, что общая суточная доза соединений и композиций по настоящему изобретению зависит от мнения лечащего врача, в рамках разумной медицинской практики. Конкретный уровень терапевтически эффективной дозы для любого конкретного пациента будет зависеть от многих факторов, включая расстройство, подлежащее лечению, и тяжесть расстройства; активность конкретного используемого соединения; конкретную используемую композицию; возраст, массу тела, общее состояние здоровья, пол и режим питания пациента; время введения, путь введения и скорость выведения из организма конкретного используемого соединения; продолжительность лечения; лекарственные средства, используемые в сочетании или одновременно с конкретным соединением, которое используют; и подобные факторы, хорошо известные в медицине.

Термин "фармацевтически приемлемая соль", как он используется в настоящей заявке, означает соли, полученные из неорганических или органических кислот. Соли могут быть получены in situ в процессе конечного выделения и очистки соединений формулы (I), или их можно получить отдельно путем взаимодействия формы свободного основания соединения формулы (I) с неорганической или органической кислотой. Репрезентативные кислотно-аддитивные соли включают, но не ограничиваются этим, ацетат, адипат, альгинат, цитрат, аспартат, бензоат, бензолсульфонат, бисульфат, бутират, камфорат, камфорсульфонат, диглюконат, глицерофосфат, гемисульфат, гептаноат, гексаноат, фумарат, гидрохлорид, гидробромид, гидроиодид, 2-гидроксиэтансульфонат (изетионат), лактат, малеат, фумарат, метансульфонат, никотинат, 2-нафталинсульфонат, оксалат, памоат, пектинат, персульфат, 3-фенилпропионат, пикрат, пивалат, пропионат, сукцинат, сульфат, (L) тартрат, (D) тартрат, (DL) тартрат, тиоцианат, фосфат, глутамат, бикарбонат, п-толуолсульфонат и ундеканоат.

Термин "фармацевтически приемлемое пролекарство" или "пролекарство", как он используется в настоящей заявке, представляет такие пролекарства соединений по настоящему изобретению, которые, в соответствии со здравой медицинской оценкой, являются подходящими для использования в контакте с тканями человека и низших животных, без чрезмерной токсичности, раздражения, аллергических реакций и т.п. Пролекарства по настоящему изобретению могут быстро преобразовываться in vivo в соединения формулы (I), например, в результате гидролиза в крови.

Настоящее изобретение предусматривает соединения формулы (I), образованные синтетическим путем или образованные путем биопреобразования in vivo.

Соединения по настоящему изобретению могут существовать в несольватированных, а также в сольватированных формых, включая гидратированные формы, такие как полугидраты. Как правило, сольватированные формы с фармацевтически приемлемыми растворителями, такими как вода и этанол, среди прочих, являются эквивалентными несольватированным формам для целей настоящего изобретения.

Общая суточная доза соединений по настоящему изобретению для введения человеку или низшим животным может находиться в пределах от около 0,003 до около 30 мг/кг/день. Для перорального введения более предпочтительные дозы могут находиться в пределах от около 0,01 до около 10 мг/кг/день. Если желательно, эффективную суточную дозу можно разделить на несколько доз в целях введения; следовательно, композиции, содержащие разовую дозу, могут содержать такие количества или дробные части этой дозы, которые составляют суточную дозу.

Протеинкиназы можно подразделить на широкие группы на основании идентичности аминокислоты(аминокислот), на которую они нацелены (серин/треонин, тирозин, лизин и гистидин). Например, тирозиновые киназы включают рецепторные тирозиновые киназы (RTK), такие как факторы роста, и нерецепторные тирозиновые киназы, такие как семейство src киназ. Также существуют протеинкиназы с двойной специфичностью, которые нацелены как на тирозин, так и серин/треонин, такие как циклин-зависимые киназы (CDK) и митогенактивируемые протеинкиназы (MAPK).

Тирозиновые протеинкиназы (PTK) образуют крупное семейство киназ, которые регулируют передачу сигналов от клетки к клетке, которые участвуют в росте, дифференциации, адгезии, подвижности и гибели (Pearson, M. et al., In Protein Tyrosine Kinases; Fabbro, D., McCormick, F., Eds.; Humana Press Inc., 2006; pp 1-29.). Члены семейства тирозиновых киназ включают, но не ограничиваются этим, Yes, BMX, Syk, EphA1, FGFR3, RYK, MUSK, JAK1 и EGFR. Тирозиновые киназы подразделяются на два класса, а именно, тирозиновые киназы рецепторного типа и нерецепторного типа. Интересно, что все семейство тирозиновых киназ состоит из, по меньшей мере, 90 охарактеризованных киназ, из которых, по меньшей мере, 58 киназ рецепторного типа и, по меньшей мере, 32 киназы нерецепторного типа, и включает, по меньшей мере, в общей сложности 30 субсемейств. Тирозиновые киназы связаны с различными заболеваниями человека, включая диабет и рак (Pearson, M. et al., In Protein Tyrosine Kinases; Fabbro, D., McCormick, F., Eds.; Humana Press Inc., 2006; pp 1-29.). Тирозиновые киназы часто принимают участие в большинстве форм злокачественных заболеваний человека и связаны с широким рядом различных врожденных синдромов (Robertson et al., Trends Genet. 16:265-271, 2000). Нерецепторные тирозиновые киназы представляют группу внутриклеточных ферментов, которые не имеют внеклеточных и трансмембранных последовательностей. В настоящее время идентифицировано более 32 семейств нерецепторных тирозиновых киназ (Robinson et al., Oncogene 19, 5548-5557, 2000). Репрезентативные примеры включают Src, Btk, Csk, ZAP70 и Kak семейства. В частности, Src семейство является самым большим семейством нерецепторных тирозиновых киназ, состоящим из Src, Yes, Fyn, Lyn, Lck, Blk, Hck, Fgr и Yrk тирозиновых протеинкиназ. Src семейство киназ связано с онкогенезом, клеточной пролиферацией и прогрессированием опухоли. Было обнаружено, что многие из тирозиновых протеинкиназ участвуют в клеточных сигнальных путях, которые связаны с различными патологическими состояниями, включая, но не ограничиваясь этим, рак и гиперпролиферативные расстройства и иммунные расстройства.

Циклинзависимые киназы CDK представляют группу внутриклеточных ферментов, которые контролируют прохождение через клеточный цикл и играют существенную роль в клеточной пролиферации (Cohen, P. Nature Reviews Drug Discovery 1, 309-315, 2002). Репрезентативные примеры CDK включают, но не ограничиваются этим, циклин-зависимую киназу 2 (CDK2), циклин-зависимую киназу 7 (CDK7), циклин-зависимую киназу 6 (CDK6) и белок 2, контролирующий клеточное деление (CDC2). CDK участвуют в регуляции переходов между различными фазами клеточного цикла, например, переход от стадии покоя в G1 (промежуток между митозом и началом репликации ДНК для нового цикла клеточного деления) к фазе S (период активного синтеза ДНК) или переход от G2 к фазе M, в которой происходит активный митоз и деление клетки (Rowell et al. Critical Reviews in Immunology 26(3), 189-212, 2006). CDK комплексы образуются через ассоциацию регуляторной циклиновой субъединицы (например, циклин A, B1, B2, D1, D2, D3 и E) и каталитической киназной субъединицы (например, cdc2 (CDK1), CDK2, CDK4, CDK5 и CDK6). CDK демонстрируют абсолютную зависимость от циклиновой субъединицы, чтобы фосфорилировать их субстраты, на которые они нацелены, и различные пары киназа/циклин обладают функцией регулирования продвижения через специфические части клеточного цикла. Кроме того, CDK участвуют в различных болезненных состояниях, включая но не ограничиваясь этим, состояния, демонстрирующие фенотип рака, различные опухолевые расстройства, и в неврологических расстройствах (Pallas et al. Current Medicinal Chemistry: Central Nervous System Agents 5(2), 101-109, 2005).

Митогенактивируемые протеинкиназы (MAP) участвуют в трансдукции сигналов к ядру клетки в ответ на внеклеточные стимулы. Репрезентативные примеры MAP киназ включают, но не ограничиваются этим, митогенактивируемую протеинкиназу 3 (MAPK3), митогенактивируемую протеинкиназу 1 (ERK2), митогенактивируемую протеинкиназу 7 (MAPK7), митогенактивируемую протеинкиназу 8 (JNK1), митогенактивируемую протеинкиназу 14 (p38 альфа), митогенактивируемую протеинкиназу 10 (MAPK 10), JNK3 альфа протеинкиназу, стрессактивируемую протеинкиназу JNK2 и митогенактивируемую протеинкиназу 14 (MAPK14). MAP киназы представляют собой семейство пролин-направленных сериновых/треониновых киназ, которые опосредуют сигнальную трансдукцию от внеклеточных рецепторов или теплового шока или УФ-излучения (Barr et al., Trends in Pharmacological Sciences 27(10), 525-530, 2006). MAP киназы активируются через фосфорилирование треонина и тирозина обладающими двойной специфичностью протеинкиназами, включая тирозиновые киназы, такие как факторы роста. Клеточная пролиферация и дифференциация, как было показано, находятся под регуляторным контролем различных MAP киназных каскадов (Sridhar et al., Pharmaceutical Research, 17:11 1345-1353, 2000). Таким образом, MAP киназный путь играет критическую роль в различных болезненных состояниях, например, дефекты активностей MAP киназ, как было показано, приводят к аберрантной клеточной пролиферации и карциногенезу (Qi et al., Journal of Cell Science 118(16), 3569-3572, 2005). Более того, активность MAP киназ также связана с резистентностью к инсулину, связанной с диабетом типа 2 (Fujishiro et al. Recent Research Developments in Physiology 1(Pt. 2), 801-812, 2003).

p90 Рибосомальные S6 киназы (Rsk) представляют собой сериновые/треониновые киназы, которые играют определенную роль в митогенактивируемом клеточном росте и пролиферации, дифференциации и клеточном выживании. Примеры членов Rsk семейства киназ включают, но не ограничиваются этим, рибосомальную протеинкиназу S6, 90 кДа, полипептид 2 (Rsk3), рибосомальную протеинкиназу S6, 90 кДа, полипептид 6 (Rsk4), рибосомальную протеинкиназу S6, 90 кДа, полипептид 3 (Rsk2) и рибосомальную протеинкиназу S6, 90 кДа, полипептид 1 (Rsk1/p90Rsk). Члены Rsk семейства активируются связанными с внеклеточным сигналом киназами и фосфоинозитидзависимой протеинкиназой 1 (Frodin and Gammeltoft, Mol. Cell. Endocrinol. 151, 65-77, 1999). В обычных условиях RSK киназы локализуются в цитоплазме клетки, а при стимуляции митогенами активированные (фосфорилириованные связанной с внеклеточным сигналом киназой) RSK преходящим образом перемещаются к плазменной мембране, где они становятся полностью активированными. Полностью активированная RSK фосфорилирует субстраты, которые участвуют в клеточном росте, пролиферации, дифференциации и клеточном выживании (Clark et al. Cancer Research 65, 3108-3116, 2005). RSK сигнальные пути также связывают с модуляцией клеточного цикла (Gross et al., J. Biol. Chem. 276, 46099-46103, 2001). Имеющиеся на настоящий момент данные дают основание предположить, что малые молекулы, которые ингибируют Rsk, могут быть полезными терапевтическими средствами для профилактики и лечения рака и воспалительных заболеваний.

Члены семейства протеинкиназ контрольных точек (CHK) представляют собой сериновые/треониновые киназы, которые играют важную роль в развитии клеточного цикла. Примеры членов семейства протеинкиназ контрольных точек включают, но не ограничиваются этим, CHK1 и CHK2. Киназы контрольных точек представляют собой системы контроля, которые координируют развитие клеточного цикла, оказывая влияние на образование, активацию и последующую инактивацию циклин-зависимых киназ. Киназы контрольных точек предотвращают развитие клеточного цикла в неподходящее для этого время, поддерживают метаболический баланс клеток при “остановке” клетки в определенной точке клеточного цикла и, в некоторых случаях, могут индуцировать апоптоз (программированная клеточная гибель), когда требования контрольной точки не были удовлетворены (Nurse, Cell, 91, 865-867, 1997; Hartwell et al., Science, 266, 1821-1828, 1994). Члены семейства киназ контрольных точек связаны с пролиферативными расстройствами, фенотипами рака и другими заболеваниями, связанными с повреждением и репарацией ДНК (Kumagai and Dunphy Cell Cycle, 5, 1265-1268 (2006); Xiao et al., Molecular Cancer Therapeutics 5, 1935-1943, 2006).

Киназы Aurora представляют собой семейство мультигенных митотических сериновых-треониновых киназ, которое функционирует как класс новых онкогенов. Эти киназы включают aurora-A и aurora-B. Киназы Aurora гиперактивируются и/или чрезмерно экспрессируются в некоторых сόлидных опухолях, включая, но не ограничиваясь этим, рак молочной железы, яичников, предстательной железы, поджелудочной железы и колоректальный рак. В частности, aurora-A представляет собой центросомальную киназу, которая играет важную роль в развитии клеточного цикла и клеточной пролиферации. Aurora-A расположена в области 20q13 хромосомы, которая часто амплифицируется в некоторых различных типах злокачественных опухолей, таких как колоректальный рак, рак молочной железы и мочевого пузыря. Также существует тесная взаимосвязь между aurora-A и высоким гисто-прогностическим уровнем анеуплойдии, что делает эту киназу потенциальным прогностическим вектором. Ингибирование активности киназы aurora может снизить клеточную пролиферацию, рост опухоли и потенциально канцерогенез. Подробное описании функции киназы aurora представлено в Journal of Cell Science, 119, 3664-3675, 2006.

Rho-ассоциированные, содержащие скрученную спираль сериновые/треониновые протеинкиназы ROCK-1 и ROCK-2, как считается, играют основную роль в цитоскелетной динамике, выполняя роль расположенных ниже эффекторов Rho/Rac семейства активируемых цитокинами и факторами роста небольших GTPаз. ROCK фосфорилируют различные субстраты, включая, но не ограничиваясь этим, фосфатазу легкой цепи миозина, легкую цепь миозина, эзрин-радиксин-моэзиновые белки и LIM (для Lin11, Is1l и Mec3) киназы. ROCK также опосредуют образование актиновых стрессовых волокон и фокальные адгезии в различных типах клеток. ROCK играют важную роль в клеточной миграции путем усиления клеточной сократительной способности, и они необходимы для ретракции хвостов моноцитов и раковых клеток. Ингибиторы ROCK, как также было показано, снижают рассеивание опухолевых клеток in vivo. Проведенные в последнее время эксперименты определили новые функции ROCK в клетках, включая центросомальное расположение и регуляцию размера клеток, что может способствовать различным физиологическим и патологическим состояниям (Mueller et al, Nature Reviews Drug Discovery 4, 387-398, 2005). Члены ROCK семейства являются привлекательными мишенями для вмешательства при различных патологиях, включая рак и сердечно-сосудистые заболевания. Ингибиторы ROCK могут быть полезными терапевтическими средствами для лечения гипертензии, стенокардии и астмы. Кроме того, Rho, как предполагают, играет определенную роль в нарушениях периферического кровообращения, артериосклерозе, воспалении и аутоиммунных заболеваниях и, таким образом, представляет собой полезную мишень для терапии (Shimokawa et al, Arteriosclerosis, Thrombosis and Vascular Biology, 25, 1767-1775, 2005).

Ограниченный успех фармакотерапевтических подходов при повреждении спинного мозга в большой степени связан с неспособностью поврежденных нервных волокон в белом веществе человеческого спинного мозга возобновлять рост и снова устанавливать синаптические контакты с их разъединенными партнерами-нейронами. Агрессивное микроокружение, характеризующееся присутствием большого разнообразия молекулярных ингибиторов роста невритов на участке поражения, в рубцовой ткани и на ЦНС миелине, является причиной этой необратимой остановки роста невритов. В культуре ткани эти ингибиторы роста невритов часто индуцируют весьма драматичные ответы, включая коллапс образования и утрату неврита. Рубцовая ткань в головном и спинном мозге человека является сильным и персистентным барьером для любой регенерации роста невритов, и ингибиторы ROCK могли бы помочь поврежденным волокнам расти или распространяться за пределы этой ингибирующей регенерацию ткани. Различные факты указывают на то, что в результате повреждения головного и спинного мозга происходит сильная активация RhoA-ROCK пути. Из-за постоянного присутствия ингибиторов роста невритов на участке поражения или вокруг него и в ЦНС миелине, такая активация потенциально могла бы сохраняться в течение длительного времени, делая ингибирование ROCK привлекательной целью не только для неотложного лечение острых и под-острых случаев, но также для хронического лечения повреждения спинного мозга. Ингибирование ROCK двумя различными малыми молекулами-ингибиторами ROCK (Y-27632 и фасудил) стимулировало или ускоряло функциональное восстановление в различных моделях травмы спинного мозга мышей и крыс при их местном или системном введении сразу после повреждения в виде разовой дозы или в течение нескольких недель (Dergham, P. et al. Rho signaling pathway targeted to promote spinal cord repair. J. Neurosci. 22, 6570-6577, 2002; Hara, M. et al. Protein kinase inhibition by fasudil hydrochloride promotes neurological recovery after spinal cord injury in rats. J. Neurosurg. Spine 93, 94-101, 2000.; Fournier, A. E. et al. ROCK inhibition enhances axonal regeneration in the injured CNS. J. Neurosci. 23, 1416-1423, 2003; Sung, J. K. et al. A possible role of RhoA/Rho-kinase in experimental spinal cord injury in rat. Brain Res. 959, 29-38, 2003; Tanaka, H. et al. Cytoplasmic p21(Cipl/WAFl) enhances axonal regeneration and functional recovery after spinal cord injury in rats. Neuroscience 127, 155-164, 2004). В этих исследованиях, ингибирование ROCK не только усиливало рост нервных волокон за пределами участка поражения, но также имело нейрозащитное действие и уменьшало повреждение ткани и образование пустот. На основании этих исследований на грызунах, ингибиторы ROCK, которые обладают нейрозащитным и стимулирующим нейрорегенерацию действием, могли бы принести существенную пользу пациентам с повреждением спинного мозга. Кроме того, они могли бы нормализовать кровоток в спинном мозге, благодаря их сосудорасширяющему эффекту, таким образом, еще сильнее способствуя сохранению ткани.

Патологически, болезнь Альцгеймера характеризуется на микроскопическом уровне внутриклеточными нейрофибриллярными сплетениями и внеклеточными амилоидными агрегатами. Нейрофибриллярные сплетения содержат аберрантно фосфорилированный tau белок, ассоциированный с микротрубочками белок и субстрат для ROCK, тогда как амилоидные агрегаты образуются преимущественно посредством токсических амилоидных-β (Aβ) пептидов, имеющих в длину 42-аминокислот. Недавно было показано (Zhou, Y. et al. Nonsteroidal anti-inflammatory drugs can lower amiloidogenic Aβ42 by inhibiting Rho. Science 302, 1215-1217, 2003), что в клетках, секретирующих Aβ42, и у трансгенных PDAPP МЫШЕЙ, продуцирующих большие количества Aβ42, некоторые нестероидные противовоспалительные лекарственные средства (NSAID) снижали уровень Aβ42 путем ингибирования RhoA-ROCK пути. Ингибитор ROCK, Y-27632, был эффективным в снижении уровней Aβ42 как в клеточной культуре, так и у PDAPP трансгенных мышей при введении путем интрацеребровентрикулярной инъекции. Активация Rho геранилгеранилпирофосфатом, липидом, необходимым для мембранного прикрепления Rho, повышала уровни Aβ42; это повышение полностью предотвращалось при помощи Y-27632. Ингибитор ROCK, Y-27632, который использовали в животных моделях болезни Альцгеймера, был эффективным, вызывая снижение количества уровней токсичного Aβ42, но не оказывал никакого эффекта на общие уровни Aβ, и этот эффект ингибиторов Rho или ROCK является, по меньшей мере, одним механизмом, посредством которого NSAIDs снижают уровни Aβ42. В дополнение ко многим другим терапевтическим вмешательствам, эти ингибиторы обладают таким хорошо подтвержденным документально преимуществом, которое состоит в стимуляции возобновляемого роста невритов, и поэтому является возможным, что ингибирование этого пути может привести к восстановлению амилоид-поврежденной невральной цепи.

Наиболее важным в патогенезе заболевания является миграция лейкоцитов за пределы эндотелия головного мозга в ЦНС и воспалительный каскад, стимулируемый этими клетками, который в конечном результате приводит к демиелинизации участков волокон ЦНС и повреждению и потере невритов. Лейкоциты нуждаются в активном RhoA и ROCK для их продвижения за пределы эндотелия головного мозга, поскольку их транс-эндотелиальная миграция была предотвращена ингибитором ROCK Y-2763294.

Нейрозащитное действие ингибиторов ROCK фасудила и гидроксифасудила не ограничивается моделями повреждения спинного мозга, но также были сообщения о таком эффекте в церебральных мультиинфарктных моделях песчанок и крыс (Toshima Y, Satoh S, Ikegaki I, Asano T. A new model of cerebral microthrombosis in rats and the neuroprotective effect of a Rho-kinase inhibitor. Stroke 31, 2245-2250, 2000; Satoh, S. et al. Pharmacological profile of hydroxy fasudil as a selective ROCK inhibitor on ischemic brain damage. Life Si. 69, 1441-1453, 2001; Kitaoka, Y. et al. Involvement of RhoA and possible neuroprotective effect of fasudil, a ROCK inhibitor, in NMDA-induced neurotoxicity in the rat retina. Brain Res.l018, 111-118, 2004). В моделях удара у грызунов некоторые ингибиторы регенерации, такие как ROCK-активирующий NgR1 комплекс и один из его лигандов, NOGO-A, были нейтрализованы спустя 24 часа или даже 1 неделю после индукции церебрального удара, и наблюдали улучшенное функциональное восстановление (Lee, J. K., Kim, J. E., Sivula, M. & Strittmatter, S. M. Nogo receptor antagonism promotes stroke recovery by enhancing axonal plasticity. J. Neurosci. 24, 6209-6217, 2004; Wiessner, C. et al. Anti-Nogo-A antibody infusion 24 hours after experimental stroke improved behavioral outcome and corticospinal plasticity in normotensive and spontaneously hypertensive rats. J. Cereb. Blood FlowMetab. 23, 154-165, 2003). Блокирование ROCK поэтому является достижимой нейрорегенеративной стратегией; кроме того, такая стратегия имеет преимущество, состоящее в том, что терапевтическое окно для использования этих ингибиторов может быть больше, чем для тромболитического или нейрозащитного вариантов лечения удара.

Повреждения нервных клеток в периферической нервной системе или в ЦНС человека может привести к состоянию хронической боли, известному как невропатическая боль. Недавно было показано, что воспалительные медиаторы, такие как лизофосфатидиновая кислота (LPA), которая продуцируется в ответ на повреждение, участвуют в инициации невропатической боли в мышиной модели повреждения периферического нерва (Inoue, M. et al. Initiation of neuropathic pain requires lysophosphatidic acid receptor signaling. Nature Med. 10, 712-718, 2004). LPA присутствует на участках поражения в периферической нервной системе и ЦНС и проявляет свою функцию путем связывания с G-белок-связанными LPA рецепторами, что приводит к активации RhoA-ROCK пути. Ингибитор ROCK, Y-27632, предотвращает инициацию невропатической боли после повреждения нерва или LPA инъекции, тогда другой ингибитор ROCK, H-1152, облегчает невропатическую боль в модели рассечения спинального нерва L5 (Tatsumi, S. et al. Involvement of Rho-kinase in iflammatory and neuropathic pain through phosphorylation of myristoylated alanine-rich C-kinase substrate (MARCKS). Neuroscience 131, 491-498, 2005). Результаты этих испытаний показывают, что ROCK является потенциальной мишенью для лекарственных средств, которая отвечает за индукцию, а также поддержание хронических состояний боли.

Более того, Schueller et al. (Abstract 1216, 8th World Congress on Inflammation, Copenhagen, DenMark, June 16-20, 2007) продемонстрировали, что SLx-2119, перорально биодоступный, сильнодействующий и высокоселективный ингибитор ROCK 2, снижает атерогенез в присутствии сильно повышенных уровней липидов в группах, состоящих из 8 имеющих ApoE-“нокаут” мышей, и это говорит о том, что селективное ингибирование ROCK 2 имеет потенциал ограничения атеросклероза.

70 кДа рибосомальная S6 киназа (p70S6K) активируется различными митогенами, факторами роста и гормонами. Активация p70S6K происходит через фосфорилирование на различных участках, и основной мишенью активированной киназы является 40S рибосомальный белок S6, основной компонент механизма, участвующего в синтезе белков в клетках млекопитающих. Кроме того, активация p70S6K связана с контролем клеточного цикла, дифференциацией нервных клеток, регуляцией клеточной подвижности и с клеточным ответом, что является важным для метастазов опухоли, иммунитета и восстановления ткани. Модуляция активности p70S6 киназы также может иметь терапевтическое применение при расстройствах, таких как рак, воспаление и различные невропатиии. Подробное обсуждение p70S6K киназ можно найти в Prog. Cell Cycle Res., 1, 21-32, 1995, а также в Immunol. Cell Biol. 78, 447-51, 2000.

Гликогенсинтаза-киназа 3 (GSK-3) представляет собой широко экспрессируемую, конститутивно активную сериновую/треониновую киназу, которая фосфорилирует клеточные субстраты и посредством этого регулирует широкий ряд различных клеточных функций, включая развитие, метаболизм, генную транскрипцию, трансляцию белка, цитоскелетную организацию, регуляцию клеточного цикла и апоптоз. GSK-3 первоначально была описана как ключевой фермент, участвующий в метаболизме гликогена, но в настоящее время известно, что она регулируют широкий ряд клеточных функций. Ранее были идентифицированы две формы этого фермента, GSK-3+ƒ и GSK-3+ƒ. Активность GSK-3+ƒ отрицательно регулируется протеинкиназой B/Akt и сигнальным путем Wnt. Поэтому малые молекулы, являющиеся ингибиторами GSK-3, могут иметь некоторые терапевтические применения, включая лечение и профилактику нейродегенеративных заболеваний и стимуляцию нейрогенерации при различных неврологических расстройствах (Gartner et al. J. Cell Science, 2006, 119, 3927-3934. Zhou et al. Neuron, 2004, 42, 897-912), диабете типа II, биполярных расстройствах, ударе, раке, остеоартрите, остеопорозе, ревматоидном артрите (Cuzzocrea et al. Clinical Immunology, 2006, 120, 57-67) и хроническом воспалительном заболевании. Общий обзор: Kockeritz et al., Current Drug Targets, 7, 1377-1388, 2006. Обзор неврологических применений: Current Drug Targets, 7(11), 1389-1397 и 1399-1409, 2006.

Протеинкиназы стали привлекательными мишенями для лечения раковых заболеваний (Fabbro et al., Pharmacology & Therapeutics 93:79-98, 2002). Предполагают, что участие протеинкиназ в развитии злокачественных опухолей человека может происходить посредством следующего: (1) геномные перестройки (например, BCR-ABL в хроническом миелогенном лейкозе), (2) мутации, приводящие к конститутивно активной киназной активности, например, острый миелогенный лейкоз и желудочно-кишечные опухоли, (3) нарушенная регуляция киназной активности путем активации онкогенов или потери функций супрессора опухоли, как, например, при раковых заболеваниях с онкогенным RAS, (4) нарушенная регуляция киназной активности в результате сверх-экспрессии, как в случае EGFR, и (5) эктопическая экспрессия факторов роста, которая может способствовать развитию и сохранению опухолевого фенотипа (Fabbro et al., Pharmacology & Therapeutics 93:79-98, 2002).

Некоторые раковые заболевания связаны с ангиогенезом. Ангиогенез представляет собой рост новых капиллярных кровеносных сосудов из ранее существующей сосудистой сети (Risau, W., Nature 386:671-674, 1997). Было показано, что протеинкиназы могут способствовать развитию и сохранению опухолевого фенотипа (Fabbro et al., Pharmacology & Therapeutics 93:79-98, 2002). Например, VEGF A-D и четыре их рецептора связаны с фенотипами, которые включают неоваскуляризацию и повышенную сосудистую проницаемость, такими как опухолевый ангиогенез и лимфангиогенез (Matter, A., Drug Discov. Today 6:1005-1023, 2001).

Было признано, что подход на основе одного средства, которое специфическим образом нацелено на одну киназу или один киназный путь, может быть недостаточным для лечения заболеваний и расстройств, в частности рака, по некоторым причинам. Модели дают основание предположить, что необходимо от 5 до 7 мутаций для преобразования нормальной клетки в злокачественную. Кроме того, общепризнано, что рак является результатом изменений в нескольких путях, в частности, протеинкиназных путях, которые связаны с такими процессами, как клеточный рост, пролиферация, апоптоз, подвижность или инвазия. В большинстве раковых заболеваний, общим характерным признаком является одновременная сверхэкспрессия и/или гиперактивация различных протеинкиназ, таких как рецепторные и нерецепторные киназы, сериновые/треониновые киназы, P13 киназы и связанные с клеточным циклом киназы. На самом деле, некоторые из этих киназ, либо отдельно, либо в сочетании с другими киназами, участвуют в различных процессах, важных для клеточного выживания, пролиферации, роста и злокачественного преобразования, подвижности и инвазии, ведущих к метастазам и ангиогенезу или воспалению и заболеваниям, расстройствам и состояниям, связанным с ними.

Следовательно, блокирование одной киназной мишени может быть клинически недостаточным, поскольку существует несколько мишеней, представляющих собой киназы, которые влияют на прогрессирование состояния, заболевания или расстройства. Кроме того, блокирование одной киназной мишени может быть клинически недостаточным, поскольку избыточные киназа-опосредованные пути и альтернативные онкогенные или воспалительные механизмы могут компенсировать блокированную киназную мишень. Более того, применение одного средства также может повысить вероятность развития резистентности к этому средству.

Сердечно-сосудистое заболевание является причиной почти четверти общей годовой смертности во всем мире. Сосудистые расстройства, такие как атеросклероз и рестеноз, являются результатом нарушений роста стенок сосудов и ограничения притока крови к жизненно важным органам. Различные киназные пути, например JNK, активируются атерогенными стимулами и регулируются через локальную продукцию цитокинов и факторов роста в клетках сосудов (Yang et al, Immunity 9:575, 1998). Ишемия и ишемия вместе с реперфузией в сердце, почке или головном мозге приводят к клеточной гибели и образованию рубцов, что может в результате привести к застойной сердечной недостаточности, почечной недостаточности или церебральной дисфункции. При трансплантации органов реперфузия ранее ишемических донорских органов приводит к острому лейкоцит-опосредованному повреждению ткани и замедлению функции трансплантата. Пути ишемии и реперфузии опосредованы различными киназами. Например, JNK путь связан с лейкоцит-опосредованным повреждением ткани (Li et al., Mol. Cell. Biol. 16:5947-5954, 1996). И наконец, усиленный апоптоз в сердечных тканях также связывают с киназной активностью (Pombo et al., J. Biol. Chem. 269:26546-26551, 1994).

1. Соединение формулы (I)

или его фармацевтически приемлемая соль, где
А представляет собой


R1 представляет собой водород или RaRbN;
R2 представляет собой водород;
R3 представляет собой алкил, алкокси, арил, циано, циклоалкил, галоген, галогеналкил, гетероарил, нитро или RgRhN-;
Ra и Rb каждый представляет собой водород-;
Rg и Rh каждый независимо представляют собой водород, С1-10алкил или С1-10алкилкарбонил;
Ri, Rii, Riii, Riv, Rv, Rvi, Rvii, Rviii, Rix, Rx, Rxi, Rxii, Rxiii, Rx1v, Rxv, Rxvi, Rxvii и Rxviii каждый независимо представляют собой С1-10алкокси, С1-10алкокси-С1-10алкил, С1-10алкоксикарбонил, С1-10алкоксикарбонил-С1-10алкил, арил, арил-С1-10алкил, арил-С1-10-(гидрокси)алкил, арилоксиалкил, арилкарбонил, арилтиоалкил, карбокси, карбокси-С1-10алкил, С1-10цианоалкил, С3-8циклоалкил, С3-8циклоалкил-С1-10алкил, С3-8циклоалкилкарбонил, галоген, гетероарил, гетероарил-С1-10алкил, гетероцикл, гетероцикл-С1-10, С1-10алкил, гетероциклкарбонил, С1-10гидроксиалкил, С1-10триалкилсилил-С1-10алкил, H2NC(O)-С1-10алкил, ZaZbN-, ZaZbN-С1-10алкил, ZcZdNC(O)- или ZcZdNS(O)2; Za и Zb каждый независимо представляют собой водород, С1-10алкил, алкоксикарбонил-С1-10алкил, арил, арил-С1-10алкил, С3-8циклоалкил, H2NC(O)-, H2TN-С1-10алкилС(O)-, H2NC(О)-С1-10алкил, С1-10диалкилNС(О)- или С1-10диалкилNС(О)-алкил-;
Zc и Zd каждый независимо представляют собой водород, С1-10алкил, С1-10алкокси-С1-10алкил, арил, арил-С1-10алкил, арил- С1-10(гидрокси)алкил, С3-8циклоалкил, С3-8циклоалкил-С1-10алкил, гетероарил-С1-10алкил, гетероцикл, гетероциклС1-10алкил, С1-10гидроксиалкил, H2NC(O)-С1-10алкил-, С1-10диалкилNС(О)-С1-10алкил-, С1-10диалкилN-С1-10алкил- или CHZeZf;
Ze представляет собой арил или гетероарил;
Zf представляет собой гетероарил-С1-10алкил или гетероцикл-С1-10алкил;
m имеет значение 0;
а имеет значение 0 или 1;
b имеет значение 0, 1 или 2;
с имеет значение 0, 1, 2 или 3; d имеет значение 0, 1, 2, 3 или 4,
где арил означает фенил, дигидроинденил, инденил, нафтил,
дигидронафталинил или тетрагидронафталинил;
где гетероарил означает фурил, имидазолил, изоксазолил, изотиазолил, оксадиазолил, оксазолил, пиридинил, пиридазинил, пиримидинил, пиразинил, пиразолил, пирролил, тетразолил, тиадиазолил, тиазолил, тиенил, триазолил, триазинил, бензофуранил, бензоксадиазолил, 1,3-бензотиазолил, бензимидазолил, бензодиоксолил, бензотиофенил, хроменил, циннолинил, фуропиридин, индолил, индазолил, изоиндолил, изохинолинил, нафтиридинил, оксазолопиридин, хинолинил, тиенопиридин или тиенопиридинил; и
где гетероцикл означает азетидинил, азепанил, азиридинил, диазепанил, 1,3-диоксанил, 1,3-диоксоланил, 1,3-дитиоланил, 1,3-дитианил, имидазолинил, имидазолидинил, изотиазолинил, изотиазолидинил, изоксазолинил, изоксазолидинил, изоиндолин-1,3-дион, морфолинил, оксадиазолинил, оксадиазолидинил, оксазолинил, оксазолидинил, пиперазинил, пиперидинил, пиранил, пиразолинил, пиразолидинил, пирролинил, пирролидинил, тетрагидрофуранил, тетрагидротиенил, тиадиазолинил, тиадиазолидинил, тиазолинил, тиазолидинил, тиоморфолинил, 1,1-диоксидотиоморфолинил, тиопиранил, тритианил, 1,3-бензодиоксолил, 1,3-бензодитиолил, 2,3-дигидро-1,4-бензодиоксинил, 2,3-дигидро-1-бензофуранил, 2,3-дигидро-1-бензотиенил, 3,4-дигидро-1Н-изохромен-4-ил, 2,3-дигидро-1Н-индолил, сукцинимидил, 1,2,3,4-тетрагидрохинолинил, 2,3,4,4а,9,9а-гексагидро-1Н-карбазолил, 5а,6,7,8,9,9а-гексагидродибензо[b,d]фуранил или 5а,6,7,8,9,9а-гексагидробензо[b,d]тиенил.

2. Соединение по п.1, где А представляет собой (ii), (iii), (iv), (vii), (х), (xiv), (xv), (xvi), (xvii) или (xviii).

3. Соединение по п.2, где А представляет собой (ii),

R11 представляет собой С1-10алкокси-С1-10алкил, С1-10алкоксикарбонил, арил, арил-С1-10алкил, арил-С1-10 (гидрокси)алкил, арилокси-С1-10алкил, арилкарбонил, алкоксикарбонил-С1-10алкил, арил-С1-10тиоалкил, карбокси, карбокси-С1-10алкил, С3-8циклоалкил, С3-8циклоалкил-С1-10алкил, С3-8циклоалкилкарбонил, галоген, гетероарил, гетероарил-С1-10алкил, гетероцикл, гетероцикл-С1-10алкил, гетероциклкарбонил, С1-10гидроксиалкил, С1-10триалкилсилил-С1-10алкил, ZaZbN-, ZaZbN-С1-10алкил- или ZcZdNC(O)-;
Za и Zb каждый независимо представляют собой водород, С1-10алкил или H2N-С1-10алкилС(O)-;
Zc и Zd каждый независимо представляют собой водород, С1-10алкил, С1-10алкокси-С1-10алкил, арил, арил-С1-10алкил, С3-8циклоалкил, С3-8циклоалкил-С1-10алкил, гетероарил-С1-10алкил, гетероцикл-С1-10алкил, С1-10гидроксиалкил или С1-10диалкилN-С1-10алкил-; и
b имеет значение 0, 1 или 2.

4. Соединение по п.3, где
R11 представляет собой арил, арил-С1-10алкил, С3-8циклоалкил, С3-8циклоалкил-С1-10алкил или галоген;
b имеет значение 1 или 2.

5. Соединение по п.1, где А представляет собой (iii),

Riii представляет собой арил-С1-10алкил; и
с имеет значение 1.

6. Соединение по п.2, где А представляет собой (iii)

Riii представляет собой С1-10алкоксикарбонил-С1-10алкил, арил-С1-10алкил, С1-10цианоалкил, гетероцикл-С1-10алкил или H2NC(O)-С1-10алкил-;
с имеет значение 0, 1 или 2.

7. Соединение по п.2, где А представляет собой (iv)

Riv представляет собой арил, арил-С1-10алкил, гетероцикл, гетероцикл-С1-10алкил или ZaZbN-С1-10алкил или ZcZdNS(O)2-;
Za и Zb каждый независимо представляют собой водород или С1-10алкил;
Zc и Zd каждый представляют собой С1-10алкил; и
с имеет значение 0 или 1.

8. Соединение по п.2, где А представляет собой (vii)

Rvii представляет собой С1-10алкоксикарбонил, арил, арил-С1-10алкил, С3-8циклоалкил, гетероцикл-С1-10алкил, гетероциклкарбонил, С1-10гидроксиалкил или ZcZdNC(O)-;
Zc и Zd каждый независимо представляют собой водород, С1-10алкил, С1-10алкокси-С1-10алкил, арил, арил-С1-10алкил, арил-С1-10(гидрокси)алкил, С3-8циклоалкил, С3-8циклоалкил-С1-10алкил, гетероарил-С1-10алкил, гетероцикл, гетероцикл-С1-10алкил, С1-10гидроксиалкил или CHZeZf;
Ze представляет собой арил или гетероарил;
Zf представляет собой гетероарил-С1-10алкил или гетероцикл-С1-10алкил; и b имеет значение 1.

9. Соединение по п.2, где А представляет собой (vii)

Rvii представляет собой С1-10алкоксикарбонил, арил-С1-10алкил, С3-8циклоалкил, гетероцикл-С1-10алкил, гетероциклкарбонил, С1-10гидроксиалкил или ZcZdNC(O)-;
Zc и Zd каждый независимо представляют собой водород, С1-10алкил, С1-10алкокси-С1-10алкил, арил, арил-С1-10алкил, арил-С1-10(гидрокси)алкил, С3-8циклоалкил, гетероарил-С1-10алкил, гетероцикл- С1-10алкил или С1-10гидроксиалкил; и
b имеет значение 1.

10. Способ по п.2, где А представляет собой (vii)

Rvii представляет собой арил-С1-10алкил; и
b имеет значение 1.

11. Соединение по п.2, где А представляет собой (х)

R1 представляет собой водород;
Rx представляет собой арил или ZaZbN-;
Za и Zb каждый независимо представляют собой водород, С1-10алкил, арил или арил-С1-10алкил; и
b имеет значение 1 или 2.

12. Соединение по п.2, где А представляет собой (xiv)

R1 представляет собой водород;
Rxiv представляет собой ZaZbN-;
Za и Zb каждый независимо представляют собой водород или С3-8циклоалкил; и
с имеет значение 1.

13. Соединение по п.2, где А представляет собой (xv)

Rxv представляет собой ZaZbN-;
Za и Zb каждый независимо представляют собой водород, С1-10алкоксикарбонил-С1-10алкил, арил, арил-С1-10алкил или С3-8циклоалкил; и
d имеет значение 0 или 1.

14. Соединение по п.2, где А представляет собой (xvi)

R1 представляет собой водород;
Rxvii представляет собой ZaZbN-;
Za и Zb каждый независимо представляют собой водород или С3-8циклоалкил; и
d имеет значение 1.

15. Соединение по п.2, где А представляет собой (xvii)

R1 представляет собой водород;
Rxvii представляет собой ZaZbN- или арил;
Za и Zb каждый независимо представляют собой водород, С1-10алкил, С1-10алкоксикарбонил-С1-10алкил, арил, арил-С1-10алкил, С1-10циклоалкил или H2NC(O)-С1-10алкил; и
d имеет значение 0 или 1.

16. Соединение по п.2, где А представляет собой (xviii)

R1 представляет собой RaRbN-;
с имеет значение 0.

17. Соединение, выбранное из группы, включающей:
5-(1-бензил-1Н-1,2,3-триазол-5-ил)-1Н-индазольное соединение с 5-(1-бензил-1Н-1,2,3-триазол-4-ил)-1Н-индазолом;
5-(1-бензил-1Н-1,2,3-триазол-4-ил)-1Н-индазол;
5-[1-(2-метилбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(3-метилбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(4-метилбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(3-метоксибензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(2-фторбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(3-фторбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(4-фторбензил)-1H-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(2-хлорбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(3-хлорбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(4-хлорбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(2-бромбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(2-нитробензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(3-нитробензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(4-нитробензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
2-{[4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-1-ил]метил}бензонитрил;
3-{[4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-1-ил]метил}бензонитрил;
4-{[4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-1-ил]метил}бензонитрил;
5-{1-[2-(трифторметил)бензил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
5-{1-[3-(трифторметил)бензил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
5-{1-[4-(трифторметил)бензил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
5-{1-[3-(трифторметокси)бензил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
5-{1-[4-(трифторметокси)бензил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
5-[1-(4-трет-бутилбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
метил 3-{[4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-1-ил]метил}бензоат;
метил 4-{[4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-1-ил]метил}бензоат;
5-[1-(2,4-диметилбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(3,5-диметилбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(2,3-дихлорбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(2,4-дихлорбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(2,5-дихлорбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-(3,5-дихлорбензил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-{1-[2,4-бис(трифторметил)бензил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
N-циклогексил-6-(1Н-индазол-5-ил)имидазо[2,1-b][1,3]тиазол-5-амин;
N-циклогексил-2-(1Н-индазол-5-ил)имидазо[1,2-а]пиридин-3-амин;
N-циклогексил-2-(1Н-индазол-5-ил)имидазо[1,2-а]пиразин-3-амин;
5-[1-бензил-4-(4-фторфенил)-1Н-имидазол-5-ил]-1Н-индазол;
N-{3-[4-(4-фторфенил)-5-(1Н-индазол-5-ил)-1Н-имидазол-1-ил]пропил}-N,N-диметиламин;
5-[4-(4-фторфенил)-1-(1-фенилэтил)-1Н-имидазол-5-ил]-1Н-индазол;
4-(1Н-индазол-5-ил)-N-фенил-1,3-тиазол-2-амин;
N-этил-4-(1Н-индазол-5-ил)-1,3-тиазол-2-амин;
N-бензил-4-(1Н-индазол-5-ил)-1,3-тиазол-2-амин;
4-(1Н-индазол-5-ил)-1,3-тиазол-2-амин;
4-(1Н-индазол-5-ил)-N-(2-фенилэтил)-1,3-тиазол-2-амин;
N-бензил-2-(1Н-индазол-5-ил)имидазо[1,2-а]пиримидин-3-амин;
N-бутил-2-(1Н-индазол-5-ил)имидазо[1,2-а]пиримидин-3-амин;
N-(4-хлорфенил)-2-(1Н-индазол-5-ил)имидазо[1,2-а]пиримидин-3-амин;
2-(1Н-индазол-5-ил)-N-(4-метоксифенил)имидазо[1,2-а]пиримидин-3-амин;
2-(1Н-индазол-5-ил)имидазо[1,2-а]пиримидин;
метил N-[2-(1Н-индазол-5-ил)имидазо[1,2-а]пиридин-3-ил]глицинат;
N[-бензил-2-(1Н-индазол-5-ил)имидазо[1,2-а]пиридин-3-амин;
N(4-хлорфенил)-2-(1Н-индазол-5-ил)имидазо[1,2-а]пиридин-3-амин;
2-(1Н-индазол-5-ил)-N-(4-метоксифенил)имидазо[1,2-а]пиридин-3-амин;
трет-бутил 4-[4-(4-фторфенил)-5-(1Н-индазол-5-ил)-1Н-имидазол-1-ил]пиперидин-1-карбоксилат;
5-(1-бензил-1Н-1,2,3-триазол-4-ил)-1Н-индазол-3-амин;
5-[4-(4-фторфенил)-1-пиперидин-4-ил-1Н-имидазол-5-ил]-1Н-индазол;
5-{4-(4-фторфенил)-1-[2-(1-метилпирролидин-2-ил)этил]-1Н-имидазол-5-ил}-1Н-индазол;
5-{4-(4-фторфенил)-1-[3-(4-метилпиперазин-1-ил)пропил]-1Н-имидазол-5-ил}-1Н-индазол;
этил 5-(1Н-индазол-5-ил)изоксазол-3-карбоксилат;
5-(1Н-индазол-5-ил)-N-метилизоксазол-3-карбоксамид;
5-(3-бензилизоксазол-5-ил)-1Н-индазол;
N-бензил-4-(1Н-индазол-5-ил)-5-фенил-1,3-тиазол-2-амин;
4-(1Н-индазол-5-ил)-N,5-дифенил-1,3-тиазол-2-амин;
5-(1-бензил-5-циклопропил-1Н-1,2,3-триазол-4-ил)-1Н-индазол;
5-(1-бензил-4-циклопропил-1Н-1,2,3-триазол-5-ил)-1Н-индазол;
2-(1Н-индазол-5-ил)-3-фенилимидазо[1,2-а]пиримидин;
5-[1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-4-ил]-1Н-имидазол;
5-[3-(пиперидин-1-илкарбонил)изоксазол-5-ил]-1Н-индазол;
5-(1Н-индазол-5-ил)-N-фенилизоксазол-3-карбоксамид;
N-циклогексил-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-[3-(пиперидин-1-илметил)изоксазол-5-ил]-1Н-индазол;
[5-(1Н-индазол-5-ил)изоксазол-3-ил]метанол;
5-(1Н-индазол-5-ил)-N-(2-метоксиэтил)изоксазол-3-карбоксамид;
5-(1-бензил-5-фенил-1Н-1,2,3-триазол-4-ил)-1Н-индазол;
5-(4-бензил-1Н-1,2,3-триазол-1-ил)-1Н-индазол;
5-(1-бензил-5-циклопропил-1Н-1,2,3-триазол-4-ил)-1Н-индазол-3-амин;
5-(1-бензил-4-циклопропил-1Н-1,2,3-триазол-5-ил)-1Н-индазол-3-амин;
5-(3-бензилизоксазол-5-ил)-1Н-индазол-3-амин;
N-{2-[4-(4-фторфенил)-5-(1Н-индазол-5-ил)-1Н-имидазол-1-ил]этил}-N,N-диметиламин;
5-[4-(4-фторфенил)-1-(3-морфолин-4-илпропил)-1Н-имидазол-5-ил]-1Н-индазол;
5-[4-(4-фторфенил)-1-(3-пирролидин-1-илпропил)-1Н-имидазол-5-ил]-1Н-индазол;
5-{4-(4-фторфенил)-1-[2-(4-метилпиперидин-1-ил)этил]-1Н-имидазол-5-ил}-1Н-индазол;
5-[1-(1-бензилпиперидин-4-ил)-4-(4-фторфенил)-1Н-имидазол-5-ил]-1Н-индазол;
5-[4-(4-фторфенил)-1-(2-морфолин-4-илэтил)-1Н-имидазол-5-ил]-1Н-индазол;
5-[1-(1-бензилпирролидин-3-ил)-4-(4-фторфенил)-1Н-имидазол-5-ил]-1Н-индазол;
2-{4-[4-(4-фторфенил)-5-(1Н-индазол-5-ил)-1Н-имидазол-1-ил]пиперидин-1-ил}-2-оксоэтанол;
5-(1-бензил-5-фенил-1Н-1,2,3-триазол-4-ил)-1Н-индазол-3-амин;
2-[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]пропан-2-ол;
5-[4-(метоксиметил)-1Н-1,2,3-триазол-1-ил]-1Н-индазол;
1-[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]-1-фенилэтанол;
1-[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]пропан-2-ол;
3-[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]пропан-1-ол;
1-{[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]метил}-1Н-1,2,3-бензотриазол;
5-{4-[(фенилтио)метил]-1Н-1,2,3-триазол-1-ил}-1Н-индазол;
5-(4-циклопропил-1Н-1,2,3-триазол-1-ил)-1Н-индазол;
5-[4-(2-фенилэтил)-1Н-1,2,3-триазол-1-ил]-1Н-индазол;
5-[4-(циклогексилметил)-1Н-1,2,3-триазол-1-ил]-1Н-индазол;
5-(4-циклопентил-1Н-1,2,3-триазол-1-ил)-1Н-индазол;
1-[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]циклогексанол;
5-[4-(феноксиметил)-1Н-1,2,3-триазол-1-ил]-1Н-индазол;
5-(4-[(1,1-диоксидотиоморфолин-4-ил)метил]-1H-1,2,3-триазол-1-ил}-1Н-индазол;
5-[4-(3-фенилпропил)-1Н-1,2,3-триазол-1-ил]-1Н-индазол;
[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил](фенил)метанон;
N,N-диэтил-N-{[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]метил}амин;
этил N-[2-(1Н-индазол-5-ил)имидазо[1,2-а]пиримидин-3-ил]-бета-аланинат;
5-(1-бензил-5-метил-1Н-1,2,3-триазол-4-ил)-1Н-индазол;
5-(1-бензил-5-метил-1Н-1,2,3-триазол-4-ил)-1Н-индазол-3-амин;
N-[2-(1Н-индазол-5-ил)имидазо[1,2-а]пиримидин-3-ил]-β-аланинамид;
5-(1-бензил-5-иод-1Н-1,2,3-триазол-4-ил)-1Н-индазол-3-амин;
N-{3-[4-(3-амино-1Н-индазол-5-ил)-1-бензил-1Н-1,2,3-триазол-5-ил]фенил}-N'-(3-метилфенил)мочевину;
5-(1H-индазол-5-ил)-N-(2-изопропоксиэтил)изоксазол-3-карбоксамид;
5-[3-(морфолин-4-илкарбонил)изоксазол-5-ил]-1Н-индазол;
5-(1Н-индазол-5-ил)-N-(3-морфолин-4-илпропил)изоксазол-3-карбоксамид;
N-[2-(1Н-имидазол-4-ил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
(3R)-1-{[5-(1Н-индазол-5-ил)изоксазол-3-ил]карбонил}пиперидин-3-ол;
1-{[5-(1Н-индазол-5-ил)изоксазол-3-ил]карбонил}пиперидин-3-карбоксамид;
2-[2-(4-{[5-(1Н-индазол-5-ил)изоксазол-3-ил]карбонил}пиперазин-1-ил)этокси]этанол;
5-{3-[(4-метил-1,4-диазепан-1-ил)карбонил]изоксазол-5-ил}-1Н-индазол;
N-(3-гидроксипропил)-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[(1R)-2-гидрокси-1-фенилэтил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[3-(1Н-имидазол-1-ил)пропил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[3-(2-оксопирролидин-1-ил)пропил]изоксазол-3-карбоксамид;
N-{2-[4-(аминосульфонил)фенил]этил}-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил](3-хлорфенил)метанон;
[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил](циклопропил)метанон;
5-[5-циклопропил-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
N1-{[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил]метил}глицинамид;
(4-фторфенил)[4-(1Н-индазол-5-ил)-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-5-ил]метанон;
(4-хлорфенил)[4-(1Н-индазол-5-ил)-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-5-ил]метанон;
(3-хлорфенил)[4-(1Н-индазол-5-ил)-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-5-ил]метанон;
(2-хлорфенил)[4-(1Н-индазол-5-ил)-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-5-ил]метанон;
циклопентил[4-(1Н-индазол-5-ил)-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-5-ил]метанон;
1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоновую кислоту;
5-{5-(4-фторфенил)-1-[4-(трифторметил)бензил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол-3-амин;
5-[1-бензил-5-(4-фторфенил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол-3-амин;
[4-(1Н-индазол-5-ил)-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-5-ил](тетрагидро-2Н-пиран-4-ил)метанон;
5-[1-бензил-5-(2-метилфенил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-{1-бензил-5-[(4-метилпиперазин-1-ил)карбонил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
1-{[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил]карбонил}пиперидин-4-ол;
1-бензил-4-(1Н-индазол-5-ил)-N,N-диметил-1Н-1,2,3-триазол-5-карбоксамид;
N,1-дибензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
N-(2-гидрокси-2-фенилэтил)-5-(1Н-индазол-5-ил)-N-метилизоксазол-3-карбоксамид;
N-[(18)-2-гидрокси-1-фенилэтил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-бензил-N-(2-гидроксиэтил)-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-[1-бензил-5-(2-метилфенил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол-3-амин;
2-{2-[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]этил}-1Н-изоиндол-1,3(2Н)-дион;
5-{4-[(2,4-дихлорфенокси)метил]-1Н-1,2,3-триазол-1-ил}-1Н-индазол;
5-{4-[(2,6-дихлорфенокси)метил]-1Н-1,2,3-триазол-1-ил}-1Н-индазол;
5-[5-(4-фторфенил)-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
1-{[1-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-4-ил]метил}-1Н-индазол;
5-[1-бензил-5-(пиперидин-1-илкарбонил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[5-(2-метилфенил)-1 (тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[5-(2-метилфенил)-1-(тетрагидро-2Н-пиран-4-илметил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол-3-амин;
5-[1-бензил-5-(морфолин-4-илкарбонил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол;
5-[1-бензил-5-(4-метоксифенил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол-3-амин;
N-[(1S)-1-бензил-2-гидроксиэтил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[(1S,2R)-2-гидрокси-2,3-дигидро-1Н-инден-1-ил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-{3-[(3-фенилморфолин-4-ил)карбонил]изоксазол-5-ил}-1Н-индазол;
N-бензил-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
((1S)-2-{[5-(1Н-индазол-5-ил)изоксазол-3-ил]карбонил}-6,7-диметокси-1,2,3,4-тетрагидроизохинолин-1-ил)метанол;
N[(1R)-3-гидрокси-1-фенилпропил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N[(1S)-3-гидрокси-1-фенилпропил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-2,3-дигидро-1Н-инден-1-ил-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-2,3-дигидро-1Н-инден-2-ил-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(1-фенилпропил)изоксазол-3-карбоксамид;
5-{1-бензил-5-[3-(диметиламино)фенил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол-3-амин;
5-{1-бензил-5-[4-(диметиламино)фенил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол-3-амин;
N-{3-[4-(3-амино-1Н-индазол-5-ил)-1-бензил-1Н-1,2,3-триазол-5-ил]фенил}ацетамид;
N-{4-[4-(3-амино-1Н-индазол-5-ил)-1-бензил-1Н-1,2,3-триазол-5-ил]фенил}ацетамид;
5-{1-бензил-5-[3-(1Н-пиразол-1-ил)фенил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол-3-амин;
5-[1-бензил-5-(1-метил-1Н-пиразол-4-ил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол-3-амин;
3-[4-(3-амино-1Н-индазол-5-ил)-1-бензил-1Н-1,2,3-триазол-5-ил]-N-фенилбензамид;
3-[4-(3-амино-1Н-индазол-5-ил)-1-бензил-1Н-1,2,3-триазол-5-ил]-N-бензилбензамид;
5-[1-бензил-5-(1-метил-1Н-индол-5-ил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол-3-амин;
5-[1-бензил-5-(3-метоксифенил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол-3-амин;
5-[1-бензил-5-(3-морфолин-4-илфенил)-1Н-1,2,3-триазол-4-ил]-1Н-индазол-3-амин;
5-[3-(1,3-дигидро-2Н-изоиндол-2-илкарбонил)изоксазол-5-ил]-1Н-индазол;
5-{3-[(4-метил-2-фенилпиперазин-1-ил)карбонил]изоксазол-5-ил}-1Н-индазол;
1-{[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил]карбонил}пиперидин-4-амин;
N-[(1R)-1-бензил-2-гидроксиэтил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1-бензил-1Н-пиразол-4-ил)-1Н-индазол;
3-[4-(3-амино-1Н-индазол-5-ил)-1-бензил-1Н-1,2,3-триазол-5-ил]фенол;
3-[4-(3-амино-1Н-индазол-5-ил)-1-бензил-1Н-1,2,3-триазол-5-ил]бензамид;
5-{1-бензил-5-[4-(метилсульфонил)фенил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол-3-амин;
5-(1Н-индазол-5-ил)-N-[(1S)-1-фенилпропил]изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1R)-1-фенилпропил]изоксазол-3-карбоксамид;
5-(1-бензил-1Н-пиразол-4-ил)-1Н-индазол-3-амин;
1-бензил-4-(1Н-индазол-5-ил)-N-[(2S)-тетрагидрофуран-2-илметил]-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-4-(1Н-индазол-5-ил)-N-(2-изопропоксиэтил)-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-4-(1Н-индазол-5-ил)-N-[(2R)-тетрагидрофуран-2-илметил]-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-4-(1Н-индазол-5-ил)-N-(тетрагидрофуран-3-илметил)-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-циклопентил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-(циклопентилметил)-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-этил-4-(1Н-индазол-5-ил)-N-метил-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-4-(1Н-индазол-5-ил)-1,-изопропил-N-метил-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-4-(1Н-индазол-5-ил)-N-(2-метоксиэтил)-N-метил-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-4-(1 Н-индазол-5-ил)-N-фенил-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-(4-хлорфенил)-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-4-(1Н-индазол-5-ил)-N-(2-морфолин-4-илэтил)-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-[2-(диметиламино)этил]-4-(1Н-индазол-5-ил)-N-метил-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-(2-гидроксиэтил)-4-(1Н-индазол-5-ил)-N-пропил-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-[3-(диметиламино)пропил]-4-(1Н-индазол-5-ил)-N-метил-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-[2-(диэтиламино)этил]-4-(1Н-индазол-5-ил)-N-метил-1Н-1,2,3-триазол-5-карбоксамид;
N,1-дибензил-N-этил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
N,1-дибензил-N-(2-гидроксиэтил)-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
(3R)-1-{[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил]карбонил}пиперидин-3-ол;
1-{[1-бензил-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-ил]карбонил}пиперидин-4-карбоксамид;
5-{1-бензил-5-[(2,6-диметилморфолин-4-ил)карбонил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
5-{5-[(4-ацетилпиперазин-1-ил)карбонил]-1-бензил-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
5-{1-бензил-5-[(4-фенилпиперазин-1-ил)карбонил]-1Н-1,2,3-триазол-4-ил}-1Н-индазол;
1-бензил-N-[(1R)-1-(гидроксиметил)-2-метилпропил]-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-[(1S)-1-(гидроксиметил)-2-метилпропил]-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
1-бензил-N-[3-(1Н-имидазол-1-ил)пропил]-4-(1Н-индазол-5-ил)-1Н-1,2,3-триазол-5-карбоксамид;
3-[4-(3-амино-1Н-индазол-5-ил)-1Н-пиразол-1-ил]пропаннитрил;
2-[4-(3-амино-1Н-индазол-5-ил)-1Н-пиразол-1-ил]ацетамид;
метил 3-[4-(3-амино-1Н-индазол-5-ил)-1Н-пиразол-1-ил]пропаноат;
3-[4-(3-амино-1Н-индазол-5-ил)-1Н-пиразол-1-ил]пропанамид;
[4-(3-амино-1Н-индазол-5-ил)-1Н-пиразол-1-ил]ацетонитрил;
4-(3-амино-1Н-индазол-5-ил)-N,N-диметил-1Н-имидазол-1-сульфонамид;
5-имидазо[1,2-а]пиридин-3-ил-1Н-индазол-3-амин;
5-(1Н-пиразол-5-ил)-1Н-индазол-3-амин;
5-(1Н-имидазол-4-ил)-1Н-индазол-3-амин;
5-(1-бензил-1Н-имидазол-4-ил)-1Н-индазол-3-амин;
N-3,4-дигидро-1Н-изохромен-4-ил-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-(циклогексилметил)-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-(3-хлорбензил)-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(2-метоксибензил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[2-(трифторметил)бензил]изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[3-(трифторметил)бензил]изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[4-(трифторметил)бензил]изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(пиридин-2-илметил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(пиридин-3-илметил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(пиридин-4-илметил)изоксазол-3-карбоксамид;
N-(2-хлорбензил)-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-(4-хлорбензил)-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-]-N-[-(1-фенил-2-пиперидин-1-илэтил)изоксазол-3-карбоксамид;
N-[2-(1Н-имидазол-1-ил)-1-фенилэтил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-]-N-(2-морфолин-4-ил-1-фенилэтил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[2-(4-метилпиперазин-1-ил)-1-фенилэтил]изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(1-фенил-2-пирролидин-1-илэтил)изоксазол-3-карбоксамид;
трет-бутил 2-({[5-(1Н-индазол-5-ил)изоксазол-3-ил]карбонил}амино)-2-фенилэтилкарбамат;
5-(1Н-индазол-5-ил)-N-(1-нафтилметил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(2-фенилэтил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(2-пиридин-2-илэтил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(2-пиридин-3-илэтил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-(2-пиридин-4-илэтил)изоксазол-3-карбоксамид;
N-[2-(2-хлорфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[2-(3-хлорфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[2-(4-хлорфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-бензил-N-этил-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-метил-N-(1-нафтилметил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-метил-N-(2-фенилэтил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-метил-N-(2-пиридин-2-илэтил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1R)-1-фенилэтил]изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-1,2,3,4-тетрагидронафталин-1-илизоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1S)-1-(1-нафтил)этил]изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1R)-1-(1-нафтил)этил]изоксазол-3-карбоксамид;
N-[3-(диметиламино)-1-фенилпропил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-(2,3-дигидро-1,4-бензодиоксин-5-илметил)-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-(3,4-дигидро-2Н-1,5-бензодиоксепин-6-илметил)-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1-метил-1Н-индол-4-ил)метил]изоксазол-3-карбоксамид;
5-{3-[(3-фенилпирролидин-1-ил)карбонил]изоксазол-5-ил}-1Н-индазол;
5-{3-[(2-фенилпирролидин-1-ил)карбонил]изоксазол-5-ил}-1Н-индазол;
5-{3-[(2-фенилпиперидин-1-ил)карбонил]изоксазол-5-ил}-1Н-индазол;
5-(1Н-индазол-5-ил)-N-[(1S)-1-фенилэтил]изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1R)-1-(4-метилфенил)этил]-изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1S)-1-(4-метилфенил)этил]изоксазол-3-карбоксамид;
N-[(1R,2S)-2-гидрокси-2,3-дигидро-1Н-инден-1-ил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-(1R,2R)-2-гидрокси-2,3-дигидро-1Н-инден-1-ил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[(1R)-1-(4-бромфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[(1S)-1-(4-бромфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[(1R)-1-(4-хлорфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[(1S)-1-(4-хлорфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1S)-1-(2-нафтил)этил]изоксазол-3-карбоксамид;
N-[1-(4-этоксифенил)-2-гидроксиэтил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[2-гидрокси-1-(4-изопропилфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-(3,4-диметилфенил)-2-гидроксиэтил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[2-гидрокси-1-(2-метоксифенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
N-[2-гидрокси-1-(4-метилфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1R)-1-(2-метоксифенил)этил]-изоксазол-3-карбоксамид;
N-[(1S)-1-(3,4-дифторфенил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-[(1R)-1-(3-метоксифенил)этил]-изоксазол-3-карбоксамид;
5-(1Н-индазол-5-ил)-N-{(1R)-1-[3-(трифторметил)фенил]-этил}изоксазол-3-карбоксамид;
N-[1-(2,3-дигидро-1,4-бензодиоксин-6-ил)этил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид; или
N-[1-(3,5-дихлорфенил)-2-гидроксиэтил]-5-(1Н-индазол-5-ил)изоксазол-3-карбоксамид.

18. Фармацевтическая композиция, обладающая ингибирующей активностью в отношении киназы, включающая терапевтически эффективное количество соединения по любому из пп.1-17 в сочетании с фармацевтически приемлемым носителем.



 

Похожие патенты:

Изобретение относится к соединениям формулы (I) и их солям, где R1 представляет формулу -А11 -А12-; R2 представляет тетрагидрофурилметил, тетрагидропиранилметил или тетрагидропиранил; А11 представляет простую связь, метилен или 1,2-этилен; А12 представляет C1-6алкил, C3-6циклоалкил или C3-6циклоалкил, содержащий метил; R3 представляет метокси, циано, циклобутилоксиметил, метоксиметил или этоксиметил; и R4 представляет метокси или хлор.

Изобретение относится к соединениям формулы 1, где X и Т представляют собой N или С, Q представляет собой (3-7)-членный ароматический цикл, который содержит от О до 3 атомов азота в качестве членов цикла, и который необязательно бензоконденсирован, и замещен оксо; C1-С6-алкилом; галоген-С 1-С6-алкилом; гидрокси-С1-С6 -алкилом; C1-С6-алкокси; С6-С 10-арилом; или (3-7)-членным гетероарилом, содержащим от 1 до 3 атомов кислорода, Р представляет собой С1-С 6-алкил, необязательно замещенный галогеном, и R представляет собой группу, выбранную из: (i) - С1-С6 -алкил-R1, (ii) -NR2R3, (iii) -O-R4, (iv) -S-R5, (v) -C (=O)-R6 , (vi) необязательно замещенного (3-7)-членного гетероарила, содержащего от 1 до 4 гетероатомов, выбранных из атома азота, атома кислорода и атома серы, (vii) необязательно замещенного, насыщенного или частично ненасыщенного, единственного или конденсированного (3-10)-членного гетероцикла, содержащего от 1 до 4 гетероатомов, выбранных из атома азота, атома кислорода и атома серы, (viii) азидо; где каждый R1, R2, R3 , R4, R5, R6 является таким, как определено в формуле изобретения.

Изобретение относится к производному 2-аза-бицикло[3.3.0]октана формулы (I), со стереогенными центрами в (1S,3S,5S)-конфигурации, где А представляет собой тиазолил, который является незамещенным или монозамещенным, где заместитель независимо друг от друга выбирают из группы, включающей С1-4алкил, С3-6 циклоалкил и NH2; В представляет собой фенил, который является незамещенным или моно- или дизамещенным, где заместители независимо друг от друга выбирают из группы, включающей С 1-4алкил, трифторметил, NHC(O)СН3 и галоген; и R1 представляет собой группу имидазо[2,1-b]тиазолила или бензоизоксазолила, где названные группы являются независимо друг от друга незамещенными или монозамещенными, где заместители независимо друг от друга выбирают из группы, включающей C 1-4алкил; или R1 представляет собой группу 2,3-дигидробензофуранила; или его фармацевтически приемлемая соль.

Изобретение относится к соединению общей формулы: или его фармацевтически приемлемой соли, где кольцо А представляет собой фенильную группу, которая может содержать 1-3 заместителя, выбранных из группы заместителей , или тиенильную группу, которая может содержать 1-3 заместителя, выбранных из группы заместителей , L представляет собой одинарную связь или группу формулы -NReСО- (где Re представляет собой атом водорода), кольцо В представляет собой С6-14 арильную группу, которая может содержать 1-3 заместителя, выбранных из группы заместителей , или 5-10-членную гетероциклическую группу, которая может содержать 1-3 заместителя, выбранных из группы заместителей , значения радикалов X, Y, Z, R1 и R2 , R3, R4, R5 и R6 представлены в п.1 формулы изобретения, которое обладает эффектом ингибирования продукции белка А или эффектом ингибирования ВАСЕ1 и применимо в качестве профилактического или терапевтического средства от нейродегенеративного заболевания, вызываемого А .

Изобретение относится к соединениям бициклосульфонильной кислоты (BCSA) формулы: где: каждый из -RPW, -R PX, -RPY и -RPZ независимо представляет собой -Н или -RRS1; каждый -RRS1 независимо представляет собой -F, -Cl, -Br, -I, -RA1, -CF 3, -ОН, -OCF3 или -ORA1; при этом каждый RA1 независимо представляет собой С1-4 алкил, фенил или бензил; и дополнительно, две соседние группы -RRS1 могут вместе образовать -ОСН2О-, -ОСН2СН2О- или -ОСН2СН2 СН2О-; -RAK независимо представляет собой ковалентную связь, -(СН2)- или -(СН2) 2-; -RN независимо представляет собой -R NNN, или -LN-RNNN; остальные значения радикалов представлены в п.1 формулы изобретения, действующим как ингибиторы фермента, конвертирующего фактор некроза опухоли - (ТАСЕ).

Изобретение относится к 3-аза-бицикло[3.3.0]октановым производным формулы (I), где R1 и R2 представляют собой водород, С1-4алкил или фтор; R3 представляет собой фенил, который является незамещенным, моно- или ди-замещенным, где заместители независимо друг от друга выбирают из группы, включающей С1-4алкил, С1-4алкоксигруппу, трифторметил, трифторметоксигруппу и галоген; 2,3-дигидробензофуранил; 2,3-дигидробензо[1,4]диоксинил; или изоксазолил, пиридил, индазолил, бензофуранил, бензоксазолил, бензоизоксазолил, бензотиазолил, бензоизотиазолил, пирроло[2,1-b]тиазолил, имидазо[1,2-а]пиридинил или имидазо[2,1-b]тиазолил, где названные группы являются незамещенными, моно- или ди-замещенными, где заместители независимо друг от друга выбирают из группы, включающей С1-4алкил, С 1-4алкоксигруппу, галоген и трифторметил; А представляет собой или ;R4 представляет собой С 1-4алкил или -NR6R7 ; R6 представляет собой водород или С1-4 алкил; R7 представляет собой водород или С1-4 алкил; и D представляет собой фенил, который является незамещенным, моно- или ди-замещенным, где заместители независимо друг от друга выбирают из группы, включающей С1-4алкил, С1-4 алкоксигруппу, трифторметил и галоген; или фармацевтически приемлемая соль такого соединения.

Изобретение относится к новым антибактериальным соединениям формулы I гдеR1 представляет собой галоген или алкоксигруппу; U и W каждый представляет собой N, V представляет собой СН и R2 представляет собой Н или F, или U и V каждый представляет собой СН, W представляет собой N и R2 представляет собой Н или F, или U представляет собой N, V представляет собой СН, W представляет собой СН или CRa и R2 представляет собой Н, или также, когда W представляет собой СН, может представлять собой F; R a представляет собой CH2OH или алкоксикарбонил; А представляет собой группу СН=СН-В, биядерную гетероциклическую систему D, фенильную группу, которая является моно-замещенной в положении 4 С1-4 алкильной группой, или фенильную группу, которая является ди-замещенной в положениях 3 и 4, где каждый из двух заместителей независимо друг от друга выбирают из группы, включающей С1-4 алкил и галоген; В представляет собой моно- или ди-замещенную фенильную группу, где каждый заместитель является атомом галогена; и D представляет собой группу где Z представляет собой СН или N и Q представляет собой О или S; или солям таких соединений.

Изобретение относится к средству для активации липопротеинлипазы, включающее производное бензола общей формулы (1) ,которое используется для профилактики и лечения гиперлипидемии и ожирения.

Изобретение относится к способу получения соединения, представленного формулой (А). .

Изобретение относится к соединениям формулы (I), их стереоизомерам, транс- и цис-изомерам, рацематам или фармацевтически приемлемым солям, которые обладают модулирующей активностью в отношении гистаминовых Н3-рецепторов.

Изобретение относится к соединениям формулы (I), его фармацевтически приемлемой соли, где каждая пунктирная линия (представленная как ) представляет собой необязательную двойную связь; Х представляет собой N или СН; R1a и R1b независимо представляют собой водород или С1-6-алкил; L представляет собой -O-; R2 представляет собой водород; R3 представляет собой водород или C1-6-алкил; R4 представляет собой хинолинил, замещенный одним, двумя или тремя заместителями, выбранными из С1-6-алкила, С1-6 -алкилокси, тиазолила или пиразолила, где указанные тиазолил или пиразолил замещены на любом атоме углерода C1-6 -алкилом; n равно 3, 4, 5 или 6; р равно 1 или 2.

Изобретение относится к N-оксидам октагидро-пирроло[3,4-b]пиррола или их фармацевтически приемлемым солям общей формулы (I), где Z1 представляет собой N или СН. .

Изобретение относится к производным тетрагидроимидазо[1,5-а]пиразина формулы I или к их фармацевтически приемлемым солям где Аr представляет собой фенил, где фенил дополнительно замещен 1-3 заместителями, независимо выбранными из галогена; R1 представляет собой трифторметил; R 2 выбран из группы, состоящей из гидроксила, алкила, имеющего от 1 до 4 атомов углерода, алкоксила, имеющего от 1 до 4 атомов углерода, циклоалкила, представляющего собой 5-6-членную полностью состоящую из углерода моноциклическую кольцевую группу, и -NR 4R5, где каждый алкоксил возможно замещен одной группировкой, выбранной из группы, состоящей из фенила и -OC(O)OR 8; R3 выбран из группы, состоящей из атома водорода и алкила, имеющего от 1 до 4 атомов углерода; каждый из R 4 и R5 независимо выбран из группы, состоящей из атома водорода, алкила, имеющего от 1 до 4 атомов углерода, циклоалкила, представляющего собой 3-8-членную полностью состоящую из углерода моноциклическую кольцевую группу, фенила и пиридинила, где алкил или фенил каждый возможно замещен одной или более чем одной группировкой, выбранной из группы, состоящей из галогена, цианогруппы, -SO2R7, -NR4R 5 и -С(=O)ОСН3; или R4 и R5 вместе с атомом, к которому они присоединены, образуют 5-6-членный гетероцикл, где 5-6-членный гетероцикл необязательно содержит один или более чем один атом N, О или S, и каждый 5-6-членный гетероцикл возможно замещен одной или двумя группировками, выбранными из группы, состоящей из галогена, гидроксила, аминогруппы, алкила, имеющего от 1 до 4 атомов углерода, гидроксиалкила, имеющего от 1 до 4 атомов углерода, -SO2R7, -C(O)NR 4R5, -C(O)R7, =O; R7 представляет собой алкил, имеющий от 1 до 4 атомов углерода; и R8 выбран из группы, состоящей из алкила, имеющего от 1 до 4 атомов углерода, и циклоалкила, представляющего собой 5-6-членную полностью состоящую из углерода моноциклическую кольцевую группу.

Изобретение относится к новым производным азоиндолизинов или их фармацевтически приемлемым солям, обладающим ингибирующей активностью в отношении Mek-киназы. .

Изобретение относится к соединениям, в которых R представляет собой смесь энантиомеров, а также к соединениям, в которых R является энантиомерно обогащенным или энантиомерно чистым.
Наверх